Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "kill it"
-
A little ago, a devRant user drew something awesome (fantasy stylish) of another devRanter.
I said in the comments that I'd kill for a drawing of my own character!
A day later I got a mention. He'd drawn my character!
Thanks a lot @ichijou! I find it awesome, it's in a frame on my wall now :D30 -
Management: "We have a Team Building session next week"
Colleague A: "Paintballing"
Colleague B: "Go-Karting"
On the day: "Welcome. Today we will be playing an IT Helpdesk Role Playing Game"
Kill me.7 -
So there is this girl who was trying to be cute and wrote a mock C code for me :
She wrote :
If(existence=disapointment)
printf("kill self");
else
printf("what else??");
And without hesitating I told her that her code had a fault in it and it would always print "kill self" no matter what the level of disappointment is. And asked her to fix it.
The way she fixed it was probably best described as the situation when you have no idea what you are doing and you don't try to understand either. (or was simply passive aggressive) :
If(existence=disapointment)
printf("kill self");
else
printf("kill self");
Honestly though I hope she was being passive aggressive because boy do I pity people who confuse between '=' and '=='12 -
My Linux machine completely froze up so I used another Linux machine to ssh into it and kill the misbehaving process.12
-
Android studio gradle takes so much time to build. I decided to draw something to kill time whenever it build.
Day 3: Starlord is nearly complete.10 -
Me at the office, Boss calling me by phone..
Boss: Hi, I need a new Build of XX Android app for another client.. set the base address at x.x.x.x and send me an APK file
Me: OK, I will do it.
Boss: can you do it in 5 minutes?
Me: Sure, it's simple..
Android Studio: You think it's simple !
* Indexing Files
* Sync Project
* Gradle Build
* Indexing....
* Some f* tasks
Oh kill me now !!4 -
I strongly dislike the www part in domain names (the subdomain, really), that's not really news anymore.
Loads of sites use it which I find annoying as fuck for some reason but so be it. (I understand that its very logical to loads of people)
And then you get a client who calls in because the email server isn't accepting her username/password.
*looks into the logs*
"incorrect authentication data: info@www.herdomain.com"
Kill it with fucking fire.18 -
Back in 2011 when I was 14, I created a cmd shortcut on all pc in my school's computer lab. Replaced the icon and renamed it to Internet Explorer. Deleted the original IE shortcut and a week later the lab got closed because they all the computers got infected with a "virus"
i know im lame kill me7 -
Pro tip:
Although 'hmm either kill it or if that doesn't work, sacrifice some of its children' is a perfectly valid sentence in the sysadmin world, it's not in public.
😅10 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I wonder if those people who give unwarranted useless advice to developers go to their doctors and do the same thing.
- Doc, just make a small slit, take out old heart, put in a new one, connect everything back as before and stitch it. Easy peasy. Shouldn't take more than a few minutes.
- my leg is fractured. Just open it and tape it back. It is a hack job, but it'll make the client happy for now. It will be quickly done.
- I think I have cancer. Just write a script to kill it. Shouldn't be too difficult.
Fuckers.4 -
So, I just got up, opened my sister's laptop to work (she gave it to me while I was in this small trip) and I see this. She was like "if you break it, I'm gonna kill you" and I said "oh no! What am I gonna do? Hammer it or something?" Fuck my luck, seriously16
-
this one time my coworker was having a hard time debugging a javascript function so he set it to alert("kill me pls") and that somehow got into production.
we recieved many support emails from concerned customers that day6 -
If Windows 10 auto changes my keyboard to US one more fucking time I'm going to move it off my PC on to an external HDD and fuck it in a fucking volcano before moving to Linux.
SORT YOUR SHIT OUT WINDOWS, I'M CLEARLY IN THE FUCKING UK.
/Rant19 -
Today pranked my colleague changing some semicolons in his PHP Code to greek question marks.
It took him tears, sweat and a long time until I told him.
Now he wants to kill me.
XD9 -
Customer sends an email complaining about his WordPress website getting a score of 2 out of 100 on Google PageSpeed Insights. I open their website, a video is being used as wallpaper. I open their PageSpeed Insights report, and it says reduce payload to less than 100MB.
Can I go kill myself now?23 -
When the entire platform mysteriously goes down for a half hour at 11pm ON A SATURDAY AND YOU'RE THE ONLY PERSON WHO WORKS ON IT GOOD GOD SERIOUSLY YOU'VE GOT TO BE SHITTING ME I JUST WANT TO SLEEP
WHOEVER DID THIS I WILL FIND YOU AND I WILL KILL YOU3 -
*offering sweets to a fellow at work
Colleague: Oh I'm a diabetic but What you've got here aaaaaa.....
My Brain:
Don't say it
Don't say it
Don't say it
Don't say it
Don't say it
Don't say it
Don't say it
Me: Oh come-on already One small piece won't kill you11 -
God damn it udemy, you have courses on the fundamentals of ass wiping but I can't find a good quality c++ from scratch course
༼ つ ◕_◕ ༽つ Kill me15 -
I would kill all these +1 guys, srsly. I subscribe these threads to know if it will be implemented.
You do not add any value to issue:
* devs are pissed off as this does not help solving problem
* others are pissed off
No one really cares about your likes, really.28 -
1.5 hours of UI and performance enhancements for the UWP app on Windows Phone, and guess what greets me when I plug it in.
//kill me
//yes I restarted both9 -
Epic team fail. I bought a mechanical keyboard, plugged it in typed one word and the team wanted to kill me.
I don't know much about keyboards, but turns out it had blue, very loud, very clicks switches.
Keyboard was unplugged, wrapped up and put back in the box ready to be returned.13 -
Got a call while on vacations, the main server is down.
*holy shit* I thought.
As I opened my MacBook, the phone kept ringing and slack was going crazy.
“What should I do? Where is the problem?”, the voices in my head said..
I opened the terminal and tried to get a ssh connection.
Sweat was dropping down from my forehead.
“Connected” the terminal said.
“Fuck yeah, the server is up, only the app is not responding”, I thought and opened the log files.
Suddenly, “STOP” I shout at the log files that were appended way too fast.
Then I saw it.
TimeOutExceptions..
I added an index to the modification date column,“ kill -9“ed the process, started again and went back to vacation mode 🙂
And of course I was the office hero for a while💪
For the smart asses, I’m aware that it’s a bad idea to -9 the app process in prod, but it was so overloaded that i was not able to kill it any other way. And we needed that server up again.4 -
Proprietary video format. Native iOS app. Ok.
Using swift to decode and render. Ok.
Kills battery and is actually too slow on older devices. Ok..
Diving into armv7 neon assembly, it puts the "ok" in "pleasure".. Ok.....
Getting it to work. Fast frames. Yes. Ok!
Battery still stressed..ok.
Just need to get rid of the brown tint.. ok.
The tint became a brand mark. iPhone gone. Ok! Hours later, received email.
Vendor upgraded to serve h264 over http.
"Kill yourself with fire, ok?"2 -
WTF - I discovered that wasps listen to me!
Earlier when one came in, I tried to catch it with a glass and release it, or kill it if that wasn't feasible. This year, I tried pointing to the window and ordering "get out!" just because I was too lazy to take action. Of course, I didn't expect it to work, but it did. I thought it was only a coincidence, so I kept trying it. It works every single time!
Crazy shit!14 -
You can kill me for this...
I've one old printer and and I wanted to print some pages. So I did following steps
1. Plugged printers power cable and turned it on.
2. Connected included cable to printer.
3. Opened PDF and tried to print
4. Did step 3 for fucking 20minutes
What went wrong?
I fucking forgot to connect USB cable to my fucking laptop. FML...8 -
WHAT THE FUCK
WHY DOES SHIT RENDER DIFFERENTLY ON CHROME AND SAFARI
I SPENT A LONG ASS TIME TRYING TO MAKE A SMALL DIV PERFECT BUT FUCK ME IT ONLY WORKS ON CHROME
AND THE ONLY THING THAT WORKS ON SAFARI IS SOME HACK
WTF KILL ME I DONT WANT TO LIVE ANYMORE15 -
Managers: fullStackClown!!!! The image uploader on the dashboard at <insert 3rd party service here> isn't working!!!!!
fullStackClown: Yeah? What do you want me to do about it?
Managers: Well, fix it!
fullStackClown: ... * sigh * Well, in case you didn't realize, I don't work at <insert 3rd party service here>, so... unless you want me to go work for them instead of you absolute clowns (which I dream about daily), I cannot help you further in this matter.
Managers: ...
fullStackClown: ...
Kill me. 🤡6 -
AM I THE ONLY PERSON WHO READS THE CSS !important RULE AS ACTUALLY SAYING THAT SOMETHING IS _NOT_ IMPORTANT EVEN WHEN IT MEANS THAT IT _IS_?!!
Just kill me.7 -
When a A.I. is gonna take over my job, Im gonna build a robot to steal the job of the A.I. and then kill it.
Maybe the robot will kill all of humanity, but yolo let's try it. Wanna see a real life terminator 😂4 -
Five US quarters are about 1oz in weight and should hold down most keys on most keyboards.
I knew this because we had an error on a server with a pop up window that was only "ok". We couldn't kill the process because critical so we left a stack of change on enter until it it was done running and we could leave for the night.3 -
Okay, just wrote a program with memory allocation inside an accidental infinite loop and by the time I was able to kill it, it had already claimed 86% of my memory. Scared the shit out of me because my OS was CRAWLING for a while3
-
Guy: - "Your restart script doesn't work."
Me: - "What do you mean?"
Guy: - "It does nothing."
Me: - "It should kill every processes that's running within the project and start them again. Wait... Why do you terminate it?"
Guy: - "I don't. It just stops."
Me: - "It says `Terminated` here. You killed it. Just let it do it's job, don't kill it."
Guy: - "I'm not killing it! It just stops!"
(...two hours later...)
Me: - "Wait... Where do you run it from?"
Guy: - "What do you mean? I just run the script you gave me."
Me: - "Yeah, but where do you run it from? Where did you put it?"
Guy: - "It's part of the project so I put it in the project, d'oh!"11 -
Dad : My WhatsApp has an issue and you're a software engineer. Fix it
Me : Looks like a Android bug...can't do anything.
Dad : Come with me, this guy at the shop around the corner who does prepaid talk time recharge will fix it... learn from him
Me : facepalm , gotta kill that guy1 -
Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!17 -
Friend,
I signed a petition on Action Network urging Congress to reject the dangerous EARN IT Act and protect our online free speech.
The Eliminating Abusive and Rampant Neglect of Interactive Technologies Act of 2019 — also known as the EARN IT Act — gives Attorney General Willliam Barr the power to demand that tech companies kill important encryption programs. That puts us all at risk of government censorship, cybersecurity breaches, and human rights abuses.
Don’t let Congress chip away at your essential freedoms online. Sign our petition now to tell your lawmakers to reject the dangerous EARN IT Act: https://actionnetwork.org/petitions...
Thanks!5 -
Me : Who wrote that monstrosity of code ? I’m going to kill someone!
Git blame !
Me : Oh never mind, it was me 4 yeas ago.10 -
[Found on tumblr]
It only takes a minute of your time, so please call EVERYDAY to save net netrality. Here is the link:
https://www.battleforthenet.com/
Also if you are like me and get nervous with phone calls, use this. You won't have to talk to anyone: https://resistbot.io/
We can also kill the piece of shit, Ajit Pai, that would be a much easier solution ;)4 -
Some years ago I was in cyber security in the military being shown some new tech for our use. Was challenged to try and get past it after being explained it's basics. Took me one long line in Linux about 10 seconds.
Anomaly detection firewall with machine learning seemed like a good idea.
Setting it to aggressive response and then change the package header to the firewall's own address however made it kill itself.
We didn't deploy that firewall that I know of.5 -
#programmingstuff
A parent may kill it's children if the task assigned to them is no longer needed.
*Don't apply it to real world.5 -
Why are clients so ignorant and stupid?!
Send them the software with specific instructions WHERE to install it. Location is important as it is a plugin for AutoCAD.
First mail with complains about the plugin doesn't work. Find out (in the mail they sent internal) that they installed the plugin somewhere else than I instructed them.
Sent an email back with (again) an explanation why it doesn't work and where to install the plugin.
Email from client: So I put the plugin here [incomplete and invalid location] and create the last folder myself...
FOR FUCK SAKE SRUPID ASS IGNORANT DOWN SYNDROM (sorry folks) MOFO CLIENT!!!!
I SENT YOU UP TO 3 TIMES WHERE TO PUT THE GODDAMNED PLUGIN!7 -
Me: *kills process*
Linux: 3243 killed.
Me: "sudo netstat -ntlp | grep 3243"
Linux: 3243 running.
* hour later *
Me: *kills process with 3045974th method*
Linux: 3243 killed.
Me: "sudo netstat -ntlp | grep 3243"
Linux: 3243 running.
Me: "Are you absolutely FUCKING kidding me?! What is this fucking thing, the god damn grim reaper? I've done some SKETCHY fucking things at the terminal to kill this BASIC fucking server and it is still running!! WHAT THE FUCK ARE YOU?!"
Manager: *peeks in helpfully* "Did you try the 'kill' command?"15 -
This code is so bad,
If it were a bridge it would kill hunderds of people.
If it were an electric grid it would, plunge thousands of households into darkness
It is so bad,
If it were an operationsystem it would be WINDOWS2 -
I really hate fucking Wordpress!
I hate it's stupid API, with it's stupid hooks and actions and all those stupid functions and no fucking logic to any of it!
I hate it's stupid plugin system, with all that fucking overhead that brings no real value and adds all that complexity for nothing!
I hate stupid fucking multiple calls for the same fucking assets, loading them over and over again because every stupid plugin calls them again and again!
I hate motherfucking SHORTTAGS, or whatever the fuck they are called!
I hate that every stupid fucking plugin and shortcode and fucking every little fucking piece of HTML comes from a different fucking place, with different fucking structure and different fucking classes and stupid fucking loading seaquences that make no fucking sense!
And I hate fucking page builders !!!!!
Fuck!!!!
I should be fucking coding on this fucking peace of shit, but I just cannot fucking take it any more!!!
IT NEEDS TO FUCKING DIE!
It should be relegated to the darkest corners of the internet and all the servers that have it's fucking code anyware on their systems should be disconnected and buried in the deepest pits of hell, just to be sure it never, EVER, surfaces again!!!
AAARRRRGGGHHHHHHH !!!!!!!!!5 -
LPT: If you use Linux, always carry another one in your pocket (flash drive) in case you'd need to fix your main one after you kill it again7
-
Apparently color pair 0 is reserved in curses.
So modifying it will never work.
Even though that's not in the documentation.
I've wasted hours.
I finally changed the color pair to 1 and everything worked.
God.
Kill me now.2 -
I'm such a dumb fuck....
It took me fucking 30 mins to figure out that I use a function which relies on a copy of an object that's copied one line after the function call instead of before...
PLEASE KILL ME8 -
I really, really need an office. Today I've been in a meeting for 2 hours with my mum hoovering in the background and my sister playing the entire fucking soundtrack to Chicago. FUCKING KILL ME!!!
Every time I fucking talk all you can hear is "'n' all that jazz" in the fucking background.
I CAN'T TAKE IT ANYMOREEEEE D'X14 -
IT is so violent and disturbing when it comes to technical terms in relation to clusters:
- master / slave
- master / master / witness (crime scene?)
- splitbrain (how does that look in reality?)
- stonith (shoot the other node in the head)
- deadtime (no heartbeat)
- slicing (wtf?)
- shard (do they kill with that?)
- active / passive (sex scene?)
- single point of failure (at least they know who is to blame)
- share nothing / shared all (dictators vs communism)
😯7 -
Two weeks ago, I chose my modules for my Master in Data Science. This morning, I received an e-mail to tell me it was a bug, I was not accepted.
.
So what's now
.
I guess I will kill myself6 -
The codebase I'm working with hss rarely comments on it. But when there are comments written they are shit like:
//Kill Matt
//don't ask me where that hard-coded value came from, it just works
//we have to add the elements to the fucking list
Reeeeally helpful. Yep.2 -
The guy that developed this template redefined every bootstrap class and now i have to maintain it... kill me please6
-
GUYS I BUILT A FUCKING URL BAR AND IT EXISTS, IT'S ALIGNED, AND IT FUCKING WORKS
It doesn't have a very good check for what is a valid url tho, it is currently working checking for subreddits like /r/<whatever> and it checks if the link begins with http:// or https://. At some point in the near future I want to clean it up a bit, maybe write some regex (oh god kill me now) that'll actually check for a valid url7 -
My last day before vacation, Friday after hours,
Me as a Junior dev, not that experienced with bash.
An unfortunately with root on a prod machine.
I wrote a script and wanted it to stop at a specific point, but couldn’t remember which of those cmd it was so I wrote all of them.
Quit
Close
Stop
Halt
Exit
Ran the script.
Wanted to kill myself.
I haven’t had the privs to turn on the VM again.
¯\_(ツ)_/¯
🤦🏽♂️
I definitely learned a lot!2 -
I am not a front end developer. Don't have the skill set, but I am learning. Work assigns me an "easy" task of modifying someone else's angular code(with all those <div> tags) to change some functionality. If it was well formatted, easy shit.
WHY THE FUCK DID THE PREVIOUS FUCKER INDENT LIKE THEY HATE ME? PARENT TAGS ARE FARTHER OUT THAN CHILDREN TAGS. SOME OF THE TAGS ARE 10 TABS FROM THE LEFT, WHILE THEIR CHILD IS ONLY 2. IN ADDITION, ALL THEIR CODE IS COPY PASTED FROM OTHER FILES, REFERENCES CONTROLLERS FROM OTHER PARTS OF THE CODE IT DOESNT NEED!
I am tempted to kill it with fire, find the person who wrote it(on a different continent), kill them, and then rewrite the whole thing in a language I am still learning. FUCK!2 -
Oh the beauty of WYSIWYG etitors...
I don't know which one I'm more amazed of. All that beautiful styling for a simple line break or that incredibly accurate and absolute neccessary line-height value.
I guess it's time for a strip tag massacre.4 -
!rant
Told a friend I was just killing time. He said "I feel sorry for time. People have been trying to kill it for years."5 -
Spent a month working on a website that relied on crawled data
Got the memory leaks and usage down from 700mb to ~150mb
CPU usage from ~100% to <5%
Shrink-wrapped the DB requirements based on data
Created self-supporting services and what not
When everything FINALLY worked good enough for me to look at it and go "damn, this actually worked"
the whole monitoring sys got dyed in red :v
A quick look up and my crawlers exhausted my godaddy's per-user db limits.
Kill me.
Just fuckin kill me.7 -
Eclipse: Hey, I found a nice little update for you
Me: ok, install it
Eclipse: nope, I can't find it ...
AAAAAAAHHHH I'm gonna kill you !!!!!4 -
Was thinking of upgrading my HDD to SSD.
Decided to make a post on Reddit to seek advice. Bloody laptop froze.
Had to kill it and force restart it. Seems like my laptop can read the posts that I am making.
What luck!22 -
Scientists have found that If you just kill the Chrome process, it can give you enough charge to fully charge your Mobile Phone.2
-
The entire modern gaming ecosystem is a scam.
I added The Crew: Motorfest trial version to my library for free.
Click on Install and it downloads 43 GB of data.
Now it's time to launch.
Click on launch and Ubisoft Connect takes over and it starts downloading another 43 GB??????
WTF ??
If I can't even get the trial version of a game without nearly wanting to kill myself, how does the company expect me to pay full price for it?
Piracy FTW. Fuck all the companies.16 -
QA: When I start the onboarding process, kill the app and reopen it, I return to where I left off with no way to go back to the previous screen.
Me: Please click the back button in the top left corner5 -
I'M GONNA KILL THIS MAC
what the FUCK!!!???!!!??? IT WORKED YESTERDAY!!!!
Now the whole iOS build pipeline fails again complaining smth about distribution profiles. Then about certificates. And then it starts using a completely unrelated certificate and complaining that provisioning profile does not include it...
what the f...
IT FUCKING WORKED YESTERDAY!!!!!!26 -
Love being contacted by a consultant.
At 7PM.
Via WhatsApp.
Becuase they recently "migrated to gmail" (wtf does that even mean?!?! it was their reason why I didnt get their email)
I fucking hate zoomers, please kill me, i have made a mistake working with these clowns
🤡5 -
FUUUUUCKKKKKKKKKKKKKK.
Im trying to rebuild a project but the .exe is active and everytime I kill it a new one spawns......
So my only option left is to restart my laptop. The thing is I always hibernate and that has come to bite me in the ass..7 -
I just want a coffee machine that is smart enough to know when I need coffee and then serves it on my desk.
(Also this coffee machine should automatically kill all annoying client's)5 -
Oh my fucking god people are stupid, or ignorant, or fucking both.
How hard is it to copy a password from an email and paste that fucker in and press login.
Seriously several times of “this is your email” and “THIS” is your god dam fucking password.
God kill me now.
(No the password isn’t stored in plaintext, I reset it myself before sending it to the user)1 -
> worst coding procrastination story
worst and best at the same time:
If you wait long enough things might resolve themselves.
My team inherited an ancient site. Hosted on an old host that the org wanted to kill, using an old log service the org wanted to kill.
A ticket was written in 2021 to migrate that site's hosting and logging to the new services our org started using.
My team kept avoiding it since it was a cheap unimportant site.
in 2023 we were about to finally take action - then we hear "Turns out the new hosting platform and logging platform are way too expensive - I know all of you have migrated to these new services but you gotta revert and go back the old ones til we figure this out"
We didn't have to do squat.
Problem solved by procrastinating ✅1 -
Hotest bug: a server in Vietnam kept going offline then popping back a few seconds later. While logged on I couldn't find anything wrong, so eventually I decided to go check on it. It turns out the aircon in the server room situated right above the server has started leaking, so the ever-helpful ops people onsite has wrapped the whole rack in plastic, covering all vents. Surprisingly hard to kill, old HP servers...1
-
Somebody please kill Pinterest!
Pinterest is a cancer that has turned searching by image into a pointless effort. If you search by image, you want to discover the image's original source. Instead you get 1000 Pinterest boards with the image in it.5 -
*installing linux on my mini laptop*
- Dad: "you should make a backup image of windows 10"
- Me: "LOL NOPE!"
(With 2gb of ram, linux makes it the perfect lightweight coding machine. But with W10? Jesus christ)6 -
I have code convention OCD.
My team really fucked up the code with their different indentation styles, and it really makes me want to kill them!! 😡😡😠3 -
True story
Was free at work so applied for a stretch project.
PM: you know mobile dev?
Me: yes, built a few apps
PM: good, we have an old app we want you to take the JAR change everything but the look of it and make it a new hybrid app with the required features.
Me: *kill me please*
PM: and use WordPress as the server.
Me: ...........
Accepted the challenge. Did the entire app in ionic and build a server for it with SpringBoot. Client loves it PM is still doesn't know😂2 -
I REALLY HATE IIS. IT IS THE STUPIDEST FUCKING PLATFORM. FUCK. WHERE THE FUCK ARE MY FUCKING ERROR LOGS YOU STUPID PIECE OF FUCKING CRAP. FUCKING KILL ME YOU STUPID SERVER ASS BITCH CUNT2
-
!!psa
Terminator's broadcast feature was sending duplicate input to all non-focused terminals yesterday, and it was pissing me off.
After some digging and research, it turns out the ibus daemon was the cause. If you're having this happen, track ibus down and kill it.2 -
Me: hmmmm it's a pain in the ass building my program and having to rebuild it everytime I want to swap to my Chromebook (going from x86 to ARM64), I really wish they could develop an OS that is essentially a VM so you would compile once and have the OS' VM later do the heavy lifting
My brain: hey Alex, that sounds like a great idea, you deserve a coffee for that!
Me: yes I do... Wait... Coffee... Cup of jo... Java.... WAIT! This sounds like what Java was intended to be!!!!!
My brain: oh dear god... Time to fucking bury this thought to never be discussed again!!!!!
What's the lesson to learn here? If it looks like Java, sounds like Java and acts like Java, beat it over the head and bury it 6 feet down :-37 -
Security!
Offensive and defensive at both code and infrastructure levels.
So many times I see devs not give a flying pancake about security. Whether it be rolling integers for sql injection or permission guarding to prevent someone executing something they shouldn't.
Why is security in this industry always the last thing to be concerned about when it's the first thing that's going to kill your business.
😓7 -
I'm working on a redesign of a website and their logo is so bad… (I made it years ago, but ssshhh)…
And they love it so much, so I can't even change it.
It's killing my creativity, because the only way you can put it seems to be at the top, inside a white header.
I hate its' designer so much… and it's me! Fuck myself.
I designed it thinking about a particular website look, so it was perfect back then, but now I have to do something "new", "different", but without changing the logo.
Any suggestion on where to put it, how, or how kill myself?17 -
Very !dev
But Amy Winehouse was fucking crazy
Rappers these days OD on one drug.
Amy overdosed on all the drugs at once and most of the time, it didn't even kill her.2 -
Partners off at TAFE and I've got 3 hours to kill before walking to work, maccas and writing it is then!
Wish I brought my Mac so I could work on my other projects but oh well ¯\_(ツ)_/¯11 -
Is it just my random madness...
Or do you sometimes picture yourself in a fictional comic / movie / whateva...
Had this feeling today.
Burned a database down, grilled 2 terabyte of data, deleted ~ 500 elasticsearch indices.
Then I chopped an haproxy loadbalancer into 6 seperate machines, because noone likes to read ~ 2.5 to 3 k of lines.
And I guess now I'm doing some backups of elasticsearch before the second round of flamethrower madness starts.
It's somehow very satisfying to just destroy everything.3 -
Webpack and Babel make me want to kill myself. Takes longer to set a project up than it does to write the damn thing.6
-
Working on an AI that learns to generate quatrains, by only feeding it every letter of the alphabet at the beginning.
It's learning super slowly, but theoretically it works. And with slowly I mean it takes 5000 iterations just to realize the optimal letter frequency to generate a word that is real.
Please just kill me.2 -
Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.
At least I'm getting payed7 -
Opening the bag...
Stuck my nose in it. Deeeeeeep breath.
Better than sex.
Taking the scale, getting the right amount.
Feeding the grinder, thinking about whom to kill... Watching get them torn to pieces, shredded bit by bit.
Preheating the iron, getting the water up to temperature.
Filling up the espresso can, turning it on.
Boiling fresh espresso.
Nothing's sexier than the sound of the steam and the smell of fresh grinded and brewed espresso.
Good Sunday.9 -
FUCKING FUCK ANGULAR!!!!
LIKE FUCK IT IN THE ARSE AND BURN THE MOTHERFUCKER WHILE LAUNCHING A MISSILE ON IT TO BE SURE!
(ノ≧∇≦)ノ ミ ┸━┸
So I am making something on angular and I got everything running in ng serve(development environment) , after handling all issues and showing it to my boss man he approves and asked to put it up on prod for a demo , doesn’t sound like an issue , I make the prod build on cli and BAM! 16 errors ? No issues right?, I’ll just google the issue. Googles.... there aren’t no clear solutions to it as the angular version keeps changing and nobody knows what broke it, I mean people have the issue,but like 100 reasons that can cause it,
HOLY LORD RELEASE A NEWER VERSION AFTER MENDING THE OLD ONE
But nooooooo!
Angular Dev:We fucked this one, lol what should we do boss man?
Angular boss man: lol just leave it, we need to build the new version with newer bugs,
P.S. I like angular, but it’s like a underdeveloped framework, too many issues and too many changes2 -
It really sucks being the senior guy sometimes because it means there's nobody above you that you can bounce questions off of. No mentor. Just random people on the internet (and stack overflow, eww.)
The rubber ducky on my monitor can only go so far.
It's a constant worry of "am I writing garbage?" and "is there a better way to do this?"
I'd kill for a QA group that I could actually send some of my stuff to and get feedback.2 -
When you accidentally click on Android Studio while working on something else....leading to 30 seconds of frantically going through task manager and command prompt to kill it before it claims every resource your computer has.
I feel like thinking you clicked on AS is the real life dev equivalent of a falling dream....4 -
So today at the beginning of the class, our teacher asked us to write a function that translates a given string to "leet speak" (basically having to replace every character to another).
Some used python dictionnaries, some used arrays...
And the two people arround me wrote a program with a condition for EVERY SINGLE CHARACTER.
It kind of made me wanna die or kill them 😥7 -
That feeling when your housemate restarts the WiFi router without telling anyone while you were doing some remote work.....
Would it kill you to at least notify us? I would really love to see what happens if my other housemate was on a ranked CSGO match or something...1 -
"No i mean the bot goes offline like whatever is hosting it goes offline and then the bot literally doesnt respond to commands"
- One guy trying to prove how "unreliable" a bot is.
Kill me.2 -
Hey, senior developers, is there a reason for this?
I just can't believe it.
The line that makes me wanna kill is the
$("#" + id).val(val);
Taken from a very profesional site.9 -
*has a test in school on html and javascript*
*Studies a lot and checks to see if code works*
*it works*
*goes into test confident*
*None of the Javascript works* (legit nothing)
Kill me6 -
I'm pissed off as fuck. By far these were the worst fucking 2 weeks in a very long time.
My grandma died. At work I had to do shitty tasks and IT support for stupid end users, like an overpayed PC technician. I couldn't find any time to write a single line of code on any of my personal projects.
And I still can't find a fucking developer job. I feel like I'm stuck in this IT hell forever.
Kill me3 -
In horror movies. Characters do things that they them-self know it could kill them. Like getting in basement.
As a developer we all know to never deploy code on Friday. Here we are taking the wrong turn.2 -
Could not fucking sleep at all.
Spent the entire night in a combination of:
Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)
And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.
I hate it when this happens.
During the week I would do crazy shit to try and get me to fall asleep.
I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.
Still wide fucking awake.
To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)
I really dislike being human. Such fragile bodies.
But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps5 -
Keeping myself from getting bored af at work. I am a backend engineer doing mostly frontend. And right now it ain't even the interesting stuff. I am merely passing photoshop files to static displays.
Kill me. Every once in a while I do maintenance on Java and PHP apps, but still...bored.....more Rails or Django please -
Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?
Me: Replacing?
I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.1 -
"Startup (called Nectome) wants to upload your brain to the cloud, but has to kill you to do it"
https://theguardian.com/technology/...
No thanks, I am sure NSA will kick in.4 -
How many programmers does it take to kill a cockroach?
Two: one holds, the other installs Windows on it.6 -
Kill who ever let's a robot program anything. Because what ever boundaries you place on it does not stop it from recreating it's self without them.
Who ever makes an AI that can program is putting humanity on the thin edge between utopia and dystopia3 -
I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...
I remember the days when 8G RAM was an overkill.
The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....11 -
There once was a beautiful initiative to put ballistic missile launch codes into a small capsule and hide it near some person’s heart.
This person would give consent to become the president’s personal assistant and will be paid indefinitely just to be around president all the time.
This way, if the president wants to launch missiles, they first needs to kill one person with their own hands before killing millions.3 -
*trying to install arch linux for the first time*
> reboot
> system goes into a boot loop
> cant get into BIOS
> taking pc apart rn8 -
Whatsapp on windows phonewill be shutdown in december.
Slowly more and more apps will be off.
Windows phone has a beautiful OS why did you kill it Microsoft!!!!
Why why why.26 -
What's a database? Oh, uh... Think, like, a spreadsheet -- but it makes you wanna kill yourself even harder.4
-
"Millions of slaves"
"When you kill it, you kill everything."
-- Guy at work doing presentation about docker2 -
PBF: This program is so difficult
Me: what's difficult about it?
PBF: *explains*
PBF: *may as well be speaking greek*
Me: Oh. Well, I'm sure you'll kill it. I believe in you ❤
PBF: -_-
Me: (^^,)2 -
The computer lags, windows 8 lags, vagrant lags, chrome lags, phpstorm lags, EVERY-FUCKING-THINGS LAGS.5
-
IT Dept creates an update installer with a Message of "Your computer will restart now to install updates" with only an OK button when your in the middle of work with multiple apps and windows open...
1. Kill Process
2. Resume Work6 -
I want to kill the guy who wrote this. He creates a temp table, selects data into it. Then selects the data out of it and returns the results. It does Nothing Else. WTF.5
-
What a horrible monday today was. Fuck-all worked. Missed deadline. Not much sleep. Heart is racing.
But hey, the horoscope in the daily toiletpaper press knows it all better, as usual, 100% IQ:
💫"You have finally found your center. Your body and soul are feeling great and your're in tune with yourself. You are enjoying it and would love to share your experiences with your loved one."💫
Where is my rocket launcher??? I have to kill a newspaper.6 -
I am as sure as I am of anything that the software I am working in is sentient and pulling the long con on me to kill me over the course of my career via stress. Joke's on it though. With the amount of drinking I do to cope with the stress I will die of alcoholism way before I die of stress. Take that. Victory is mine.1
-
What is fucking wrong with Windows? When shit doesn't respond it's impossible to kill it and it freezes other processes. NEVER happens in Linux, all I do is kill the PID. When you can't open task manager or "end the process" you are shit out of luck. You'd think they'd fix this in the decades they've had to built a computing platform. I'd use linux exclusively but some work and tools at my company necessitates windows.8
-
We've all seen bad code in our time. The code I'm currently looking at needs to die horribly in a fire. In fact, that doesn't even seem extreme enough for this monstrosity
-
Sorry guys but I have to vent!
I made such a stupid mistake I want to kill myself right now. In short you can call it ignorance..........
I spent so many hours trying to find a solution to a problem of invalid signatures being reported by an OAuth provider I'm making, just to find that Chrome was blocking requests to http.
So it was not a problem, to begin with. Aaaaarrh........ I'm so mad at myself.3 -
u+200b.
Who made that shit? and whhhyyyyy?
I spent 20 minutes trying to figure out why the code file, a mac using co-worker sent me, does not compile.
Intlij did not help, np++ did not help, textmate did not help!
Only hex editing the file worked!
kill it with fire!7 -
The best kinds of comments:
/**
Gets user CC info datas.
*/
public Object getUserCCInfoDatas() {}
If you really want to outdo yourself:
/**
Gets user CC info datas.
@param someshit Outdated docs ftw
*/
public Object getUserCCInfoDatas(String unrelatedToDocAbove) {}
Honestly, no documentation is better in some cases. At least I can't be angry about their shitty quality... And they don't waste my time.1 -
How awesome would it be to be able to migrate to a cattle-approach from a pets-approach when it comes to the human body, just kill your old body and start using a new one
Sickness? Create a new instance of your base image. Death? Just spin up a new instance and you're ready to move on. Broken arm? Kill body and get a new one.
Ofcourse, since we're stateful this method is kinda harder, unless you consider your conciousness an external database/soul4 -
I have more side projects than I'll ever be able to finish. When I do finish them (or at least get a mvp), I have no idea how to market them, and in many ways, I don't even want to. I'm worried that it will kill the fun of it for me.3
-
So, let me preface this by saying I come from a backend (mostly c#) background.
The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.
I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.
All that said, of course I'll go back to work on it tomorrow.
Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.7 -
We have a customer that doesn't have a SINGLE linux admin. So now I have to fight with Docker EE on Windows Server 2019 (linux containers). Just fucking kill me already. Nothing works and when it does it just seems so shaky. Not like I didn't try to tell my team that linux containers on Docker EE for windows aren't officially supported and highly experimental.
But wtf do I expect from someone that STILL sells SAP and from someone that is stupid enough to buy it.2 -
Come on devRant! I’m getting really annoyed when clicking on rant that has [read more] at the end since it is a gamble to kill this iOS app you have made. Every ~5th click I get app terminated. Then after I reenter the app, I lost where I was. Thats why I ++ all the rants I have read, even those who don’t deserve it :), so I can scroll quickly and see which are not ++’ed.3
-
When your colleague doesn't add a dependency to package.json and the distribution stops working.
Am I the only one who has got such idiot colleagues? It blows my head every fucking time , I wish I could kill people.1 -
So I have a date tomorrow. First meeting in person. I’ve got a little time to kill before hand, and need to learn Dart anyway....so I thought it would be fun to code her up something interactive. Kinda like that game Mr and Mrs. Only in the terminal, and for nerds.
Features, ladies and gentleman?9 -
Just wondering... anyone else think having a script automatically kill gradle if it runs for more than X amount of minutes would be a great sanity saver?
"Jesus Fucking Zombie Christ I only added ONE FUCKING TEXTVIEW IN A SIMPLE GODDAMNED LINEAR LAYOUT YOU WORTHLESS MOTHERFUCKING PIECE OF SHIT AND GRADLE IS STILL RUNNING AFTER FIVE MOTHERFUCKING MINUTES?!?!?!?!?!!?!?!?!?!"1 -
I was going to write an obligatory "fuck webpack" post but decided to skip it and try out rollup.
https://github.com/rollup/rollup/...
..and they said it would be better than webpack.
The more things change the more they stay the same.
At this rate maybe I'll just join the military and kill brown people in the middle east for a living.9 -
has it ever happens to you that for whole day you kill yourself to solve error and next day you find out it was just happening because of a single semicolon
it hurts...3 -
Et tu Chrome?
Closing a tab should kill it.
I writes code, my code somehow causes an endless loop, tab gets at 25% i7 CPU.
I tells Chrome: "end it", Chrome won't close.
I wants to see under the hood to diagnose, Chrome unresponsive, forget about DevTools.
I Ctrl + Alt + Dels it
Sad Windows user4 -
I swear on the Almighty nature, I fucking hate Browser compatibility.
Passing php data via JSON encode. Works superfine on Firefox and Android mobile browser doesn't on Chrome. Fucking shit. Been sitting for 13 hours and gave up. FFuuuuuuck !!!!
Form submission via ajax and it again works on Firefox but doesn't on Chrome. I just can't understand, my mind is fucked by all the angels in heaven. Data gets submitted, the form is reset but the function called to refresh the JSON data doesn't work.
Someone please kill me or I swear I will fucking kill everybody.4 -
I don’t understand how Microsoft can continue to ship functionality in modern versions of SharePoint that only work on IE11 (open in Explorer, open in InfoPath, Skype presence integration). The only reason my company has to make web apps compatible with that browser is because of the hot garbage that is IE11. Just kill the functionality and kill the browser. Please.
Yes I know *why* they only work in IE11, it’s because activex is a massive security hole, but just kill the functionality if you can’t recreate it in modern browsers.1 -
"Our supplier asks that you double the number of php child processes for this fpm pool"
"Are you aware, that that would lead to about 100% of memory overcommit, taken the current limit of 128MB/child, and that if a lot of them started at once, the system would probably go for OOM-Kill, which would most probably kill your database, that still runs on 100% MyISAM tables that do not support transactions, and you'd have to kiss your data integrity goodbye, right?"
"Uh... Nevermind then"
I get that some people are not IT-versed, but really... Hire someone who knows what they are doing and doesn't live 20 years in the past, god damn it! -
(another) Russian roulette for devs
$jobs -l
[1]+ 642 python .....etc
$sudo kill -9 642
.... other commands here
arrow up...arrow up... (looking for jobs -l)... got it.
arrow up...
$kill -9 642
F*uck! (i remember that i have not changed the pid)
kill: no such process (luckly no damages)
anyone killed something relevant making this mistake?6 -
WHAT THE FUCK
MY MAC CRASHED TWICE WHILE I WAS SEARCHING FOR AN ANSWER ON STACK OVERFLOW
I HATE WHEN I HAVE TO DEAL WITH SOME BULLSHIT CROSS BROWSER ISSUE AND I THOUGHT IT COULDNT GET ANY WORSE
WELL SAFARI FUCKING PROVED ME WRONG (AGAIN)
GOD I CAN KILL SOMEONE RIGHT NOW6 -
mini rant
So I finally started toying around C#.
As much as I tried to avoid it, as much as I wanted, well, sometimes there is need. I was laying it off and laying it off...
There are some things that well.. aren't my taste but whatever.
But come on why the fuck I cannot delete explicitly?
What do you mean "just assign it to null and GC will eventually kill off that instance"
No, I want that fucker to die here and right now. Like in good ol' C++.23 -
How to kill Jira Backlog in one simple step:
1) put '-∞' to Storypoints
2) enjoy
(Bottom line: it can be fixed from User Story Map to something normal) -
being a dumbass and ran a blocking call then it broke and i can't kill it with ^C :/
killed it later with htop lol im so fucking dumb
also hi first post here7 -
StackOverflow Jobs was the best platform for finding and posting jobs: quality candidates, quality job postings.
I hope that whoever decided to kill it got a huge pay from LinkedIn/Indeed.
But it's loss would be felt for years to come.
And, who have any suggestions similar to StackOverflow Jobs?3 -
I hate it when we are discussing a feature and they ask me "what do you think?" after they said how would they go about it and i mention that i would do it differently and think that my way may be longer now but can pay off in the long run and they decline it.
What i hate even more is that after some period they revesit their decision again and come to conclusion that my way is better and now we (i) need to rewrite it but without acknowledging that i said it then and was the best solution.
AMMA KILL SOMEBODY IN THIS BISH RIGHT TF NOW!!10 -
You know a server is having a jolly'ol time when, while logging through the serial console, it lags... Then, a few seconds later, you get a message
[time.seconds] Out of memory: Kill process PID (login) score 0 or sacrifice child
[time.seconds] Killed process PID (login) total-vm:65400kB, anon-rss:488kB, file-rss:0kB
10/10, only way to bring the server back to life was by a hard-reset :|3 -
Yet another thing i think is fucking stupid.. GDPR btw.
So, a guy in Denmark owns a grocery store and has an issue with people stealing from him a lot the last couple of years. He catches them on tape and shares it on social media to try and prevent it.
Im not sure why it didn't work to go to the cops, but it didn't.
What the owner ended up doing, was hang a note on the front of the store so people could see it before they entered, see attached image.
However, now he has been notified what hes doing is illegal, because the "user" doesn't consent clearly enough.
I dont understand GDPR, but if you do, you're probably gonna find mistakes in what i wrote.
Source for story: https://bt.dk/erhverv/...
Its his fucking store, if people steal from him he should be allowed to post it on pornhub if that was his desire.
It's illegal to kill someone, but if you're threatened on your life, you may kill in selfdefense.
To me, those are the same, just one is on a much more serious level of course.
Fuck me.13 -
ah yes, the usual family get-together: my grandma's throwing heavy shit with intent to kill, my sister is violently crying in a corner and refuses to move to safety, and my dad's shut down in a chair somewhere in the house. Just like every Christmas. And Thanksgiving. And Halloween. And every other large holiday.
Surprised I made it to 19.3 -
All these companies not going the full 100% remote and requiring one day in the office, would it kill them to do 100% remote? My current role is fully remote and were spread through many timezones and still manage to work well, why don't companies see this and give an option atleast to be fully remote for developers?12
-
Scenario after sending a build to QA:
(Monday)
Me: How's the build? did that app worked?
.
.
.
.
.
(here come's friday)
QA: The app didnt work on this part and there some bugs there, and please add this another module.
Me: okay ill fix that..when do you need it?
QA: today
Me: (just kill me)3 -
The person who invented powerpoint and those who use it/love it should be skinned alive.
FUCKING SHIT OF A PRODUCT.
On the other side, instead of torturing someone to death, force them to use Power point for 2 hours a day and that will be enough for the person to beg you to kill them.
Join me in this journey against power point.20 -
How our MIS/IT department handles problems...
Once upon a time a long time ago, a C level suit opened ransomware from an email with a link in it via Dropbox.
Two years in, even the marketing department, who are all using iMacs for digital media creation, inbound marketing, and website development, and alsohave more common sense than the lowly Excel minions, are still blocked from using Dropbox.
Thank god for Socks5 Proxying and an SSH tunnel to our web server. ;) I can has all the things.1 -
Fucking hate people who can't appreciate what you've worked on. And just find the fuckin faults in your task. Would it kill them to just shut the fuck up and not start the conversation with ooohh I've found a bug, just fuckin try to make something first of your own and then be an asshole to others.🖕🖕🖕🖕🖕🖕🖕🖕🖕
-
"Configuring incomplete, errors occurred!" Ok, I get that. But would it kill you to tell me what errors? If you behave like an asshole, I'll hate you as well!
-
1. Kill Internet Explorer
2. Kill anyone who sell their web/app/design services cheaply that broke the market value
3. Kill anyone who want something in exchange of "exposure" or "you'll get the money when we get funding or IPO" or some shit like that, you name it.1 -
i dont know sql, gotta look shit up and dont much of it really internalized
i may be now being assigned somebody else's task to do some sql shit
fucking kill me3 -
VirtualBox is fucking evil
It wants the humanity to disappear due to self doubt, random errors and depression
AAARRRGGGHHH
KILL VBox BEFORE IT KILLS ALL11 -
It's truly wondrous how far R can propagate shit until it finally gives up.
Looking at the call stack it's been processing increasingly demented bollocks for nine function calls.
Even then it refused to give in. It now appears to be processing an infinite sequence.
I should kill it, but I feel inspired by its tenacity. "This must be crap, but I'll have a go anyway."
Beautiful. A lesson for us all in that. -
Trying to code a Chrome extension with Native messaging so that it can communicate with my python script. Just kill me.
Can't even get the example from Google to install correctly.
FML4 -
Aye, I almost fight with everybody at work(they always think it is funny). I'm not good at listening to others when it comes to dev convo (like related to coding or some logic stuff).
So it is like someone is explaining to me that this should be like this and in between, I ask 100questions like "why like this? why not like this?","but what if I just skip it?" etc
and they always go like, "Someone is going to kill you so badly".
That's it. -
Spent the last 2 and a half days working on sth, it turned out great. Was pointed out a major mistake in the structure, have to redo about 95%. Kill me now.
-
another true story time:
be me
read about banned pokemon episodes on wikipedia
electric soldier porygon: an episode that red blue flashes caused 685 viewers taken to hospitals by ambulances
😈lets try it
write a simple program that makes same light effects
try it on myself
no kill
try it on roommates
no kill
try to send it as many people i can reach
omg people why don't you die?
gave up after 1 week of unsuccessful attempts3 -
It's like I know staying up all night is gonna kill me the next day, and I do it anyways... and now it's the next day. Fml 😫4
-
Apple just changed their file system to apfs across the board, but no recent documentation on the release. It automaticalky changes from hfs+ when you install the macos 10.12.4 update. In early docs it says that time machine is not supported, but surely they cant kill everyones short term backups?9
-
Not just a rant, also a call for help.
After 10 years using Git, I'm constrained to use Mercurial (company policy). It effing feels like playing tennis with one arm tied to my back.
Please, who knows a good GUI for Linux, or at least a command line tool to show a decent log?
Kill Mercurial!3 -
I'm going to kill myself.
In the nodejs server for my game, there's a function that pushes to an array.
It only works if the array is empty, no matter what type it is.
List of people that know why
- none5 -
We have a company policy of “you kill it you fill it.” We get free coffee here, it’s nice, I’m happy - but notoriously I’m the only one filling it for the whole company!! So I did the unspeakable today...
Fill the damn coffee. Thanks.6 -
My team has a huge, high priority project to make a very complex system a lot more simple.
It has to follow the same rules as the current system and do everything it does.
Can I kill myself now? -
Had junior devs work on a new feature on a project I spent days fixing. They spent days on the new feature but built it off of the broken version of the project and never pulled from the repository. Now when I merged their new feature onto the working and correct branch, their feature is all broken. I swear Im going to kill them all.3
-
Hey this is my first post on This new fitness-tracker-app community
I will tell y'all my workout :)
-programming a parser
FUCKING HELL PLEASE STOP ALREADY THIS IS THE WORST SHIT IVE EVER DONE EVERY WHERE IF STATEMENTS JUST TO CONSUME FOUR FUCKING TOKENS I DONT WANT TO DIE BUT I'D LIKE THIS PROJECT TO BE FINISHED ALREADY BECAUSE THIS IS ANNOYING AS FUCK I REALLY WANT TO KICK MY COMPUTER WHILE TELLING IT TO BE THE MOST STUPID BRAIN ON THE WORD AND THEN REMEMBERING THAT ITS NOT A BRAIN FUCK MY FUCKING FUCK HELL THEN I WOULD KILL THE PEOPLE WHO THOUGHT THAT MAKEING std::vector::end() RETURN AN ITERATOR WITHOUT ELEMENT WAS FINE AND THEN I'D KILL ALL THOSE WHO COME INTO MY ROOM THUS DISTURBING MY WORKFLOW
Enough rage.4 -
Teacher's story:
Once a friend of mine had a problem with is program but it would only happen from time to time, so he didn't get bothered with it.
So, because I'm an evil person, I did a print in his program with the error message.
After a day debugging, he found the error. He really wanted to kill me. -
I really hope to not be into desperate needing of the squishy ball.
Because even if I buy it, i will probably kill somebody in the expedition time.
Please 2018 be a lowstress-year
Please -
The fact that I need to make this shit multimodal is gonna be a whole different level of shitshow. 🤦🤦🤦🤦🤦
Somebody kill me plz.
Today I tried to concatenate a LSTM unit with a FC and was wondering why it was throwing weird shapes at me. 🤦
Yes, I was THE idiot.
Kill me.19 -
Code is a highly detailed description of what a computer should do. If that description becomes inaccurate we will remove inaccurate parts. Take pride in writing good code, recognize that it was useful for a while, but don’t get attached to it. It will stay in the git history.
If you see code as your baby, know that the team might need to kill your baby.1 -
I have a question of morality .. we are devs so it may start becoming more important then ever..
If to save the world... Would you do something that would first effect millions or 10 of millions of lives negatively, possibly quite seriously so, as in death or starvation etc
Similar to the do you pull the switch and kill one man or do you let the train kill 5 but on a world scale I suppose.14 -
What would your solution to daily commute traffic be if it were a solvable programming question?
Ps - I'm sitting in traffic right now and want to kill myself.4 -
Hey google, stop automatically opening apps after they are updated on my android. It makes me want to kill somebody 😡6
-
I hate it when someone asks me for help in a part of his code, then I find that the problem is the whole code not just that part.
I have 3 options:
- try to make it work, and get lost in his shit, not refactored code.
- tell him that I am not that good so he get out of my face
- kill him, so he can reproduce
PS: just kidding -
First c class. Techer starts by telling us to use void main() and that it is necessary for program to run correctly. Someone kill me.4
-
I think the worst feeling ever is taking a break from something, then coming back to it and realizing that you have to rewrite something because you put it off before you took a break.
I've had a lot going on lately, and I decided to work on a web dev project I was doing to get the hang of frontend development. Just realized that I have to rewrite a couple functions. Someone kill me now1 -
Fuck you Mobike!! Stop polling your applog.mobike.com server literally every 10 fucking seconds when your app is not even running! And why the fuck did it suddenly start last night, of all things? It's fucking creepy and invasive.
Related question: does anyone know how to permanently shut down a background app service on an unrooted android 7? Even if I kill the background process (not the app itself - that one has not even been opened), it still restarts a minute later3 -
There comes a time, when you look into the mirror and you realize that what you see is all that you will ever be. Then you accept it or you kill yourself, or you stop looking into mirrors.5
-
For today I had to implement a Strategy Pattern solution for dynamically loading items in a view. So, I came in the morning and started doing it, finally after some time I acomplished it, with one strategy, so when I started implementing the other ones, everything went to crap so I thought "Okay, lets checkout to how it was on the morning, just to realize I leaved yesterday without commiting.
I wanna kill someone1 -
I will literally pull out you soul, grill it, and then put it back into you just to kill you, roll you up in nice mustard, pickles, bacon, pepper and salt and then roll you over with beef so I can properly make a roast and then, when you're ded, I will take your soul again to just torture it for all eternity.
....didn't have my coffee yet, guten morgen16 -
Praying to every deity, I begged to spare me, to never kill my inner child. To never make me grow up into materialistic mindset that punishes curiosity and denies miracles.
It seems like my wish was granted. Am I naive? Sure. Do I have kid ego? Sometimes.
But I never wanted to be someone else.3 -
Sooo TIL:
Running software that is still in development and it uses realtime jackd is a REALLY BAD IDEA. I could not even kill the damn thing! Thankfully shutdown -r now worked...1 -
It seems that most of us feel under appreciated for our hard work. Would it kill managers to say "thank you", or say "great work" once in a while? Until then, I'll continue wondering if my work is good enough.4
-
I don't think meeting are bad nor good, it's like weapon, it's what we do with them that decide.
also, it's pretty easy to kill someone with it -
Hey guys, I wouldn't really mind if you moved the live devrant podcast thing to a later time, I have school and I would kill or die to be there for it. Kill. Or. Die.9
-
Google PageSpeed Insights can kill my motivation. Few days ago I launched a site and everything is awesome, page loads around 0.535 seconds, caching enabled, images optimized. Than my boss run it on Google PageSpeed Insights result was 85/100 then my boss said why I can't get 100/100.3
-
So I'm writing a function in Unity3D that walks a rectangular grid. At one place in the code, I got the x+y coordinates backwards, which caused the function to infinitely loop between two coordinates.
Not seeing a way to kill the loop, I looked it up on Google. The suggestions I get are. . .
1. You need to kill the Unity3D task and lose your edits because the environment and the player run on the same thread.
2. You can pay ten bucks for an extension that lets you break out of infinite loops.
3. You should really avoid writing infinite loops. That's just bad form.
SERIOUSLY?1 -
!rant
Playing Battle Royal with friends, had to leave 2 of 4 teammates behind as the play area was shrinking and they couldn't be rescued. The 4th player ran me over with a game car just to get revenge for our other team mates.
With me alive we actually had a fighting chance to win the round. (8 kill streak and lots of ammo with a decent tactical position) ....but NOoo the fucker thought it more sweet to kill me rather than help me win the round!
Fuck this shit, I'm out!1 -
Need to find the visual studio process to kill it because the app is frozen. Pen task manager > processes> sort by memory usage. right there at the top...always at the top...2gb+ usage.3
-
When you hate every fucking thing on earth and want to kill everyone on this fucked up planet.
That bug didnt fix. Fuck you.
The client needs answer now. Fuck you.
Stackoverflow user marked it as duplicate. Fuck you in particular.
Fuuuuuuuccckkkkkkkkkk every fucking asshole. -
I just hate the word "menu" today
Even worse: menues
The Internet is a fucking restaurant!
Kill it!3 -
Writing code for software that was deprecated since 2015 it's a nightmare. More when the unit tests take way more time than the actual fix or feature. Just kill it with fire
-
I get a chill or an eerie feeling when there are more programs open than needed and I go ahead and kill them.
Is it just me or happens to others too?2 -
Working on an Angular project for the change of things. God, please kill me already.
Its fucking slow - hot reload? I am gonna make myself a coffee in the meanwhile
Its fucking stupid - Why make it easy when you can make black boxed. Make the magic happen!
And please dont get me started on Ressources, documentation, error messages and all the other stuff thats annoying here. Never going back to Angular, if it wasnt paid that well…3 -
Noticed a running process called geoclue. Wanted to kill it but xdg uses it. Went down the rabbit hole, and guess what? Flatpak is the mother of all dinosaurs. Busy enough that I can't care, but like... Really, flatpak? ReAlLy???1
-
Hey guys, I just discovered that an instance of internet explorer is actually set to open on startup on Windows.
Try going into your task manager and look for "explorer.exe".
If you want to kill it without finding it, you can also just use the BATCH command `kill /I explorer.exe`8 -
Her: What do you do in your spare time?
Me: Learn to code
Her: Can you install an antivirus on my laptop and make it go faster?
Now I just want to kill myself. Who else here has encountered this?2 -
You can comprehend its whole construction completely in two seconds. Yet, a hamster will be entertained by exploring this thing for life.
In the same way, an advanced neural network will be able to figure out our brain's construction and explain it to us.
If you cry AI takeover, remember that just because you can kill a hamster with your hand, and it absolutely can't do anything about it, doesn't mean you'll do this.
Said neural network may have morals completely detached not only from ours, but from the whole concept of "morals" as we know it. Its goals being beyond our understanding doesn't mean it will be hostile and won't help us.
The only thing we'll lose is control. Yet, benefits are so huge that they can transfer us up within the Kardashev scale, and it may be our only way to prevent the death of our civilization.
We don't have control over our nature either. We can't prevent eruptions and earthquakes. Losing control in itself doesn't mean the thing we lost control on will kill us.18 -
sometimes its better to hold it back when a customer says you need 2 months just to finish the payroll+hr system in a way that it makes you wanna kill him so badly but your response is a faint smile which humbly says fuck you piss of shit1
-
Has anyone tried Vivaldi around here? Although I assume it was forked from Opera, it's a really nice alternative to Google Chrome, plus it supports Chrome apps! And does not kill the ram!!!!9
-
So I lost £40 and had to spend ANOTHER £40 to pay my friend back that I couldn't fucking afford. Why is the world just giving me a constant barrage of shit and fuckups that make me want to kill myself more each time. Fuck this shit, 8m so tired of it. FUUUUUUUHSLWNX DNSISY ,83+£;£)# JDTCVOSMDD ARGHHHH7
-
Oh here's a good one. When the managers realised one of our apps is a giant hunk of crap that wasnt thought through at all and was lazily thrown together, and their solution is "meh let's just rewrite it in Swift on our new platform. And those other guys can maintain the old one and continue to do hotfixes for it until we are done".
I've been telling them for the past year that its the worst codebase I have ever seen and the lack of tests is disgusting and not something we should dare to release to paying customers (especially when those customers work in healthcare!!!). The best part was when one of them promised we would all be working on the new shiny platform by Christmas. That was last year. And I'm currently the poor bugger doing the legacy maintenance and in the process of trying to get moved to a new project. So much for managers promises amirite... -
When the scrum team complains in the last three to four sprint retros that were sick of back to back meetings ... MAYBE STOP SCHEDULING BACK TO BACK MEETINGS. Would it kill you to just spread them out a bit?4
-
fuck mailchimp. it says its "simple" api is "easy to use" but it's actually a total bait and switch piece of bullshit. every developer at that crackhouse should fucking kill themselves, it'd do the world a big favour3
-
Been ‘working’ on this game for the last 5 months now. I love making it but I haven’t gotten any where because there are too many bugs. Like, it’s all bugs.
I started the project when I started learning game development and with all the time I’ve put in it I don’t want to kill it.
Anyone else have a project that they are working on, where they don’t even make progress on it, they just fix bugs?2 -
Cause when you die or exit from process it doesn’t matter how it happened, was it kill -9, sigkill or sigterm. As long as you go to hell / heaven / you name it and not to /dev/null you can still try to segfault the universe. Just give me the code !!!
And it aligns well with depression, alcoholism and lack of sleep. -
It took me an hour to process when a client wanted icons for sitemap. By icons for sitemap she ment social media icons... kill me please
-
in the last time devrant freezes at this screen REALLY often ALMOST EVERY TIME i open it. i dont know why. this is new. so i have to kill the app and reopen it a few times until it unfreezes. help11
-
git rebase is like fish.
Hours after the kill: hmm, tasty.
A day after the kill: not too bad.
A few days: time to toss this in the trash
More than a week: dig a hole and bury this thing before it stinks up the neighborhood.
That being said, I'd rather eat a plate of Hákarl than deal with rebasing a diverance that is over a month old. I simply don't use rebase. It's just too stinky. I just merge very often and keep things in sync.
If you need the effect of a rebase without the crazy hassle:
git checkout master
git checkout -b rebase_branch
git merge --squash dev_branch2 -
I have to restart my computer in order to go do bed (i want to have it run at night) but that would kill the upload that I have. Fuck.2
-
!dev
Left the window open to cool the room before going to bed. A fucking cricket got in. Didn't kill it at first, thought it'd leave.
Nope. It didn't. Lights off, comfy in my covers and there it goes... That noooooise! For fucks sake! It's not even loud, but it grates so muuuch. Agh.
And then it took me foreeeeever to find it. Bastard hide on top of the wardrobe, behind my luggage. Spend a good 10min looking for it. And he kept on taunting me, the fucking piece of crap. Well, at least its dead now. Good riddance, asshole. -
I am in jvm hell. I have been given a task to add mockito tests. All the existing documentation concerning junit 4 is out of date. Need to use junit 5. All mockito tutorials are out of date. I thought mockito was stupid before junit 5. Now it is “really” stupid. The tutorials I am reading are shit. We have wandered into bleeding edge fucktardness. Kill me now.17
-
Rocket League is the most ruthless program you run on Windows 10.
It hangs sometimes, so bad that the task manager can't be put on top of the window for me to be able to kill the program.
I unplugged my earphones mid game and that action was enough to set off the atom bomb that this game is.
Tried creating a new desktop and starting Task manager there. It resulted in my laptop screen resembling a horror movie. It became so scrambled.
No other option than to force restart my laptop.2 -
Just added a new alias to my .bash_aliases.
alias killstudio='pkill -f android'
What it does is kill all process with the name 'android' in them forcefully, like in android studio. -
While investigating alternatives for translating a query string to a dotnet expression I discovered that roslyn has runtime eval of string as verbatim code.
I had no idea a feature could make me this uncomfortable. It's like discovering an armed bomb under your bed that's "there if you want - it has its uses, just be careful".
At least you have to explicitly reference a package for it. Promise to kill me if I ever am tempted by it. -
Microsoft bought GitHub.
2 Ways it will go:
0. They will welcome it
They will make it bigger
And then kill it
1. They will welcome it
They will keep it running
It will be as good as before2 -
Trying to find a linux distro I like to replace Windows on my home pc... Didn't like the first 3 I tried, so I'm continuing to try others...but now it feels more like I'm trying to kill Windows
ಠ_ಠ14 -
Imma kill the next person who asks if they can “help” me or if I’m alright or ok
Since they never ask it in a way which is genuine or not related to the retarded shit all around me13 -
SO's accepted answers being "no dont do what you want to do, use this corporate™-certified library instead, we ALLLLL use it too"
Like bitch if I wanna kill myself with a knife, tell me which vein to cut, dont recommend me a gun, I dont want it. ffs.9 -
iTerm2 & Bash-It. iTerm coz of the split panes, paste history, undo kill session etc so much helpful!! And bash-it gives me so many things, completions, aliases which makes the work a breeze, gpom does a "git push origin master" and many more like these :)
-
My favourite task for when I had to kill some hours in between things is almost completed and I really liked it. I hate the fact that I have to do more boring or annoying tasks in thr future when having a few hours.
-
Pro tip. Don't start to learn react and redux when you have to Support 6 fcking Apps in jquery, plain Javascript and this bad boy Razor. You will kill yourself when you have to work on it. I nearly cried today because of this...
-
New game on steam, Middle-earth.
Showing absolutely no in game footage and asks you to pre-order for some bullwhip award.
Don't pre-order, please kill this type of behavior.
What is it even, rpg, rts?2 -
"User insisted too much, dying badly" - at least I know VLC "felt" my 300 clicks to kill it. Now I have closure
-
No idea, it just makes me happy. I'm happy when I'm programming :)
Well I mean, most of the time. Every once in a while I just want to kill myself because Tim didn't do his work properly and now there's no fucking documentation for his stuff.
Ignoring those moments, I'm happy when programming :) -
Is anybody else indecisive enough to code a RNGesus to help them decide what to do? lol... I even have it bark out commands indefinitely until I decide when to kill it, just so I feel that I have a wee bit of control in determining my faith. :P
-
!!rant && !documentation
Hm, let's see what a semi-beginner can find as a project in Python...
Oh, an API Wrapper seems interesting! *full of joy*
Okay, let's look at the documentation...
HOLY FUCKING SHIT. IT IS UGLY. IT IS INCONSISTENT. IT IS INCOMPLETE AND WRONG. WHY THE FUCK, AREN'T YOU STUPID ASSHOLES CAPABLE OF WRITING DOCUMENTATION FOR YOUR API?
HMMMMMM?
YOU STACK OF SHIT.
IF YOU HAPPEN TO CREATE AN API, AND DONT DOCUMENT IT CAREFULLY, I WILL FIND YOU.
AND KILL YOU.1 -
why on earth somebody thought that MySQL on MacOS must be restarted automatically every time you kill it like a fucking zombie?
An why the fuck every time I restart the Mac, I must kill the fucking zombie with a kill -9 in the head 2 or 3 times before being able to access it again?3 -
This feeling when you're fighting with an issue for few days and accidentaly find out the problem is caused by a dependency of the library you're using... And someone reported it already few weeks ago... Just kill me.
-
Me from the future
Only because if I say enough nice things about him, he might not come and kill me when he reads and maintain some of the code I wrote the other day....
me > You heard it me from the future, right? your cool! right?... I didn't want to! There was more code like it! I just followed what was written!!!
me from the future > Run!
me > (⊙_⊙') ohh shi.. -
Coding a side project is easy. Turning it into a profitable business is the hardest part. A wrong decision can kill it.1
-
When you unknowingly/accidentally/inadvertently delete something someone was working on for a long time and they don’t tell you until several months later when all the backups are long rotated out. No way to fix it and nothing left to do but accept blame and sanctions and work to regain lost trust. Kill me now.4
-
Despite what seem to be supported a lot on the internet, yes you can kill a hard drive with a magnet. As simple as dropping it on your running laptop! Try it at home!
-
Hang on image selection dialog.
I'm on Android (MIUI 12) and for a long time I've not been able to select an image. Whenever I go into the picker it slows to a crawl. Even when cancelling the pick devrant is all but frozen. I have to kill it and start again to get back. Selecting an image will make it just show a black screen. Does anyone else experience this? -
A medical equipment that you can attach to employees and excruciatingly kill them as soon as they say things like (please note that the list is not limited and we should use a speech to text API to provide NLP states for the meaning - I want to catch all false negatives!! Kill them all!!!!):
- It works on my machine
- I tested it before!
- Haskell is a terrible language
- Big data and actionable insights
- why do you need unit tests here?
- I am a recruiter
- Anything that comes with the following construction as well: "I don't have anything against X, but..."
Any other suggestions of phrases?2 -
Anyone know where I can get a tombstone made for an application? Finally got the powers that be to agree to retire an application that I have been asking about for over a year.
-
After a week of designing an API to our system for another team followed by redesigning it because they 'know what they need when they see it' I think I understand the pains all of you guys who work directly with customers go through what leads to exactly one question : How did you manage to never kill anyone?1
-
News: Coronavirus lockdown could last for much longer
Reactions:
Introvert living alone: so happy best feeling
Introvert living with their family: kill me, kill me
now I can't hold it3 -
Nothing gets me so anxious like endless work meetings that have nothing to do with my part of the task. Why am I even here? Should I understand this? Why is it taking 2 hours? Can I finally kill myself?6
-
I don't understand one thing and that is people who say they are going To delete their
Devrant account and make an announcement and post it 1st, as though they just announced they wan't to kill themselves. if you're really tired of devrant you'll just delete the account. You wouldn't announce it. Which leads to the Only other logical conclusion... you're just looking for attention aren't you11 -
Hey guys, i have problem with local security authority process (win 10) it is in system32 folder and it is called lsass.exe ... it is just burning my pricessor and i can not kill process, because it turns off my computer.. any solution? i am mad :(4
-
Our Gitflow:
- kill bug
- pushes hotfix branch.
- deploy hotfix branch
- see if that solves the issue
- go back to the top if it doesn't
- merge hotfix into main and then deploy main -
Today one of the user complained me that my account has been hacked and someone is using it. I asked how can you say that then he replied "Whenever I hit enter after typing the password, its getting extended !"
I was like - "Please kill me!"2 -
Anyone else having trouble saving images to your phone from DR? When I try it just spins and hangs. Have to kill and restart.1
-
Scrum con religion is after me, I either convert or burn at the stake with scrum masters holding hands and dancing around while chanting the scram commandments.
Scrum will kill every decent developer on the planet and replace them with frauds...
Scrum's stupidity is toxic it's like being exposed to radiation - it makes you mutate into a brainless freak! -
Get an exciting new project: build a help center.
Someone decides we will be building it wiith Madcap Flare.
Gonna kill myself. -
Is it more morally correct to just kill yourself and let everyone know or leave a note saying you decided to move to this country and you will never come back and then die in a way and place you are sure no one can find your body and know what happened to you?32
-
> trying to kill Windows Update to let anything else use my HDD (as I re-enable it occasionally then forget to disable it before shutting down)
> Task Manager shows 2 instances of CMD, grep from temp, 4 instances of net and "Microsoft Windows Netcode Generator"
yeah i've gotten bit by something9 -
Honestly, fuck my computer. I dual boot win10 and arch, and due to some work i had to do over on win10, its been 2-3months since i've booted back into linux. Today i decided to go update my stuff, turns out it wont even boot into to GUI. When i try to go in tty and upgrade everything with pacman, it gives me an error without even telling me whats the problem. Next i try to install it again to another hdd, doesnt work. Someone please kill me swiftly....9
-
Fuck Facebook and fuck their Graph API. Would it fucking kill somebody over there to write actual facts about request limits instead of that pretentious bullshit about their CPU resources and just how cool and awesome it is for me to use.
-
For our internship requirement. We developed a web-app with inline Javascript and CSS. I know, it was only a matter of time for our senior dev to kill us. HAHAHAHA2
-
PR done and dusted. Welp! Somehow all permissions on files have been changed. I didnt change it. Wtf happened? Log search turns up I did change it while resolving merge conflicts. I don't know how. Anyway now I am spending my afternoon working on the vaguest fucking issue and reverting back all file permissions. Might have somehow fucked up two repos and will have to fix them all. Kill me. Now
-
Everytime I open devrant, it starts from a particular rant page. No matter where I navigate and close/kill app,it still starts from same rant page. Anyone experiencing same?4
-
ChatGPT is a manifestation of how characters from Star Trek TNG++ used to pair with the ship's computer.
Sure, sometimes the computer became sentient and tried to kill everyone. But they dealt with it, ya know? -
I have an errant ; appearing in a react app screen. Hundreds of components in this friggin monstrosity.
How would you find the extra ; to remove it?
Kill me now!9 -
I hate nothing as much as I hate endings. I'll go to lengths to avoid putting an end to anything.
So I'm super anxious these days trying to put an end to a project I've been working on for a long-ish while. 😐
Literally I rather having nerve diseases and be in pain 24/7 than submitting it.
Kill me plz. 😫3 -
Expo works like shit. Sometimes it reloads on code changes, sometimes it doesn't. It can't wait for me to accept USB debugging on my virtual android device so I need to hit connect button twice. I just got "Error: null". Sometimes it downloads the package to 100% then does nothing. Sometimes it doesn't even attempt to unless I forcefully kill it and start again. Fuck this shit.
-
I wanna kill math rn. I’m in algebra 1 for the second year in a row and instead i spent an hour till I found this app so I can rant instead of getting it done …..and im like 3 weeks behind. Idk what to do with myself rn1
-
!Dev
Fuck people using trace rifles in momentum control. How the hell am I supposed to kill someone who kills me in two rounds and also fires at 1000 rounds per minute. I was trying to get the catalyst aka upgrade for the seasonal weapon which is pretty bad and the upgrade makes it usable but I am getting ripped apart after my first kill because someone can kill me with 2 bullets wherever he shot me.
Yes momentum control is supposed to be a gunfight mode and it comes around rarely but that does not mean a broken weapon can roam around killing anybody in sight before they even know you fired a shot at them from some lane. Shotguns do the same but you need to get close. Shotguns are still a problem but at least you can dodge or counter with a shotgun since your radar tells you someone is nearby and snipers need a headshot. These weapons can fire at your toe and you are dead. Oh the devs knew that such fast firing weapons wil be op and needed their damage and made them use the same ammo as shotguns, sniper and non heavy grenade launchers. However the game mode gives all weapons a damage buff which is enough for trace rifles to be broken. Yes you can use other primaries but what are you gonna do when a auto rifles kills you with two shots to the toe. And since they burn ammo quickly and take more rounds to kill then their counterparts like shotguns which use he same ammo as them they spawn in with 50 in the mag and anybody who is using shotguns snipers or grenade launchers give them ammo and they only need two rounds to kill. Also after I kill 50 PvP opponents I need to kill a few hundred opponents in PVE or PVP to actually apply the upgrade and who you kill does not matter.
Seriously and the second weapon I want to upgrade which is able has tracking but you need to aim down sights after hipfiring the tracking shots
which dl negligible damage so they explode or aim down sights and shoot which deals more damage but I am probably not going to have enough time before some random kills me again.
And this is just the first game. From what I heard it was supposed to be a fun game mode which focused on gunfights with your primary not the infamous laser tag show of Prometheus lens which happened a few years ago but now all trace rifles can do that. Oh and I still need to get 50 kills there for a seasonal challenge so I can get the free version of the premium currency and I can only skip one challenge and I have already skipped one challenge since it requires a dlc K don't own.
Seriously why cant some actual good game come up to challenge this. All the competition seems to be third person shooters. Also most of the guns don't feel good and lore is pretty lacking but lore is not top priority. The only competition is Warframe which is not my style, Titanfall 2 but I get insane pings from here so no multiplayer so after the story nothing to do unless I want to do airtstrafing which is useless since I can't play multiplayer. Granted Titanfall 2 is not a looter shooter but the guns feel good and the movement is too good and Halo 1 - 3 since I heard 4 and 5 are pretty bad and I have only played halo 1. I might complain about jackal snipers in halo 2 but at least they have fixed spawns.
Maybe I am overreacting since it is my first game of momentum control -
What if all devRant community works on a global project to kill Google, Apple, Facebook and others? I am a utopian guy, but it would be cool?!?
-
If someone can shed some light on this behavior, would be appreciated:
I am running a couple of docker containers with lighttpd on my server (lighttpd is also installed on the host server for reverse proxy). Now whenever I kill lighttpd on my host server it also kills ALL the running lighttpd instances in my docker containers. Isn't docker supposed to be, idk, CONTAINERIZED?2 -
manually writing a post request, filling it out and having to debug it vs just using the existing point and click interface ur product has and calls the same endpoint under the hood, and is already programmed to automatically fill all that tedious shit correctly etc for you
somebody mercy kill me already2