Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "why is it so hard"
-
Boss: I need you to start on this new project, how long will it take?
Me: well, hard to say with no specs whatsoever...
Boss: just your best guess
Me: 4 to 6 month I guess?
Boss: so 3 months it is. When can you start?
Me: no specs, sir...and I said 4 to 6
Boss: the specs are almost ready, I know you can simplify it
Me: ...
Boss: just start with the basic infrastructure already
(4 months later)
Boss: here you are the specs, they might change a little in behaviour and design, but all the main stuff is here
(Hands me a A3 with a total of 21 pictures in InDesign)
Me: o....Kay. what happens when I click here?
Boss: oh, we should still talk about the app workflow, I'll get you updated
(2 weeks and 16 total rewrites of the "specs" later)
Boss: you told me it was a 2 months job, why aren't you finished yet? We must deploy in 3 weeks!
Me: ...34 -
I don't understand why every non-technical person who comes to do work in my apartment messes up my fucking router.
The cleaning lady - multiple times knocked the antennas partially off. Like fucking clock work. I don't get it, why is the cleaning lady attracted to my router antennas and why does she need to be so hard on them? Whatever.
The most ridiculous episode was today. And it wasn't the cleaning lady. I had a few people here doing some work today and the woman in charge who was here informed me before that they might have to move the furniture "a little."
I come home, and like a bad omen, the plastic parts on BOTH my router antennas are missing. Completely gone. It's just the the wires. Now, the router still works fine in my tiny apartment, but it is a fancy Asus router (I learned the hard way not to buy cheap routers) and I'd like it to not have fucking wires as antennas.
I email the woman (paraphrased):
Me: hey, it seems the antennas got knocked off my router, do you have any idea where they might have went?
Her: Apologies if we didn't put everything back (no shit you didn't, that's why I've had to email you). If we knocked the antennas off the router (fucking "if"???? I literally just told you in my email that they were knocked off) , they are probably somewhere by the window on the floor (they weren't).
And I still haven't found them. Why the fuck do these people seemingly attack my router? I can't figure out what it is about it. You would think people would be more careful around electronics but naaah. Anyway, going to go keep looking for my router antennas.44 -
So, since I hear from a lot of people (on here and irl) that Linux has a 'very high learning curve', let me share my experiences with the first time my dad touched Linux (Elementary OS) without me interfering at all! (keep in mind that he is very a-technical)
*le me boots the system* (I already did setup a user account for him and gave him the password).
Dad: *enters password and presses enter*
Me: "Hmm that went faster than expected."
Dad: "Uhm I know how to login son, it's not that hard and pretty obvious".
Me: "Alright, why don't you try to open up the default word documents editor on here! I'll be right back!"
Me: *Goes away and returns after a minute*.
Dad: *already a few test sentences typed in LibreOffice writer* it's going pretty well :)!
Me: "Oo how did you find that?!"
Dad: "Well, there's a thingy that says 'applications' so I clicked in and found it in the "Office" section, do you think I am blind or something?!"
Me: 😐. uhm no but I just didn't think you'd find it that quickly. Now try to install Chromium browser! *thinking: he'll fail this one for sure* I'll be right back :).
Me: *returns again after a minute or so*
Dad: *already searching for stuff through Chromium*
Me: "wait, how the hell did you do that so quickly, it's not the easiest thingy for most people".
Dad: "Jesus, it's not that hard! I went to the application browsing thingy, typed 'software' and then a sorta software store icon showed up so I clicked it and it opened a windows with a search bar saying something like 'search for applications/software'. clicked in it, typed 'chromium', saw it coming up, there was a very clear 'install' button, it asked for my password, I put it in and after a little it gave a notification that it was installed. Then I went to that application browsing thingy again and typed Chromium. Then I hit enter because it selected an icon called chromium...."
Me: O.o. Okay this is going very good, now open an email client and login to your email address!
Dad: *goes to application browsing thingy, types 'email', evolution icon shows up, dad clicks it, email address setup steps show up and dad follows them quickly. After about a minute, everything is setup.
I expected this to be a hard process for someone who dealt with Windows his entire life but damn, I underestimated it.
Asked him if he found it easy/what he liked about it:
"Well, it's very clear where I can find everything, default browser/email/word document editor programs are easy to find and that's about all I need so yeah, great system!"
I am proud of you, dad!77 -
So my actual job is being a nurse at the local hospital, with coding being just a hobby. However, the way some IT–Related things are treated here are just mind-blowing. Here are some examples:
Issue: Printer is not recognized by network anymore due to not being properly plugged in
Solution: Someone has to tell the house technician, if the house technician is currently not available, ask his assistant who only works part time and like twice a week. House technician took the printer (God knows why), came back 2 days later and plugged it back in.
Issue: Printer 1 of 2 on ICU has run out of ink and since all computers default to printer 1, nobody can print.
Solution: Call the house technician, blah blah, house technician comes, takes ink cartridge of printer 2 and puts it into printer 1.
Issue: Public WiFi is broken, can be connected to but internet access is missing. Probably config issue as a result of a recent blackout.
Solution: Buy a new router, spend 5 days configuring it and complain about how hard networking is.
Issue: Computer is broken, needs to be exchanged with a new one, but how do we transfer the data?
Solution: Instead of just keeping the old hard drive, make a 182GB backup, upload it to the main file server and then download it again on the new computer.
Issue: Nurse returns from vacation, forgot the password to her network account.
Solution: Call the technician who then proceeds to open a new account, copies all the files from the old one and tells her to pick an easier password this time. She chooses "121213".12 -
Not a specifically dev related story, but absolutely rant worthy.
Today I was working from home, and my wife called me to tell me that some awful person had thrown a young cat into the dumpster at her work.
To that person - you are a scumbag. You’re lucky no one left you alone in a hot car as a kid, let alone a dumpster. Seriously, why? Why is it so hard to take it to a shelter?
Anyway - I went and bought a whole bunch of cat stuff - I grew up with cats but I’ve never had one on my own. We’re at the vet now. I think we’ll name her Curry (after Haskell Curry, and lovely spicy dishes).22 -
WHY THE FUCK IS IT SO FUCKING HARD FOR THESE CUM SUCKERS TO UNDERSTAND THAT CHANGING REQUIREMENTS 2 DAYS BEFORE THE DEADLINE IS JUST GONNA BREAK EVERYTHING!?!?
I DOUBLE DARE ANYONE TO TELL ME ITS NOT WORKING TOMORROW...
STUPID MOTHER FUCKER PMS CANT PLAN ANYTHING6 -
This is just my token of appreciation for the Skype devs. Can't begin to say how much I hate it. Your android app is a joke even after a host of updates, your desktop client is an even bigger joke (atleast Linux Beta version, I know betas aren't supposed to be stable but this is ridiculous).
You have reinvented chat clients to be extremely bulky, cumbersome and very hard to sync across devices. And you have managed to make it "buffer" more than a YouTube video does on a 2G network. I for one, am blown over by how you did that. And to top it all, you can't close the client on Linux atleast! All you did is just override the close button so that it only minimises it. Brilliant piece of work right there!
Why the hell can't you just close the client and run it in the background the proper way like everyone else does? Why does it have to take 20 *** seconds to open a message? The only reason I am stuck with this is some wierdos in the office still only use this. Get your shit together 😡
Ahh.. I feel much better now.18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I hope you will forgive me for a third hand story, but I'm one of those evil developers, not a support per se. But I thought you'd enjoy this story anyway. So this happened to a colleague of a colleague:
$Hero - our hero. $Cop - A representative of our hard worked law enforcement agency.
So $Hero is happily speeding along in his car, running a few yellow lights a bit late, etc. Finally, the law catches up to him and pulls him over. Here's how the conversation went:
$Cop: Can I see your driving license, please?
$Hero (with smug grin): Certainly. Here it is, officer.
$Cop takes license back to motorcycle and speaks into radio.
$Hero: It's not going to help you any, though.
$Cop (with no reaction): What do you mean?
$Hero (with wider grin): The server you have to check it against is down.
$Cop (still no reaction): And why do you say that?
$Hero: Because I'm the guy they called to get on site and get it up again.
Our hero did not get a fine this time. Instead he got a police escort to his workplace.
Source: reddit r/talesfromtechsupport3 -
Got basically nothing done yesterday because I was absolutely exhausted the entire day. Thanks, doxxing thread. But I couldn’t sleep anyway so whatever.
Told everyone at home that I wanted a really productive day tomorrow (today) because of it.
Guess what happened?
Endless fucking distractions.
Because of course.
• Cooking since apparently it’s my job.
• Extended computer repair and maintenance, since that’s apparently my job even when it’s not my computer.
• Conversations.
• Children following me.
• People paraphrasing politics.
• People summarizing stupid fail videos.
• People relating stupid prank videos.
• More conversations.
• Endless random nonsense comments from children.
• Endless noises from children’s toys, tablets, playing, etc.
• Children following me when I leave.
• Taking half an hour to order food instead of five minutes.
• Cleaning since nobody else ever does.
• Picking up toys since nobody else will and I’M FUCKING TIRED OF STEPPING ON AND TRIPPING OVER THEM.
• More fucking food prep.
• Endless random nonsense comments from children.
• More conversations.
Is it any wonder I’m so fucking pissed off every workday?
I can’t wait to move so I can have a fucking office with a fucking door and a fucking lock. And you know what? I’m going to splurge and install some fucking soundproofing, too.
WHY IS IT SO FUCKING HARD TO JUST LEAVE ME THE FUCK ALONE!? I’M PAYING FOR YOUR FUCKING EVERYTHING. FUCK THE FUCK OFF!19 -
Uncle- What do you do?
Me- I'm a software engineer
Uncle- My brother's friend's son is also a software engineer.
Me- (so what am I supposed to do about it?) yes that's nice
Uncle- I have a great idea, u should implement, I'm just telling you, it is a revolutionary idea
Me- (oh fuck, not again) yes tell
Uncle- you should make a matrimonial site which tracks what people do on internet and tell their to-be-spouses about it
Me - (yeah, I'll get sued for breach of privacy, and it has got nothing to do with my current line of work, and will probably cause divorces before marriage) yes great idea uncle
Uncle- see I told you this billion dollar idea, u should do hard work and make it
Just WHY in god's name do all uncles think laptop is a magic box in which I just have to type their idea in and it will spit out a website/software in 2 minutes. I don't go around advising them about their line of work.11 -
PM: Please get this done by tomorrow. It's just a small change.
Dev: No its not that simple.
PM: Why is it not simple? Please explain so I can understand.
Dev after a hard thought finally explains: blah blah blah
PM: Well, we have promised the client so please do this by tomorrow, thanks.
Dev: *bangwall9 -
After weeks of hard work creating a website:
It looks so beautiful 😭
*opens in a different browser*
WHAT THE HECK! why is all my divs flying here and there !
*opens in mobile*
f*#k this9 -
All web developers should support up to IE9 without any problems.
Why? Because in Korea, it is normal.
Every person uses that damn Win7, which has either IE9 or IE10. Without IE support, no one will browse your webpage.
Now you would ask us, why don't you use other modern browsers?
We would then ask you, why would you install a new browser that is
1. Buggy
2. Heavy
3. Takes up ram
4. Has so many features
when you have an awesome minimalistic browser that is preinstalled, and works in all Windows? No thanks.
So, if you put a message saying you will soon drop support of IE, it means that you won't target Korea. Just after the support drop, there won't be traffic to your web site.
So what is the point of this rant?
1. We love IE. Lol
2. IE is lightweight, minimalistic, and the fastest browser in the world.
3. All websites should NOT drop support for IE.
4. We don't care whether web devs will have a hard time. We just think websites are built with Wix and Wordpress, and they work in IE, meaning, IE support is the number one priority.
5. If you ever start a business in Korea, and has a website, make sure to hire an senior Korean web dev who has worked with IE for a long time.
6. Here is the tl;dr
Hate us. Period.25 -
why is it so hard to convince people to start using slack chat and giving up sending internal emails?10
-
Yet another rant about crappy electronic designs.
Just now I was cleaning my desk and stumbled upon some old hard drive in a caddy that I still had laying around.. I figured, let's plug it in and see whether the drive still works. And to some extent, it does! Except that every few minutes it craps out on me. And after disassembling the caddy, I think that I know why.
Just as background information, hard drives work at 12V and generally require about 10W to spin their motor. Meanwhile USB operates at 5V. So a boost converter needs to be present in the controller to step up the voltage and power the drive.
Now what's a boost converter? It's an inductor, a capacitor, a transistor and a diode in a specific arrangement (if you're interested in the design, check out https://youtube.com/watch/...), along with feedback circuitry to stabilize output voltage. Now that transistor is important.. it switches at very high frequency, and its rise and fall times create heat. In the particular transistor used in that controller, it apparently causes the transistor to operate at 65-68°C. That's quite toasty IMO, and overheating may be why the controller is so unstable. But the Chinese manufacturers thought that it's just fine and okay to be sold without heatsink or some research into transistors with better rise and fall times.
So the hard drive craps out on me and yet again it's because of certified shitdesigns. MOTHERFUCKTURERS!!!!27 -
HoD in my college is a "22 year experienced C programmer" with a PhD in CS.
One day I went to him and told, it is very hard to work with TurboC, and it isn't needed as we can easily migrate to GCC.
He asked me why was I complaining. No other student has any problem. They have been using it ever since the college started and everyone was "comfortable" with it.
I stood silent. He then went on to say, even JVM was coded in TurboC. I nodded and left the office as i didn't have an argument.
He's the same guy who had earlier said, "printf returns an array of characters printed", so I guess everything works here.11 -
I hate this fucking front-end stuff so hard..
How DA FUCK is it possible that I set up the whole backend including DB connection, base controllers, models, base validation and stuff in an hour but don't get this fucking fucking retarded JS framework piece of shit to display a test string after ONE FUCKING HOUR!!!
Why do we need this shit anyway? Why does everything have to be shiny with some fucking animations???
It's about the information, isn't it? Then WHY DOES IT HAVE TO LOOK PRETTY???
I gonna travel back in fucking time to the early 80's!
Stupid front-end shit..23 -
- If I buy x amount of ram | hard drive space | cpu power I will never need more.
- No need for version control | Tests. This is a small project
- git commit -m "changes" (its a small change. I will remember why I did it)
- It is too obvious that I put a lot of personal time in this so my boss will definitely notice!
- Why comment this simple method? Anyone should know what it does. Especially me!
- "this should never happen"
- This call can't be from work. Everyone knows I am on vacation.
- I will back up next week. It's not like it is going to crush today.
- It’s 11:30 already? I will work on this for only a half hour more and then I will definitely go to bed!
- This project will take x amount of time!2 -
Working on a project where the coordinator is insisting on using OneDrive. Lost the link he sent out in an email so decided to:
- Google "OneDrive": Eventually brought me to "office.live.com/...." with a view of my settings and apps ... no OneDrive.
- Spent a while using a bit of logic to click around and find it, forgot logic doesn't work well with MS products and ended up on Outlook instead.
- Spent a while searching for the original email with the link, found it, brings me to "...sharepoint.com/....".
- Inside sharepoint (OneDrive?) the banner says "Office 365".
- But the browser tab says OneDrive.
Are Microsoft just afraid of consistency at this point? I mean seriously, pick a name and use it everywhere. Why is that so hard? why is that so complicated?6 -
Really, I hate this composer / bower / npm shitholes!
Why the hell is my app 300MBs?!? Because that shitty pudding composer decided to download the ENTIRE git including README.md, examples, 5 hours of assembly-giraffe porn, my granny's pajamas and two wraps of kebabs!
How hard is it to define the folder that contains the REQUIRED library so that our project might stay at 5MBs instead of 300?18 -
Why do users find it so hard to understand short and clear error messages that are in place to inform them what's going wrong? Why do they instead waste my time when the message clearly says that the password is too short and hasn't got any special characters? FFS!4
-
So I've decided if I am invited to a school career day the what I'll do is this.
1. Start by handing out one of those logic puzzles that are like Sally lives 2 houses down from Bill, Bill is 3 houses away from Maggie where does Jerry live type of thing. Then I'll tell the kids they have 10 minutes to figure it out.
2. After about three minutes I'll tell them that they also need to figure out where Jerry lives and not give them enough information to figure that out.
3. 5 minutes in I'll start asking them why it is taking so long, and it shouldn't be that hard. I'll also ask about where Phil lives who was never mentioned before.
4. At 7 minutes I'll look for anyone who might be figuring it out and tell them there is a much more important high priority problem I need them to solve and give them a new puzzle and tell them I expect them both to be done on time.
5. At nine minutes I'll start yelling at them that they must not be that good and why they haven't finished yet if any of them complain I'll tell them they are just dumb.
6. At ten minutes I'll ask them to turn it in and then immediately throw it in the trash and tell them that wasn't what they were supposed to be doing, and tell them they did it wrong.
I figure that is a pretty good representation of what working in software engineering is like.3 -
It's only day one of the year and I'm already pissed right off
Why the fuck do all clients expect you to come up with absolutely everything!?
All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.
Well what are they?
Pft.. I here is a name if our products. And other stuff
WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES
Yeah do you want them
Of course I do 😐
Great here's 2 of them we have 1100 so I'll get more to you soon.
😤 Thank you!
Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough
I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site10 -
I see many people being irritated when it comes to StackOverflow and If I were to be honest I thought the same a while ago. But I noticed that I was misjudging the main point of Stackoverflow. It's not a forum to help people with their programming problems. It's a huge self writing document to gather every programming related questions and answers under a single platform if possible. That's why they won't down vote you even if you ask a question that was obvious in a language's official document as long as it wasn't in Stackoverflow. That's why questions should also be formatted accordingly which is clear and also informative in itself. I understand why stackoverflow is such a harsh place to ask questions and most of the time I prefer looking things for my self instead of asking a question. And I edit and review most questions on stackoverflow because I enjoy it. That also made me realize that stackoverflow needs to be elitist to preserve it's current quality. Who would want to see unclear duplicate questions that veteran stackoverflow users need to answer over and over again right ?
Asking the right question is hard because we humans most of the time don't know what we don't know. And it makes it really tiring to format your question the way that is fitting for a document. In those times I prefer to ask my questions on a more relaxed and chat focused platform before writing my main question on stackoverflow.
So that was my opinion on stackoverflow and it's harsh environment. It's definetly a hard to get into community which I can't even say I'm really a part of it. But looking at stackoverflow as a document that's being written by ut's users, it's easier to understand it's elitist approach. I hope you had some enjoyment from reading it.6 -
I couldn't sleep. I was staring at the blinking cursor. A slow, comforting blinking. Like everyone else, I had become a slave to the JavaScript ecosystem. If I saw something like a new build system, or a new framework, I had to have it.
My client changed the requirements again. I'm in pain.
- "You want to see pain?" my colleague said. Go read Apple support forums. That's pain.
I became addicted. Every time I died and every time I was born again. Resurrected.
During the night, I was crying in the Apple forums for an official answer that would never come. During the day, I was surfing StackOverflow to fix my problems. You get "single-serving" friends there. They help you, you help them, and then you never see them again.
- "Then you install Stack and boom, you're done. It's that easy to go functional."
That's how I met him.
- "You know why they make so many javascript frameworks?"
- "No, why?"
- "So that they can distract you while they put backdoors in them. So that you don't have time to check all of their code".
- "You are by far the most interesting "single-serving" friend I've ever met"
Then, my hard disk died. Of course, I didn't have backups: nobody has enough space for all those node_modules folders. All my addictions, lost.
Then I wrote him. If you asked me now, I couldn't tell you why I wrote him. We chatted a lot.
- "It's late, I should really go search another hdd on ebay"
- "Ebay? You called me so you could have my old hard disk."
- "No, I..."
- "Come on."
He sent me his old hard disk. It was a 256MB hard disk, but it was fine for running Arch. Then he asked me to rant about my problems in front of him.
- "I want you to rant as hard as you can"
- "Are you serious?"
We ranted all night about our bosses and clients and their fucked up requests. We kept in touch, and after a while more people were ranting with us. Every week, he gave the rules that he and I decided.
- "The first rule of devRant is -- you don't talk about devRant. The second rule of devRant is -- you don't talk about devRant."
I like to think this is how devRant started. This might also be the reason why we never see @trogus, only @dfox. A lot of shit still needs to happen.8 -
It was not me doing the screaming but one of my colleagues. He is a super programmer and joined our team early this year as my partner on frontend development.
We're a React/React Native dev house and he has always been uncomfortable with how loose it goes here because of dynamic typing. He has been advocating typescript and Angular since he started and I even allowed him to use typescript on one of the projects.
A month back I started to make jokes about how dead angular was (trigger alert) and he almost lost it. We are good friends so he as been taking it in good spirits.
Last week our boss allowed him a chance to propose a Tech stack for a new project. Naturally he started comparing Angular vs React. I chime in to trigger him again with "why would we work with a bloated zombie framework", he picked up his chair and almost threw it at me while screaming " React is just hacky ". I was laughing so hard and in the end we both did some research. We are proposing Jquery to our boss... (Evil laugh)1 -
Apple iPhone testing without being on the app store is so annoying, I had to sign up some people to test the app I've been working on and had issues on my end, it really is this whole security bullshit, really it isn't needed.
I couldn't get the team provisional certificate thing to show up because when I clicked the account the team certificate settings would disappear, only after right clicking and hitting help then clicking the team while it was selected could I go to the right window.
I don't see why it's so damn hard to do this crap.
Yet with Android, it's so easy.
I really have issues with the testing for this iPhone app, I went through so many different ways to try and get it to work.
Anyways all done, crashlytics is an awesome testing tool if you can get around that small issue I had.4 -
TL;DR age != competence
My boss is a fucking computer illiterate self taught programmer.
Don't get me wrong, he can do shit, pretty shitty but it gets done...
But the dude has 38 fucking years old and somehow still searches for keys on the fucking keyboard and struggles to touch type anything...
I sometimes crying the fuck out when I have to help him with something...
I'm having a mini fucking panic attack right now just thinking of it... Fuck
He is our "manager" but doesn't even have the fucking balls to confront his own subordinates when they need to be confronted... Everyone is aware of this and everyone is fucking around... And no one sees any consequences... I wonder why deadlines are always missed...
He is so passive that every fucking thing someone asks he goes and says it is OK...
I was studying same psychology about ignorance and I think he lacks the understanding that shit is hard to do...
We literary had a conversation the other day something like that:
Boss: so, what do you think? One call to the api for it to return all data or multiple calls to return smaller ones?
Me: well... It takes ~180ms just for latency to the server for one call, if you have 10 calls it will take 180*10ms, it is better if we have one call and cache it if necessary on the backend.
( he has no fucking clue wtf caching is, besides browser cache)
Boss: (looking confuse AS FUCK!!) Well, I don't get it... Maybe I'll test it later.
Me thinking: test how you dumb motherfucker? On you fucking workstation with no fucking latency?
There is no fucking test. I'm stating it. IT IS A FUCKING FACT!
Me: well, it takes that for the call to go to the api and come back , its simple math. 1 == 180, 10 == 1800.
Suit yourself.7 -
Why the fucking fuck is it so damn hard for me to draw a fucking curly bracket?!
All my sad attempts at it look like a 3 that was exposed to lethal amounts of nuclear radiation3 -
My previous manager: "Your code should hard to read, so our work is cant stolen by everyone".
Me: "Why?"
My previous manager: "Just do it"
Me: "Okay"
So, anyone can answer my 'Why?' question?
P.S: My previous Manager is PHP Programmer14 -
Why is skids trying so hard when it comes to talking shit about Windows? Do they think that is it the only way to get accepted into the GNU/Linux community?
Personally, I think people who does that look stupid and dumb.8 -
I hate buying new laptops. HATE IT. The manufacturers are always trying to do something that makes it more complicated to buy a laptop confidently.
Why not name all of the laptops with numbers? Make them really hard to differentiate. Then offer the same model number across multiple years so it is difficult to determine which year the laptop is from.
Oh. And let’s make sure every laptop has a major flaw in the form factor.
Let’a add a numpad that squishes the keyboard to the left in a weird way. Lets do something to the trackpad to make it awkward to use. Maybe the keyboard should have a weird configuration. Maybe we can put 4 spare characters of various colours on the symbol key caps. How about a battery only lasts a few hours. May we add specialized hardware so you are stuck with windows. Maybe we can make it super thick and heavy. Lets have a screen with terrible viewing angles. Since this laptop has no major flaws we should overprice it. No repairs or upgrades on this one because we filled the computer with glue. Lets double the amount of useless media keys.
It is like manufacturers are trying to design laptops like RPG game character classes. The fighter has no magic or stealth. The magician is weak and gets fatigued. The rogue is very stealthy but has poor defence and attack. The cleric can use magic but only to heal so it is useless in battle. The ranger is good at distance but has poor defence and no magic.
The only notebooks sold that are trying to make balanced character classes are MacBooks. Those cost a premium and aren’t reparable.17 -
every day I get phone calls from some idiot to moan about something I fixed.
I had a job to copy a site and use it for another company, with everyone's consent. I do it and found the original was garbage. hard coded functionalities. limited control over which pages appear in the menu and so on.
problem is the site administrator doesn't understand the system and made pages visible on the menu that shouldn't be and so on. these never showed up before because it was broken.
now she phones every day because she setup her pages wrong originally and tells me stuff like, why did you change this, it worked before and crap.
I never expected she would have setup the pages incorrectly so I never thought this would happen.
lesson here is if it's broken and you're the only one that's noticed, just bloody leave it.1 -
SICK AND TIRED OF READABILITY VS. EFFICIENCY!!!!!!!
I HAD TO SEPARATE A 4 LOC JSON STRING, WHICH HAD AN ARRAY OF A SINGLE KEY-VALUE PAIRS (TOTAL OF 10 OBJECTS IN THE ARRAY).
ITS READABLE IF YOU KNOW JSON. HOW HARD IS TO READ JSON FORMAT IF YOU GET YOUR STYLE AND INDENTATION PROPERLY?!?
SO I HAD TO
BREAK THE POOR FREAKING JSON APART TO A FUCKING DIFFERENT YAML FILE FORMAT ONLY SO I CAN CALL IT FROM THERE TO THE MAIN CONTROLLER, ITERATE AND MANIPULATE ALL THE ID AND VALUES FROM YAML BACK TO MATCH THE EXPECTED JSON RESPONSE IN THE FRONT END.
THE WHOLE PROCESS TOOK ME ABOUT 15 MINUTES BUT STILL, THE FUCKING PRINCIPLE DRIVES ME INSANE.
WHY THE FUCK SHOULD I WASTE TIME AT AN ALREADY WORKING PIECE OF CODE, TO MAKE IT LESS EFFICIENT AND A SLIGHTLY BIT MORE READABLE?!? FML.5 -
Complete and total rant:
You know what fucking confuses the holy fucking shit out of me? DESIGN
I have MAD respect for motherfuckers that spend their days tailoring shit away in CSS, writing custom animations and toggles in JS and ensuring that their HTML is pristine as fuck. I really do and in my opinion they should b getting mad props from everyone, because if they so decide to learn GOOD server side scripting then they are most definitely on their way to create some awesome functional and beautiful shit.
But...
I am not a designer by any means of it. And I know that shit is supposed to look good and work across a multitude of devices. Doing something like that takes me a couple of lines of code (granted, after hours of work that is) that may take a designer way less.
But why oh why do I see THOUSANDS of lines of CSS code for shit that does not take me half the amount of work that it takes other people?
Like seriously. I am trying to emulate the menu that university of Chicago uses(as an example for a lil design practice cuz i suck at it) and looking into their CSS I see thooooousands of lines of code to do something that I did in about two hundred.
So wtf man, do I suck so hard that I am missing some serious shit? wtf is happening? This confuses me, because in my mind it should take me just about as much work as it takes them right?
AGAIN MAD RESPECT FOR DESIGNERS -- If you are a designer reading this please tell me wtf is happening14 -
I had a manager who scolded me in me in public on a non-IT floor because I used child classes and overloading of methods which "is too hard to read". Instead use "lots of ifs and else's". This is the guy that had a JSP so large (be cause he had so many ifs) that it couldn't be compiled even on a server.
The best karma happened a few months later. I was looking for a new job (wonder why?) and was very deep in the interview process - like round 5- of company A. I got talking to this jackass, who had no idea I was interviewing, said "yeah I applied to company A once. Couldn't get past the first round. Great benefits, though.". Me getting the job a week later was the best thing ever. -
DO !!!NOT!!!!! USE 'X' AND 'P' TO 'CUT AND PASTE' A LOT OF LINES ACROSS FILES IN VIM!!! HOLY SHIT I JUST PWNED MYSELF SO HARD I LOST SO MUCH CODE HOLY FUCK IT'S NOT EVEN FUNNY! WHERE DID AT ALL GO YOU ASK, WHY THE FUCKING REGISTER, OK LET'S CHECK THE REGISTER, COOL THERE IT IS, BUT WAIT, THERE'S ONLY LIKE 20% OF IT BECAUSE WE CUT A SHIT LOAD OF LINES AT ONCE, AND THE REGISTER OVERFILLED.... Ok let's calm down, doesn't Vim have a recovery option? Yes it does, but WAIT A FUCKING MINUTE, MY CHANGES ARE NOT IN THE SWAP FILE BECAUSE IT'S NOT LIKE VIM CRASHED OR ANYTHING, MY DUMB-FUCK-ASS WILLFULLY WROTE THE CHANGES WHEN I SWITCHED OVER TO THE NEW FILE, AND NOW, WELL THAT'S IT, YOU'RE DEAD KIDDO, YOU WROTE THE CHANGES TO DISK, NOTHING YOU CAN DO, AND I AM SO SCREWED I SPECIFICALLY MADE A DEVRANT ACCOUNT TO MAKE SURE NO ONE ELSE PWNS HIMSELF AS HARD AS I JUST DID HOLY FUCK17
-
Fuck Xcode!
Why does every single and small update need to be at least 5GB? And why am I required to update you so fucking often? You are not fixing anything, so don’t even pretend to! Most of the time it is just to support the latest .x update in iOS. Can’t be too hard to update the SDK without updating the entire shit IDE! 😡
And guess what: I JUST UPDATED YOU, SO WHERE IS YOUR FUCKING NEW VERSION??? HOW CAN I WAIT 45 MINUTES AND AFTER THAT YOU DID NOTHING!?! HOW CAN I HAVE THE SAME VERSION AS BEFORE??? NOW I HAVE TO DOWNLOAD YOU AGAIN YOU FUCKING PEASE OF SHIT 😡😡😡1 -
What I don't understand is why it is so hard for some seniors to just let me jot my notes down, I get it you're busy but if you just let me write down certain key words, I will never ask you this question again, I am nervous cause I had to bug you for help so my mind is not taking anything in, its freaking out cause you're making it so clear I am a bother! So I'm gonna go back to my desk without notes and no idea of what you just tried to tell me.... It was never a problem for my first senior, and he even became my mentor! In a question of 6 months he could go on holiday cause I could handle all his responsibilities until he came back with my trusty note book in hand... So why are you telling me to stop making notes!! It works for me so leave me be!! - sits at desk, pondering why I exist - 😖16
-
Why is it so hard to read a 15 pages paper or article? I read hundreds of fiction pages or news in a day, but reading 100 lines of a scientific paper is a pain in the arse and I lose concentration by line 3.
Fak.9 -
Why is it so hard to just build machines that work without all this ideological bullshit? Code doesn't care if politics==true. The world is scary enough without you assholes making modern life a data minefield for even the most educated experts, and taking advantage of the ignorance of everyone else. Fuck you.
I just wanna <look at web pages> without having to consider, counteract, or silently assist some fucking regime. Why is EVERYTHING this way? Everything is a back door or a data mine or a political statement? This isn't a fucking art piece! It's not your espionage tool, fucking codes in invisible ink and tiny cameras and shit everywhere! It's a <web browser>, and if it does ANYTHING besides <browse the web> that I didn't explicitly tell it to do, you better better not be the one who made it. Because if you did, you are what's wrong with the world.6 -
Rant. (I love and respect all people! Especially developers.)
You frontend imbecils! I just can’t deal with you any more. I’ve had it.
Stop-inventing-new-components-where-there-are-fully-developed-and-working-concepts!
I mean. Just fucking stop! If I see another worthless datetime picker with an ”innovative” design I am going to hunt you down and freaking scream in your face.
And make fucking buttons look like tappable/clickable. It’s not fucking hard! Imbecils.
Oh, ooo, look at me, I am a frontend developer and I am in UX la-la land and what I am doing is sooo hard. Fuck off with your fucking moving gradients and n:th-child childish playground.
”Yeah, I exchanged the spinner…”
Fuck you. Your not contributing. Nobody cares! We’re not doing anything for the business by having a web which can be seen on a fucking telephone. EVERYBODY IS SITTING WITH SEVERAL GIANT MONITORS AND A FUCKING WORKSTATION FOR THIS. NOBODY ASKED FOR IT. AND YOU SPEND COUNTLESS HOURS ON IT.
”Yeah, I made the site work on ipad”
Please. Why? It’s not worth anything. Zero value.
”Yeah, the toggle component is now changed since we started to use the biddle-flipflup lib and it works almost the same”
No! NO! It does not work ”almost” the same. The psychology of the toggle is now wastly different. What was On before now looks like Off and it is fucking worse!!!
Imbecils. I hate you.
And no, I can’t do your fucking work! And I know that you do other non-ui stuff as well sometimes… but anyway… I have no interest to be in that clusterfuck that modern frontend is today. It was really fucking bad twenty years ago and it is just as bad today and you are not helping.
”I’ve improved the button so now it aaaaalmost does not look like a button. But I am getting there!”
Fuck you.14 -
I'm planning on writing an open source (and much improved) version of my logger, but I'm stuck on picking a name :<
So, anyone have naming suggestions for a tagged and branching/nesting logging library? (ES6)
(I don't think "deforestation" is a good choice. sounds kinda bad.)19 -
SUNDAYS ARE THE WORST!!
Normally it’s the weekend but recently it’s just so stressful!
It’s like you can’t even relax because you’re supposed to be preparing for the week ahead!
It doesn’t feel like the weekend anymore!
Why is planning and prioritizing
So MF Hard for me!?!!!!
Why did my brain cope with stress and trauma by simply checking out & spacing out!?
I got so good at it that I find it hard to bring my focus back—it takes soooo much effort to do what i need to do
I’m So Freaking TIRED.15 -
So I need to let off some steam, let me know if you think I need to calm down. Personally I'm just having a hard time understanding my team lead.
So I've been trying to update our codebase for the past two months so we run tests against the latest versions of each respective major browser. I've also been trying to cleanup our code and split it into logical modules.
Need I add, according to Bitbucket, I've written over 80% of our code on our 4 projects with 4 team members including myself.
He's out for a week, so I decide it's fine time to get some work done -- which is ridiculous in itself. I finish, add unit tests for crap I missed because he kept shutting down my PRs for shit he couldn't understand.
He tells me on Friday, when he got back, that he'll be declining my pull requests because my code is too complex -- my team lead -- thinks list comprehension and OOP in Python is too complex. Doesn't understand why we need to have pep8 lint tests, or why we can't just export one giant monolithic client package with over 3k lines of code.
Is it worth arguing or should I just let my department head know I can't work on this team anymore? He won't get talked to or fired, he's been at my company for 6 years and he's in the inner circle.6 -
WHY???
WHY THE FUCK ARE YOU SO FUCKING SURPRISED SHIT HITS THE FAN EVERY GOD DAMN TIME A CHANGE IS MADE IN YOUR LIMPING SYSTEM?
YOU GAVE NO FUCKING SPECIFICATIONS NOR ANY CARE TO DECIDE ABOUT WHAT THE FUCK YOU WANT IN IT.
EVERY TIME I SEE THE CODE I GET EYE CANCER, DEBUGGING THIS SHIT IS AS HARD AS FINDING THE FATHER IN A HOBO STREET ORGY
AND YOU FUCKING THINK ADDING FEATURES INTO THE SYSTEM UNDER THESE CIRCUMSTANCES IS SO GOD DAMN EASY.
I hope life's god damn dandy for you, get fucked with a pipe bomb.
Oh, hello DevRant, sorry for sitting on the fence for the past months.4 -
Me trying to take a screenshot with iOS 12:
*holds home and presses lock* (the only way I had found to reliably take a screenshot in previous versions): Siri
Fuck off Siri I want a screenshot!
*tries again same way*: Siri
Fuck OFF Siri!
*holds lock + home*: phone locks
Christ almighty.
*unlocks phone, presses home and lock at the exact same time*
Nothing happens.
*continues holding* I just want my fucking screenshot.
Phone powers off. Hard reset.
Fuck this shit.
How hard is it to monitor two buttons being pressed at the same time? And if it is so damn hard why make it the ONLY WAY TO TAKE A SCREENSHOT??!
Now whenever I want a screenshot it’s basically a crapshoot whether I will get a screenshot, Siri barging in, or my phone locking on me.
Couldn’t they have just used the volume buttons instead? 😡12 -
I don't get people..
He is a good person and and realy tries..
Tries what?! To annoy coworkers that have to fix every single thing he does?!
Some people will justify anything with 'he is a nice person and tries hard'. WTF?!
So if someone is a nice person, likes to talk a lot, has 'good' social skills but writes crappy code he doesn't test at all.. or tests and see that it's glitchy and still doesn't fix it.. so he is a good worker for that?! Dafaq?!
So if he is a 'lovable' person, he deserves to be here, doing more damage than helps.. he deserves to have a job, with same pay (or even more) than me?! WTF?! How?!
Why is this ok?! If we were heart surgeons and he killed a person or two due to lack of skills or negligence, what would happen?!
He'd get fired on spot!! Why can't it be the same with devs?!
Why on fucking earth do we need to put up with people who try their best and fail?! Especially if their best is lowest of all, lower than the 'I don't give a fuck, just doing sth so the boss stops nagging'?!
Fuuuuuuuu!!!!
But ok, some people are not cut out for some work, I get it.. but why the fuck do other people justify that with 'he tries'?! Dafaq?!
Maybe next time 'I'll try' to perfom brain surgery on you..and you'll end up a fuckin plant.. is that ok with you?! I'll be trying (not really) and do my best (well I will try not to use a chainsaw when cutting open your head).. will that be ok with you?!
Fuck!!5 -
I was not having much respect for out front-end developer, as the UI is not so good., yea. I know it UI depends on the designer.
Now the new design changed and our UI looks awesome.,
and I must say that my respect increased a lot when my pm asked him to fix the layout in UC Browser.
Fucking shit., in UC it is showing two lanes as one lane. I don't know why., he was working hard to fix that.
Massive Respect to him. I really happy by being backend dev.8 -
ŁEŊ@#fmęgwjnfčuÆ®ŊÆŁEŊ3ŋ4ħ€3łæŋ€4æł4ħæ4€ħ9æŋ98ł3ħŋ98↓łħ€9“→↓ŋħł93ŋ@38ŁŊ89ÆŁ4ĦŊ08ÆŁĦ093Đ3@09ŋæłęb„guwahęgawęgÆŁ$ĦÆEı$Ŋ(ÆŁ#Ŋ↑(łæ49↓ŋw
AAAAAAAAAAARRGGHHHHH!!!!!!!!!!!!!!!!!!!!!!!
I'm gonna break this laptop in half if I will not get a break from Windows!
I'm running it in a VM and STILL this fucker gets on my nerves SO FUCKING HARD!!!
1. CPU% 100%. Laptop fans are spinning so hard it's ready to take off
2. My hands are on the laptop. THey are HOT from the heat from inside. Hell that's uncomfortable!
3. ctrl+shift+esc to see why is cpu% 100%. It's something called WMI Host something. Kill that mthrfckr!
4. Process respawns immediately and goes up to 100% again. I have already increased handles limitation for that service a few weeks ago. Like 20x more than it was before!
5. website in IE
6. does not seem to be responding
7. hit f5. Nothing happens
8. Hit refrech buttong on the toolbar. Nothing happens
9. Place cursor at the address bar and hit ENTER. Nothing happens.
Meanwhile my hands are burning.
WHAT THE FUCK!!!
What kind of idiotic system is that!! My asshole is a better OS than this piece of SHIT!
AAAARGHHHHHHHHHHHHHHH#@ŦŊæ¶đ@#ĸogęq j
I'm super pissed. Better keep a 30-40 meters distance from me so the things I throw at you would not hit your ballz!
Now that I come to think of it, the only times I am THAT pissed is the times I am using windows. Srsly.8 -
To any and all family members, before requesting my help with the printer/computer/electronic device follow these steps to make sure I don't get irritated.
1. Make sure it's plugged in.
2. Turn it off then back on
3. Turn it off, unplug it for around 30s, turn it back on.
4. Request help
Why is this so hard to grasp? I don't want to stop my workflow with an issue that could be resolved in less than a minute!1 -
WHY THE FUCK DO MY TEACHERS KEEP USING SHITTY TRANSLATIONS FOR PROGRAMMING CONCEPTS?! Like dude, everything related to programming is in english, just use the fucking terms in english for fucks sake. There are some words like "array" that fit into portuguese sentences without needing translation, so why translate it?
Why do you use acronyms in portuguese? People in the Database Systems class will later read a lot the acronym DBMS but won't know what the fuck that is because they teach the acronym SGBD, which is a translation.
It's so cringy and useless, so many terms the students will have to translate back to english when they get out to the real world because everything related to programming is in english.
"oh but what if the person doesn't know english" you don't even have to know english, just associate the concept (which will be explained to you in your language) with an english word. Also if you don't know english you'll have a very hard time, so I'd suggest taking english classes as your electives.
Ok I'm done, I got it out of my system.6 -
Helping a friend who's a brilliant at mechanics and has his own patents, and got this question when downloading on his 10Mbit line:
"This was supposed to be a fast computer, so why is it taking so long to download?"
To explain the reason was surprisingly hard, considering that this is a guy who's been invited to give a lecture about innovation at a top tech university.1 -
Why is it so hard to build reputation on stackoverflow?? Can't upvote, can't comment til I get 50 reputation, can't ask for question clarification so I can answer a question except in a comment...6
-
Why you should always backup.
Nearly a year ago I developed a whole project (iOS, tvOS, watchOS), but I never backed it up because I had a recent machine and thought the chance that something happens to the disk is so small I didn’t backup. But then my mac didn’t start correctly. So I needed to reset it. Lose the project, some other files but not much else. Then I recoded the project and backed it up on multiple places. But a little later, I was writing another app, again didn’t copy again... This time I deleted the wrong folder and deleted the trash, was gone too. So from then I learned to copy everything I coded. All projects I work on, I keep a copy of on an external disk, GitHub and Bitbucket. Assuming they wont crash all at the same time 😉.
So I recommend everyone to backup all your code. Even if it’s only 500 lines. Losing it is hard...3 -
My best code review experience?
Company hired a new department manager and one of his duties was to get familiar with the code base, so he started rounds of code reviews.
We had our own coding standards (naming, indentation, etc..etc) and for the most part, all of our code would pass those standards 100%.
One review of my code was particularly brutal. I though it was perfect. In-line documentation, indentation, followed naming standards..everything. 'Tom' kept wanting to know the 'Why?'
Tom: 'This method where it validates the amount must be under 30. Why 30? Why is it hard-coded and not a parameter?'
<skip what it seemed like 50 more 'Why...?' questions>
Me: "I don't remember. I wrote that 2 years ago."
Tom: "I don't care if you wrote it yesterday. I have pages of code I want you to verify the values and answer 'Why?' to all of them. Look at this one..."
'Tom' was a bit of a hard-ass, but wow, did I learn A LOT. Coding standards are nice, but he explained understanding the 'What' is what we are paid for. Coders can do the "What" in their sleep. Good developers can read and understand code regardless of a coding standard and the mediocre developers use standards as a crutch (or worse, used as a weapon against others). Great developers understand the 'Why?'.
Now I ask 'Why?' a lot. Gotten my fair share of "I'm gonna punch you in the face" looks during a code review, but being able to answer the 'Why?' solidifies the team with the goals of the project.3 -
Why the fucking hell is it so fucking hard to find an Android phone without a shitty ass UI slapped over it?
Holy fucking shit this is fucking ridiculous.18 -
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA!
Okay, I'm feeling a bit better now.
How to stop being a lil bitch? Why does it seem like everyone got the "don't give a shit" patch except me? I'm working hard on getting my shit together, I've made MASSIVE progress, but everytime I'm feeling good and confident and ready to take the world head-on, I just kinda crumble again with the slightest mishap. This needs to stop. I'm really trying SO hard not to snap. Fucking hell, being aware of all this makes it even worse! It's like I'm two people, one is a downer and REALLY good in draining my brain power, the other is the guy who's typing this and knows that life shouldn't be taken this seriously, but doesn't stay in the cockpit for too long. I'm extremely tired and mad. I just fucking hate this.9 -
Fucking hell everything in java is so annoying, confusing and hard to get working. I just want to use JavaFX, why do you require me to sacrifice a lamb in order to do so? It might be my fault though, but c'mon, I don't want to spend 2-3 hours reading through shitty documentation in order to understand how maven works and what the hell Gradle is. Why can't it be as simple as adding a module name to a config file, like in Rust's Cargo? Even using intellij to acquire JavaFX and set it as a dependency doesn't work, it gives me some weird "JavaFX not configured" bullshit error. What the fuck, you're a library, you shouldn't need anything else ffs6
-
Why is Drupal so hard to learn?!!!!!!
It feels like you are learning an entirely new language. Yes it makes hard things simple, at the same time making simple things hard to accomplish.
And also modules are buggy, you would fix bugs instead of doing your tasks.
I want to learn Drupal but I guess it is not friendly for beginners like me.12 -
Fact, that I am making websites does NOT mean, that I will make a website for you for free. Why it is so hard for people to understand?2
-
An online community I've been part of for years has seen a lot of popularity/hate overnight due to a new policy. The influx of new people who want nothing to do with us but just drop by to troll and be cunts is impressive. Also, a significant amount of bots. I want my online home back :( I'm for the new policy and very much against these new clowns who don't really have any reason to be on our page. Before anyone yells gatekeeping, it's a site about knitting and crochet. Why would you go there if you don't know either craft and have no desire to learn or talk about those? So disappointed. I hope it brought new crafters in and that the trolls will go away soon. It's been such a nice place for so long with barely any idiots because it was reasonably small.. And now look at this mess. I logged in to 20 friend requests from people I don't know and am almost certain aren't real people.
Why is it so hard for humans to accept that some people may disagree with them and that's okay?17 -
To all frontend webdevs here:
Explain to me how do you cope with all this insane clusterfuckness of frameworks, tools and js libraries.
Why is it so hard for a beginner like me to learn webdev? Android and backend are much more logical and sane. Even Node.js is pretty dope.11 -
Why is whatsapp just AIDS?!
The privacy thing is big but let's take a look at the app.
It's the only messenger app I've ever used that forces you to save incoming images to your gallery if you want to see them, like wtf?
The UI looks like shit and it's kinda hard to understand from a UX perspective, for example read receipts which Messenger does beautifully. Facebook owns WhatsApp so A it's not really a better choice than fb messenger and B it basically has a shit quality application compared to Messenger. The messaging experience in sketchy Chinese dating apps is better.
Also it basically hacks your phone. It turns on notifications and permissions by itself even when I explicitly turned them off, and sends me notifications for muted conversations.
Speaking of notificatikns. Every time I get 1 notification, notifications from every single chat even an unread messages from 3 years ago gets sent to my phone.
It guzzles battery like a monster.
And they have basically formed a cult in the indian community, so now everyone thinks its the best and no one uses anything else because "it's so convenient" which it's NOT. It has a terrible interface, and the only thing I like about it is the fact that it being so shit gives me an excuse to uninstall it and ignore all the fucking spam on there.
Honestly, the app needs to die ASAP because it is frankly the shittiest of shittiest messaging applications.5 -
Fuck google cloud platform. My server has been down for last 4 days. Stupid reason google gives me is that it does not have resources available in my zone. Why the fuck do you start a hosting company if you cannot provide RAM and CPU. On top of that their support is so bad that after 20 emails, 4 chat tickets, 3 phone calls nobody knows the issue I am facing. They just give the links to their ultra stupid documentarion.
Now all my 6 projects are down. Clients are getting impatient. I cannot do any work and googles support is the worst.
They dont even want to understand the issue, dont know how they will solve it.
I have created AWS instance now and migrated to AWS. But i have old backups which are useless on AWS. To get the latest backups i need google cloud instance to get started but stupid google does not have resources. How hard it is to add 1 CPU and 1GB RAM?18 -
Why do so many online resources still change quote characters in the code for the curly ones? It's 2023, how hard is it to add a fucking rule to skip conversion inside the <code> blocks?9
-
Create a new project in Xcode Version 10.1 (10B61) - Single View iOS app.
Drag a button on to the screen. It shows in InterfaceBuilder
Launch app in simulator. Button shows, then disappears. Noob says WTF?!
Poor noob has to ask me why this is happening and I explain that Apple's Single View project is a single splash screen project. The button they placed on what they thought was the single "window" is really a splash screen named "LaunchScreen".
Apple Xcode team (aka fucktards) provide yet another shitty out of the box experience...
It is so hard to be positive when teaching others how to use Xcode. Thanks for DevRant for letting me vent.1 -
I now know why I'm a developer and not a designer, it's so fucking hard like it's goddamn bootstrap that shit is basically built for me but it still looks like an egg took a shit on a toaster
-
I am working on an open source game project, and the most common way to draw things is using a class named ManagedSurface. The class is otherwise awesome, but it has a method called getBasePtr(x, y), which gives you a pointer to the requested coordinates. Fair enough (this is C++ without STL by the way).
But WHY THE HELL CAN I REQUEST ANY POINTER THAT I WANT, EVEN IF IT'S OUTSIDE THE SURFACE? Other cointainers have sanity checks, asserts and such, and the surface KEEPS TRACK OF IT'S WIDTH AND HEIGHT.
WAS IT SO FUCKING HARD TO ADD assert(x <= w); assert(y <= h);???
I spent 3 days on valgrind trying to find a heap corruption that manifested at random points in the code.
FUUUUCK!
On the bright side, I learned how to use valgrind (which is awesomely awesome).4 -
I’m in a big company now. We have all the resources in the world. We promote best practice. We don’t even seem to have deadlines. We mob on everything so that we get the benefit of all our experience combined.
So if all that is true, why in gods name does the first class I open have shed loads of hard coded settings, IP addresses and GUIDs in it?
FML. How did I end up working in this shit.9 -
Microsoft owns github
Microsoft owns windows
Microsoft owns powershell
Why then, why exactly, is it so fucking hard to get ssh private keys for github, up and running on windows powershell.
I tried to change permissions on files but then it broke the git-bash implementation 😭.
Fuck it !! 😭😭9 -
Yes this is a rant about parents and work but I don't care!
So looks like my parents are going to kick me out because I don't have a full time job and according to them, I'm not looking...
I currently work in retail and have for the past 5 years and started working day 1 that I could have, been applying for IT positions when I'm one of the highest qualified on my area but get turned down so they can pay a teenager half the amount, apply for big retail chains that are "always hiring" like Coles, woolies and Kmart, get turned fucking down.
Don't qualify for government assistance as I'm just out of the earnings bracket, can't afford my own places, don't have my licence yet so I'm fucked...
But hey, atleast my parents will be rid of me and just dis-own me like my middle brother until I have a kid or they need tech support.
Why is getting work so fucking hard when you're qualified, I'm willing to even be a call centre guy but as soon as job possibilities come up I get fucked over time and time again -,-2 -
I think I might change my middle name to "I told you so"
Couple of weeks ago I proposed integrating a daily process job into an existing WPF application (details of what+why would be too long to explain) and the manager suggested I make the changes
Me: "I can do it, but Jay has the most experience with that application. I don't have his WPF skills"
Mgr: "How hard can WPF be? If it uses the MVVM pattern, it should be a snap."
Me: "Its nearly an 8 year old WPF project with several chefs in that kitchen. I pretty sure I could figure it out, but that is a difference between 2 weeks and 2 days. Integration is pretty straight forward, Jay could probably do it in a day."
DevA: "WPF is easy. MVVM makes it even easier. I worked on the shipping app."
Me: "That's was a brand new, single page app, but yea, it should be easy."
DevB: "WPF has been around a long time and the tools have really matured. I don't understand what is so difficult."
Me: "I didn't say anything would be difficult, I know with that application, there is going to be complexity we need to figure out."
DevB: "It uses the MVVM, so all we need is the user control, a view model, controller, and its done."
DevA: "Sounds easy to me."
Mgr: "If you need more time to work on the vendor project, I'll have DevB work on the integration."
<yesterday>
Me: "How is the integration going?"
DevB: "This app is a mess. I have no idea how they got the control collections to work. If I hard-code everything, I can get it to work. This dynamic stuff is so confusing. Then there is the styling. Its uses dark mode, but no matter what I do, my controls show up in light mode."
Me: "The app uses Prism, so the control configuration is in, or around, the startup code."
DevB: "That makes sense. Will it fix the styling too?"
Me: "I have no idea. When I looked at it, some controls loaded the styles from the main resource, other's have it hard-coded. Different chefs in the kitchen, I guess. How far have you got?"
DevB: "I've created invoice button. That is as far as I got"
Me: "I'm finished with the vendor project and I'll be wrapping up the documentation today. I can try to help next week."
DevB: "Thanks. I think we might have to get Jay to help if we can't figure this out."
Me: "Good idea"
Two weeks and only a button. A button? I miss Delphi.3 -
Short rant: I hate xcode, I hate Swift, I hate Apple.
After 3 weeks of intensive work (I'm an apprentice, part-student, part-worker), I was happy to go back to school and was like "Oh we're going to learn iOS, sounds cool !".
It is now friday, I have homicidal tendencies growing inside me, I want to cry whenever I hear xcode or swift.
Why in the hell I can't use a string argument when I'm calling a function NEEDING a string arg ?
Why do xcode take so long to tell me that there is a problem, why is the error message not explicit AT ALL ?
Why dictionaries so hard to manipulate, EVEN IN JAVA IT'S SIMPLIER.
Why putting our API call in specialized files make them run AFTER EVERYTHING ELSE and the solution that is given to us is deprecated since 5 years ?
Why is a classic c-style for loop is now deprecated ?
These are just a drop in the ocean of WHAT THE FUCK IS THAT that we came across this week.
Fuck Swift, fuck xcode.7 -
So....
I was asked to transfer a spaghetti Android/iOS project to xamarin for a bank client yesterday because "that's what they use".
This is a crm/loyalty app that has been around for 2+ years now (you can imagine the mess). On top of that I have no knowledge of c#, .net or xamarin.
So I ask: "When is this supposed to be delivered?"
Boss: "It was scheduled for 2 weeks ago but let's say 2 weeks from now"
Me: "..... This is a huge remake it won't be even close to ready in 2 weeks"
Boss: "Let's check on the progress in 2 weeks and see how it goes"
Why is it hard for bosses to provide an actual timeframe???
He's been pulling the same crap with junior devs for years and of course they get nervous and create more spaghetti code...
Anyway long story short (not) I have an interview Monday!
Let's hope it's not more of the same!
P.S.: to junior devs: When you are given a deadline... IGNORE IT.5 -
Im forced to work with c++ on windows for a course.
0) c++ is fucking unusable without a central repo for managing dependencies. Maybe im just too used to maven but you shouldnt be downloading dll files in 2018.
1) visual studio can go suck a fat one. I got a fairly fast pc and it takes fucking forever to load anything. For comparison, eclipse with all my plugins (and i have a lot) loads in ~10 seconds, vs2017 does in 35.
2) why the fuck is there no cross platform compilation for c++? Its supposed to run on everything right? Whats so hard about porting a fucking linux compiler so i dont realixe i have .exe files when i want to work with my laptop on the bus?
3) c++17 (? Or whatevers the newest) syntax is like a deep barf on a hot summer day after eating a whole watermelon. Its fucking unreadable and autopointers simply dont work. And its not even my lack of skill this time, its the code that the other members used and it worked for half of them.6 -
This whole programming profession sucks! Programmers suck! Managers suck! Companies suck! Products suck!
Why is it so hard to organize your stupid code at least a bit?! No, it’s not deadlines, just write a block of code and give it a meaningful name, a function, a method, a comment, so many options, so little fucks given. Give things a meaningful name instead of whatever came to your mind that moment. There’s no excuse! No, just leave it to the next guy, and he’ll leave his trash for another one. And then we complain and make memes about it. Fuck you all!
There’s no purpose or vision of products, managers sweep problems under a rug, executives do whatever they do, as long as some money is pouring in, just keep pedaling semi-mindlessly. Spin the wheel you little hamsters until you drop, there’s enough hamsters out there.
It’s just a clusterfuck of small, selfish interests and egos, a mud of meaningless and unnecessary problems that need not be there.
It’s not the workload, it’s the stress! The stress of bullshit, and constant problems that can be avoided if everyone did their job at least half-professionally. Not just programmers, everyone!6 -
Before I decided to learn C, I had heard tell of pointers being "hard to use". Of course I thought "maybe so, " after all, that was basically the only thing I heard about pointers, "they are hard!".
And so, when I learned C, and I got to the part about pointers, I was expecting at least some trouble (I can't know everything) and it was just... easy? Maybe the trickiest thing was how * has two different meanings based on the context (declare/dereference) but that was easy too.
Why the hell is all I hear from people about pointers is that they're difficult?15 -
A story from around 2005:
Customer laying out specifications: “We expect this software to need to last 25 years or so, and it will need to keep historical file processing data by dates for at least that long, assume storage is no issue.”
Devs at the time: “look best I can do is support that start with 200 or 201, anything else is really too much to ask. Also understanding how to work with dates at all and not just string manipulation is waaaaayyy hard yo.”
Fuck you lazy motherfuckers. This is why people thought Y2K would be a problem. -
So, unlike normal people who just click on an mp3 file in windows explorer, I'm listening to music saved on my windows hard drive, accessed via an sshfs mount, using VLC running inside a HyperV linux VM and Xming/pulseaudio to make it show up inside windows like a normal window and play sound.
Why? Because this is my replacement for WSL which broke (Good Job on the updates as always, M$) and I'm celebrating that I got everything* to work.
* Nevermind the hours I wasted because I forgot to add a rule to the windows firewall allowing pulseaudio to connect and the fact that Xming can't handle vlc playing video7 -
I feel guilty for using YouTube Vanced and being unable to support content creators.
Shouldn't there be a feature that allows you to toggle ads on certain channels you want to support?
I really want to support such folks who are creating valuable educational content but Google being the biggest piece of corporate shit, makes me angry when it comes to compensating the creators fairly when they make Billions off their hard work.
The world is a better place because of such teachers who spend time, energy, and efforts to create valuable and useful content for rest of the world.
Funnily, back in days when we had awesome stuff, the tech was shit to document all of it. Now when we have advanced and easily accessible tech, we have shitty TikToks.
Why can't the creators of good content get more visibility and why is the world so fucked?16 -
So, for the past...what, week or so? I've been working on a side project with @gianlu. It's the PretendYoureXyzzy fork - our attempt to rejuvenate an old shitty piece of software.
I had started working on a fork alone, and then he asked to team up so I was like "Sure, I got nothing better to do." So, he's working on the backend (and hooking JS up to the backend) and I'm developing the frontend.
I don't know why I thought tech would stand still. Google says they're putting MDL on life support and replacing it with a much more complex successor, MDC. It's not hard to use, but what really bugs me is the lack of notice on getmdl.io. If you are switching to another project as your main focus, why the fuck wouldn't you advertise in the most places possible?
Granted, I don't do web design and/or development on the daily. Yes, I can do it, but I'm not always as up-to-date with web technologies as I'd like to be.
However, the screencap captured is the third time I've taken the knife to the UI. MDC is great tooling, at least to me. That dialog? Not something MDL would've had out the box on the first day. You'd have to work for that.
I don't have an issue with MDC, I have an issue with the lack of PR around it.6 -
Well what an adventure with this SSD...😑
my sis' laptop is from 2013-ish(?) and has/had a slow HDD in it. I wanted to speed it up, before her study, so I bought a new internal SSD (no new laptop wanted).
Created a bootable USB, exchanged the hard drives and install the OS on it. Seems easy enough...
The laptop restarts to finish its process ... laptop shuts down immediately, no warning whatsoever. 😳🤨
Start it up, loading screen, fan gets louder and louder ... instant shut down.😳🤨🤨.
Redo process, this time landing on blue-screen, error code critical process died? ... instant shut down again.🤔
Restart from old HDD, normal.😐
Retry with boot USB and reinstall SSD. Setup process copying files, meanwhile instant shut down.😳 Please don't tell me!😩 Since every part of the laptop was working, except the new inserted SSD, I thought "FUCK not a broken SSD!😣"
I had my own PC with internal SSD slot, so tried to find out, whether it would be broken...
All starting up fine??🤨🤨
Ok then? Finish the setup for the third time now ... everything up and running.😐🤷
Normal shut down, unplug, plug back onto laptop, it works. HOW?? WHY?? 😕
Why the fuck are you suddenly working? 😐🤷🤷🤷
That's some magic...5 -
BielyApp, yeah, GOOOOOOOOD IDEA! I still can‘t understand how this works or why did a reasonable human being though that this would be a great idea! 🤔
Ok. There‘s a community that lives 4 or 5 hours from my my city. I don‘t want to offend anybody, so let‘s call them “Bielys” (just a random name, I don’t know if there’s actually a group or etnia with that name).
Bielys live isolated from modernity, they speak their own language and they don’t use technology.
A dev friend of mine was having a hard time (he got divorced and was almost in bankrupt). One day, a man asked him and another dev to work on a mobile app:
...
“BielyApp”.
...
It was supposed to be a movile app for commerce. Bielys could sell and buy biely stuff from another bielys. Well, at this point you can figure out why this was a bad idea. Anyway, they developed it. Even it’s on GooglePlay and AppStore 😱 I installed it to see if it was truth or not. Incredibly it was true. BielyApp exists and the worst thing is that you can log in with your facebook account. WTF?!
I asked to him “But why?! WHY?! They don’t even use smartphones!!!!”
And he answered “I know, but I needed the money”1 -
So yeah XML is still not solved in year 2018. Or so did I realize the last days.
I use jackson to serialize generic data to JSON.
Now I also want to provide serialization to XML. Easy right? Jackson also provides XML serialization facitlity similar to JAXB.
Works out of the box (more or less). Wait what? *rubbing eyes*
<User>
<pk>234235</pk>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</User>
Why is my groups property (java.util.Set) rendered as two separate elements? Who the fuck every though this is the way to go?
So OK *reading the docs* there is a way to create a collection wrapper. That must be it, I thought ...
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</groups>
</User>
What the fuck is this now? This is still not right!!!
I know XML offers a lot of flexibility on how to represent your data. But this is just wrong ...
The only logical way to display that data is:
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groupsEntry typeCode="usergroup">
<pk>6356679041773291286</pk>
</groupsEntry>
<groupsEntry typeCode="usergroup">
<pk>1095682275514732543</pk>
</groupsEntry>
</groups>
</User>
It would be better if the individual entries would be just called "group" but I guess implementing such a logic would be pretty hard (finding a singular of an arbitrary word?).
So yeah theres a way for that * implementing a custom collection serializer* ... wait is that really the way to go? I mean common, am I the only one who just whants this fucking shit just work as expected, with the least amount of suprise?
Why do I have to customize that ...
So ok it renders fine now ... *writes test for it+
FUCK FUCK FUCK. why can't jackson not deserialize it properly anymore? The two groups are just not being picked up anymore ...
SO WHY, WHY WHY are you guys over at jackson, JAXB and the like not able to implement that in the right manner. AND NOT THERE IS ONLY ONE RIGHT WAY TO DO IT!
*looks at an apple PLIST file* *scratches head* OK, gues I'll stick to the jackson defaults, at least it's not as broken as the fucking apple XML:
<plist version="1.0">
<dict>
<key>PayloadOrganization</key>
<string>Example Inc.</string>
<key>PayloadDisplayName</key>
<string>Profile Service</string>
<key>PayloadVersion</key>
<integer>1</integer>
</dict>
</plist
I really wonder who at apple has this briliant idea ...2 -
Why is it so fucking hard for people to follow basic rules? FFS you're supposed to stay at home to limit contact between people, that doesn't mean you can play volleyball with your friends or go to the local park! And if you decide to go hiking, choose a place where you'll be alone, not the most popular trails around the city! You're the fucking reason government needs to make new quarantine regulations every day, not this virus, and you deserve no help if you catch it! Fuck you!17
-
Why am I sad, depressed, demotivated, you ask?
Because I was asked to create-react-app with nodemailer, it worked well on heroku, YAYYY MEE, "
"NOTHING GOES WRONG IN DEPLOYMENT FUCK YEAH"
Little did I know that was a "demo" for the business people, My superior / manager/boss wants me to deploy on 1and1 service provider,
> Okay 1 and 1 service provider does provide Nodej, so it shouldn't be hard.
> Turns out it is a Windows hosting server IIS 10 without URL Rewrite.
> *INTERNAL SCREAMING*
I went up to him to talk about this issue and requested to let me talk to 1 and 1, and get this sorted
> But bro, if we cannot fix it, I think they also cannot fix, probably.
*INTERNAL SCREAMING AT PEAK*
I just want URL Rewrite installed on IIS10 so that I can move on to the next project.
A little background for this project
> No support from him during development.
> I personally used HD Images, because why not?
> Website seems slow because of HD Images, and now he complains about it.
You fucking (managers) want a website to be scalable and fast and yet you choose to focus on B U S I N E S S instead of support the real guy.
I'm fucking sick and tired, it took me 24 hours figure out the issue because there is nothing on 1 and 1 support/ forum/help center.
Another 24 hours to try and fix, yet no luck.
I'm gonna finally point the domain name to heroku. Fuck, I'm so fucking done6 -
Subject: a rant for devRant
Hello,
Not entirely sure why or when exactly it happened, but after I joined mailing lists I have a pet peeve for people who don't use a proper subject line, or don't use email when I literally made a mail server for that purpose (some organizations really prefer calling apparently). Is it really that hard to summarize a message in one sentence? Hell half the time even the message itself is just a few sentences.
Also the greeting and salutation at the beginning and end of email messages. I find them so redundant. Has anyone ever gotten any meaningful information out of "Hello", "Greetings", "Dear", or something like that? Or "Best regards" or whatever. I get that it's just being polite but it's so meaningless! I really don't like using them anymore. Just a message block and who it came from, that's all it needs to me. Instead pour some effort into the damn subject, the title of whatever drivel you're putting out there! Or replying to an email *only* when the subject matter is still related! Or actually replying to the damn email if it's still that subject matter...
I probably sound like an old man, but seriously.. email isn't a hard concept once you "get it". Anyone can write a halfway decent letter, why isn't that the case for email?
Best regards,
Condor13 -
The frustration that comes to each developer when he tries to write the code structured by thinking through each situations, and your team lead comes and tells you why r you doing so much validations just hard code them we need to release it today client is waiting. After 3-4 months the same team lead goes through the code and shouts at you telling why the he'll you hard coded all these, can't you write the code correctly by thinking through.3
-
How are you? I have burning open position, are you interested?
Are you open to the position?
Are you open?
ARE YOU OPEN?
Well how would I know? You didn't tell me literally anything. Why won't they start with tech stack and salary range instead of 20 "how are you messages". Why is it so hard? Why are recruiters so hopeless, I'm never gonna get this how and why this garbage ineffective way of working is tolerated by companies.1 -
I don't get it.
I tried Kotlin on Android just for fun, and it doesn't support binary data handling, not even unsigned types until the newest version. Java suffers from the same disease.
How does one parse and process binary data streams on such a high end system? Not everything is highlevel XML or JSON today.
And it's not only an Android issue.
Python has some support for binary data, and it's powerful, but not comfortable.
I tried Ruby, Groovy, TCL, Perl and Lua, and only Lua let's you access data directly without unnecessary overhead.
C# is also akward when it comes to data types less than the processer register width.
How hard can it be to access and manipulate data in its natural and purest form?
Why do the so called modern programming language ignore this simple aspect that is needed on an everyday basis?11 -
I am so much stunned i cannot form a sentence on what to say. Lost 3 days trying to fix a bug on why socket.io was connecting to backend TWICE per user. I cannot fucking comprehend this. Backend works fine because via postman it doesnt connect twice. Everything works fine. 72 fucking hours waste d of my life just to find out i had to change
<React.StrictMode>
<App />
</React.StrictMode>
Into
<App />
When i tell you my jaw fucking dropped it fucking did. And it does not drop often or that easily for me. What the FUCK is react strict mode???? FUCK react. I fucking hate this piece of garbage framework. I even like nextjs better. React💩💩💩💩💩💩💩💩💩💩motberfucker WHY is strict mode fucking my code what use does it have who gives a shit why does it have anything to do with websocket connection FUCK react 💩💩💩💩💩💩💩💩💩 how does this piece of camel turd have anything to do with duplicate connection 💩💩💩💩MFKKCER this garbage doesnt exist in my beautiful angular or nextjs PLS why this cancer has to be so headaching i knew I'll get FUCKED if i dont go over a detailed course learning react from scratch. Now im suffering. Learning this garbage the hard way FUCK off4 -
!Dev
Sitting in a bus on 19 hour ride with my class to England a few things to rant about came to my mind:
Why the fuck do you have to blast shitty german rap music out of your fucking JBL boxes and why do you have to turn up the volume so much that I can still hear it although I am wearing headphones, listening to music and sitting 5 fucking rows in front of you.
Also why the fuck do clocks in buses never display the right time? How hard can it be to make the clock display the right fucking time?
Another thing: why does this bus which is especially made for long rides not have a fucking trash can?! Seriously wtf?
Rants aside I am really looking forward to staying in England for a week although I won't have a computer for the next week :(
Another thing: why the fuck is the coffee you get at pull-ins so fucking disgusting ?
Like srsly, it is made by a machine and still tastes like thrown-up.
And why the fuck does everyone look weirdly at you when you buy a can of red bull but everything is fine when someone my age drinks 3+ liters of beer and then throws up? What the fuck? People look at me weirdly when I tell them that I don't drink any alcohol, heck I am actually not even allowed to do so because I am 15 and not 16 (beer is allowed in Germany if you are 16+ but nobody really cares about that). Heck where I am from they even encourage you to drink beer? What the fuck??!!
Anyway looking forward to England and also sorry about the long non-dev related rant. Just had to rant about some people and society.
P.S. do you know any (preferably free) Android apps / games where you have to code or just solve problems with logic?14 -
So, by a cruel twist of fate I ended up on the front line of tech support for the app we've built. It's aimed at non-IT professionals, in general people who are not expected to know too much about computers but who should have at least two neurons to bash together in their pretty little heads.
No.
It really makes me drop my faith in humanity considerably. Clicking a confirmation link is too much. Filtering an excel sheet is too hard, despite it being their technically main work tool. Tickets are basically "shit's broken go fix". What is broken? How to reproduce it? Why do you expect the person on the other side of the screen to be a fucking diviner? I recently ran all out of dove guts to search for the answers of your questions.4 -
Why is it so hard for people (especially managers) to learn to work smarter not harder....
FIX THE GODDAMN PROBLEM CORRECTLY... THE FIRST TIME SO WE DON'T HAVE TO KEEP FIXING ITS BLOWUPS ON WEEKENDS....
AND STOP HIRING MONKEYS THAT JUST KNOW TO PRESS BUTTONS RATHER THAN DESIGNING FULLY FUNCTIONAL SOLUTIONS THAT DON'T BLOW UP OR LEAVE A TRAIL OF SHIT BEHIND THAT I NEED TO DECIPHER N CLEANUP....2 -
Why the f*ck is it so hard to setup an online live radio on NodeJS but making a freaking Google hangouts clone is not.3
-
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
That's it, where do I send the bill, to Microsoft? Orange highlight in image is my own. As in ownly way to see that something wasn't right. Oh but - Wait, I am on Linux, so I guess I will assume that I need to be on internet explorer to use anything on microsoft.com - is that on the site somewhere maybe? Cause it looks like hell when rendered from Chrome on Ubuntu. Yes I use Ubuntu while developing, eat it haters. FUCK.
This is ridiculous - I actually WANT to use Bing Web Search API. I actually TRIED giving up my email address and phone number to MS. If you fail the I'm not a robot, or if you pass it, who knows, it disappears and says something about being human. I'm human. Give me free API Key. Or shit, I'll pay. Client wants to use Bing so I am using BING GODDAMN YOU.
Why am I so mad? BECAUSE THIS. Oauth through github, great alternative since apparently I am not human according to microsoft. Common theme w them, amiright?
So yeah. Let them see all my githubs. Whatever. Just GO so I can RELAX. Rate limit fuck shit workaround dumb client requirements google can eat me. Whats this, I need to show my email publicly? Verification? Sure just go. But really MS, this looks terrible. If I boot up IE will it look any better? I doubt it but who knows I am not looking at MS CSS. I am going into my github, making it public. Then trying again. Then waiting. Then verifying my email is shown. Great it is hello everyone. COME ON MS. Send me an email. Do something.
I am trying to be patient, but after a few minutes, I revoke access. Must have been a glitch. Go through it again, with public email. Same ugly almost invisible message. Approaching a billable hour in which I made 0 progress. So, lets just see, NO EMAIL from MS, Yes it appears in my GitHub, but I have no way to log into MS. Email doesnt work. OAuth isn't picking it up I guess, I don't even care to think this through.
The whole point is, the error message was hard to discover, seems to be inaccurate, and I can't believe the IRONY or the STUPIDITY (me, me stupid. Me stupid thinking I could get working doing same dumb thing over and over like caveman and rock).
Longer rant made shorter, I cant come up with a single fucking way to get a free BING API Key. So forget it MS. Maybe you'll email me tomorrow. Maybe Github was pretending to be Gitlab for a few minutes.
Maybe I will send this image to my client and tell him "If we use Bing, get used to seeing hard to read error messages like this one". I mean that's why this is so frustrating anyhow - I thought the Google CSE worked FINE for us :/ -
Why is it so hard to find internships in india? !!
Aaaaaaaarg
If you're not from india, is it hard to find some there too?5 -
Is apple a fruit? Yes.
Is orange a fruit? Yes.
Is apple an orange? No.
Does apple equal a fruit? No.
Does orange equal a fruit? No.
If you're capable of understanding this, then WHY IS IT IT SO DAMN HARD TO UNDERSTAND 0 == ""?14 -
So I told my partner in not buying a Mac and that in buying a base model pixelbook instead, showed her the pricing and she nearly strangled me...
Why is it so hard to be a Google fan and have to import litteraly everything with an extra 400 AUD tacked on -,-12 -
Error mesage on my 4GB ram "smart" phone, running a "smart" application.
'Oh no ! Something went wrong. Re-try'
Whatttttttt!!!
WHY DOES A "SMART" APPLICATION GIVE SUCH A STUPID ERROR MESSAGE.
IT IS MY PHONE, PLEASE PROVIDE A HELPFUL ERROR MESSAGE, WHY IS IT SO HARD.
I JUST HATE SOFTWARE THAT TREATS THE END USERS AS STUPID ANIMALS.9 -
Why is it so hard to convice coworkers (other programmers) to use source control? Yes it's an extra step every day or so but it can be so helpful and save so much more time tracking down versions and when the bug first appeared. Also, piece of mind if your computer every gets hosed.7
-
Oh boy the schools in the Netherlands have began again, the amount of people in the train is insane... (Also one of my biggest annoyances is) the way how people pile on top of the check-in checkout poles... They try to do it as fast as possible, but because it is an unstructured pile of garbage... It takes way too long...
Is it so hard to stand in a line and just keep your card STIL AND CORRECTLY INFRONT OF THE NFC READER!?
apparently it is because I see people slamming their wallets against it, moving it around wildly and keeping up the line being Angry why the reader can't detect their card... In their wallet, probably between multiple other NFC cards within a second (BECAUSE YOU KEEP MOVING IT FROM THE READER TO THE FUCKING SCREEN!!! WTF)2 -
The saddest and funniest side of our industry is (atleast in India): someone works hard and makes it to the best colleges, do great projects on AI, ML; get a good score on Leetcode, codechef; gets a job in FAANG-like companies...
Changes colors in CSS and texts in HTML.
And, why is there so much emphasis on Data Structures and Algorithms? I mean, a little bit is fine, but why get obsessed with it when you never write algorithms in production code?
Now, don't tell me that, we use libraries and we should know what we are doing, no, we don't use algorithms even in libraries.
Now, before you tell me that MySQL uses B-tree for maintaining indexes, you really don't need to solve tricky questions to be able to understand how a B-tree works.
It's just absurd.
I know how to little bit on how design scalable systems.
I know how to write good code that is both modular and extensible.
I know how to mentor interns and turn them into employees.
I know how to mentor junior engineers (freshers) and help them get started.
Heck I can even invert a binary tree.
But some FAANG company would reject me because I cannot solve a very tricky dynamic programming question.4 -
Stupid pipeline bullshit.
Yeah i get it, it speeds up development/deployment time, but debugging this shit with secret variables/generated config and only viewable inside kubernetes after everything has been entered into the helm charts through Key Vaults in the pipeline just to see the docker image fail with "no such file found" or similar errors...
This means, a new commit, a new commit message, waiting for the docker build and push to finish, waiting for the release pipeline to trigger, a new helm chart release, waiting for kubernetes deployment and taking a look at the logs...
And another error which shouldn't happen.
Docker, fixes "it runs on my machine"
Kubernetes, fixes "it runs on my docker image"
Helm, fixes "it runs in my kubernetes cluster"
Why is this stuff always so unnecessarily hard to debug?!
I sure hope the devs appreciate my struggle with this... well guess what, they won't.
Anyways, weekend is near and my last day in this company is only four months away.2 -
Boss: “Our ecommerce conversions in Google Analytics are less than the actual pace of orders.”
Me: “Nothing has changed in the tracking code or setup. It must be our goals setup which you have to have a Ph.D. to understand, plus whatever mood Google’s algorithms are in today.”
He’s not mad at me. We’re both just confused why Google AdWords, Analytics, and Tag Manager have to be so damn hard to get right. I’ve never been able to do it right. And most data is thrown out because people browse websites while logged into their Google Account, which makes their clickstream disappear and become unattributable because of understandable privacy policies. I don’t want my data tracked when I’m logged in either!
So now we have had to hire specialists at several thousand dollars per month to figure this out. -
Got a promotion at the end of April this year from Junior Dev to React Engineer, and HR STILL hasn't amended my contract... At this point I'm owed 2 months of backpay... Why is it so hard for HR in any business to just change a field, sign some forms and bung it off?7
-
Heh promotion? I only get fake promotion..
For two years, I was doing so many *free* overtime, manager is a big liar, he said that it will he considered on the yearly evaluation.. cool, the thing is there is no evaluation at all, just lying and lying.
Few months ago I took a vacation of 1 month (I am expatriate so I get one vacation per year, my home town is too far..) I talked to tye manager about salary taise and he said absolutely we will talk after I get back..
He called me during my vacation to do some urgent (as always) work, I worked about 5 days, and for free.
After I get back to work, he was angry about my *attitude* that I wasn't available more time.. oh and there was no fucking raise. always lying..
In this country, if you're an expatriate so you can travel outside the country without the validation of the employer (yeah like that) and the notes period is about 3 months, what makes very hard to find another job, no one will wait for 3 months, unless you vanish during a vacation.
So, why didn't I gave my resignation? well, life is hard when you have unemployed wife and a little baby, and the pay is, let's say OK comparing to costs here.
I am charged to learn and work with another language and framework, and when I asked for a raise they said no, so I will stop working in this language and let's see..
The problem is that other employees in thus company are literally bitches, they don't say no to anything, so I am the special guy here who does not a blowjob..
So, what do I do? I am hunting for a new job since a while but no luck.4 -
I think the sleep deprived me is finally cracking under the weight of incompetent assholes.
We just launched a major project in some weird cocktail of Agile slapped with MVP and release to the wild in a waterfall, but it was premature, premature in the sense QA hasn't even finished their side of things, but because some fuck with with "manager" in their title decided they have burnt through the budget with incompetence and scrapped an entire element of the project and outsourced just so they could make a shittier version that doesn't even fucking work.
How hard do you want to fail before you will start listening to the people that now have to work around the fucking clock to clean up this horse shit of a mess.
I'm literally arguing over field mapping with multiple 3rd parties, when the fucking requirements state WTF this is suppose to look like. All because they didn't validate or test their own shit.
Why is EVERY FUCKING cock head in this industry a waste of space and cash! Is it really to much to ask for 1 fucking project to fucking go live that actually fucking works where I don't need to work 2 weeks straight (including weekends) after going live just to be sure that what shit does hit the fan isn't going to create a SEV 1 issue...
Sorry, I'm pissed at the incompetence of others I need to deal with on a daily basis. It's not like this field is insanely hard. A little attention to detail and self validation, verification goes a long way. But clearly that's a rarity.
Once this shit is stable and actually works, I'll be pulling out the mop to clean up half this shit just so it actually works.
Oof, I'm getting to old for this bullshit.4 -
A new currency is emerging in our industry. It is called "blame".
Who is to blame if we don't meet the deadline?
Who is to blame if the rushed release has x bugs?
Who is to blame if nightly build breaks, because our CI-Server is an old hunk of junk and "management" didn't approve the upgrade?
Our customer blames the delay in HIS infrastructure on us, because our system requirements are too high.
Blame blame blame. This currency is the new idol of our management team. Everyone gets blamed. They manage their "blame" ledgers instead of approving the tools we need or give us reasonable deadlines. Why Lord, oh why are there SO MANY MORONS in managment? You know what, dear "managers"? FUCK YOU., FUCK YOU SO HARD YOUR MOM WON'T RECOGNIZE YOU. YOU COULDN'T POUR PISS OUT OF A BOOT WITH INSTRUCTIONS ON THE HEEL.4 -
I just read Jeff Bezos' article on Medium about how the ones at American Media are threatening him of leaking his private pictures.
As I was reading it, I felt, "Man, how low has journalism come to these days. Here is a guy who's worked so hard to build one of the world's biggest companies, and here are the ones at the National Enquirer trying to bring this man down."
To be honest, who gave them the right to indulge in a person's private life? Why do they have to say, "A nude selfie with his wedding ring on?" Maybe, he sent that image to his wife. This makes me wonder, "Is this the way we treat humans?"
Why are we concerned about what a man does in his personal life? What impact does taking down a man in public bring?
Thoughts, please!13 -
I'm writing a book that teaches everything I have learned in the past 20 years about writing small niche software and selling it.
Need some help from my fellow DevRanters.
Anyone who comments here with something constructive gets a free copy when it's done.
When I say:
"Why don't you just write your own software and sell it to end users"
What is the first thing that pops into your head?
Is it "I don't know how to advertise"
or
"that's a pipe dream"
or
"I tried starting my own business, but _______"
or
"I am doing that, i have this side project "
(how long have you spent on that side project?)
I need to know all your concerns questions fears, skepticism etc around the idea of writing your OWN software.
After 20 years I have like, so much knowledge, but it's sometimes hard to get it all out, UNLESS someone has a question or concern, then, out it comes.
So, I'm going to (hopefully) collect all the questions here ... and answer them, and it'll help me out a lot to extract this knowledge.
A lot of stuff I do without even thinking and realizing all the years it took to even know that.
What would you like to know the most?
You have the skills, you have the know how, you can probably see it in your head, so what's stopping you from making the leap?question your own business why the fuck haven't you started yet no more bosses no more clients residual income from a one time effort no more teams32 -
Working on modifying a legacy web project and just about every single element is `position: absolute` with crazy z-index juggling and hard-coded pixel sizes and positions everywhere 😭
To make it even worse, a bunch of the javascript will also change elements sizes and positions so it takes forever to track down why an element is where it is1 -
Wordpress.....
God, why..
Okay, so my company has deep roots with wordpress websites, which is, well fine, and at some point they needed portal that would do something but I was bussy doing other project for our child company, so our frontend slapped together "portal" in wordpress. So I dont even know if I understand that properly whats going on, but today buddy came with help request to wordpress.
I had to look through wordpress database and was like.... FML hard.
Okay, fuck it, let's try to make it work. So, I needed to get random category (using get_terms), check it's ->count and if its greater than X show it on page. I came to done halfway, the random part wasn't working.
Okay, made it work after initial struggle with "WHAT THE FUCK IS THAT?! AND THAT?? AND THAT?!?!??! ;-;" and now comes the kicker. It has ACF installed and it has additional category in ACF. And it should check count of posts within the category that have certain ACF value.
After awhile I just said "this shouldn't be done on wordpress, no idea how to make it work".
What I seen is like... it hurts me on so many levels... My head wants to explode...
Can I get back to writing normal code now? ;-; Im fed up patching logic in frontend (I dont even know if that's `the wordpress way` but that's what they did) -
I just finished ny first feature at my first dev job - a gallery page connected to an api.
It took 2 weeks. About 2 days of programming, but 12 days of fucking css.
Why is css so bloody hard?7 -
Why is it so hard to find a designer/front-end dev partner and/or freelancer that can make mobile specific designs!?2
-
Annoying Indian professors are everywhere. It's a computer vision class are you really teaching us Regression?
What about transfer learning? object detection! Give us papers to read, let's do projects.. what the hell is this I am going take attendance bullshit and teaching crappy concepts.
I did not sign up for this shit! I came here for my Masters to get away from pompous mother fuckers like you ...
My class is also filled with those idiots,who think bias in a neural network is somehow related to class imbalance ? Now the same idiot proceeds to ask questions like...
Why would the weights change in a neural network?
Motherfucker why you in this class ? Why don't you stick to your shit and ask these questions later..
I am so pissed off right now guys ...
I was sitting in my lab understanding the deeper insights of BN, activation fucntions.. various optimizers ..etc Stuff that this idiot motherfucking teacher must be covering... UGGH.
I shouldn't cuss so much.. or at least add variety to my cuss words..
I am pissed off cuz instead of learning the shit I should be learning I am forced to come and attend this class and waste 2 hrs of my life ...
It's the summer i find it hard to focus anyway (want to go out hiking or swimming or something.) BUT. the moment I find some resolve to focus
I get this fucking bullshit.. !
My mind is so fucked right now... I can't think of anything but standing up in class and screaming " Mother fucker, mother fucker...(point to the idiots in class you) motherfuckers shut the fuck up..
Can someone suggest some colorful swear words ?
My brains not working -_-
It is just about now that I start feeling like "Anger" from inside out12 -
Why is it so hard to remember, that devs need an error message if they should help you. just saying "it does not work" is not helping.
I even wrote you a checklist. so f*ing use it! I'm not there to be called every time just to tell you to do something that's already on this list.
Every. F**ing. Time.2 -
I have never understood why there is so much animosity from seasoned devs in the community.
I see it in a lot of places. Stackoverflow, reddit, even devRant. In so many cases, an inexperienced dev will post to the web, only to be shot down by things like "this question is stupid" or "you all have it too easy and its apparent you never learned basic CS principles" or things of that nature. In a lot of cases, these are generally unhelpful replies and often teach new devs to be wary of seeking help.
Please help me to understand, why this is.
Is it because the community is angry at these devs trying to get a high paying job by going to a bootcamp and shortcutting the hard work it takes to understand core CS principles to become a decent developer? Then why not take a moment to provide resources or insight to these folks so they can learn to be better?
Is it because the community feels that devs from bootcamps are just watering down the pool of talent making our worth decrease? I feel this isnt really valid because seasoned, experienced architects will always be needed to build good software. And at that, why are we not ensuring that the next wave of developers is equipped to handle tasks like that?
There are a lot of good people in this community who want to help and make the net a better place for all developers (after all, many of us consider it home), but there's a lot more people out there with really shitty attitudes, and it frustrates the hell out of me that my juniors now equate arrogant, self-entitled responses and attitudes with "seasoned devs" and discourages them from even bothering to get involved in the community.19 -
Dear lord! Why is it so hard to get this to work! Anyone know if its even possible to run lambda expression on JSP? I made sure everything is running on Java JDK 8. BUT IT DOESN'T WORKKKKK. I keep getting "Lambda expressions are allowed only at source level 1.8 or above"2
-
I work in a big corporate world where I felt really out of place at first. I didn’t enjoy working there, I could not understand why people would work so hard to keep all the systems happy. No one thanked them, no one gave the smart people maintaining the important systems any credits. I did not understand. Why did they care so much for these systems?
My team split. We were too many with too many systems to care for. After this my team was a lot smaller and therefore I ended up in a more important role. I was forced to do these tasks the more senior engineers had done before me, in the previous team. This was the greatest thing that could happen to me, and I started to like coming into work. Now our team is big again but I’m one of the senior people in it. Not senior as in years active in the industry but senior as in knows the most about our systems and our work environment. I work hard to constantly share my knowledge and try to put the newer members in situations where they also have to take responsibility.
Don’t be afraid to put important tasks on junior or new people. They might fuck up but they will learn, as will you. Don’t hog your knowledge and your team will thank you.1 -
Why for fucks sake can't I motivate myself to finish my thesis?
I mean I guess it is because I already got my third raise in my current (full-time) job because of hard work, which left not much time for side projects (or thesis writing).
On top of that, there is nothing which forces me to finish. My Prof. does not really care. I would probably not earn more because of a higher degree. Only thing is I have to pay the fee for enrolment once a semester.
Also, going back to my thesis project after some time, and having to upgrade all the npm modules in there does not help.
Even though I already have a working backend and proof-of-concept app, something blocks me from finishing all this work.
It is a curse. I would do so many side projects, but I tell myself that I first have to finish my thesis before doing anything else.
It is some kind of loop and I have yet to find the return condition.3 -
Seriously how hard is it to observe proper indentation! Don't mix spaces and tabs! That's why I added the .editorrc .jshintrc .jscsrc in the project repo so you'd use it. I asked you to configure your editor and the only thing you configured was your freaking Sublime theme and color scheme. aaaaargh!!!!!1
-
WTF if you want to program stuff learn how to use your programming language. Why is it so hard for that many people to learn how stuff works and stop copying blindly from the internet?
I have two colleagues who are doing nothing else that to just google their problems going to the first answer and cooping it then trying to run the program and if it doesn’t work ether give up completely or starting a loop of inserting the error message to google and copy the first result?3 -
Why doesn't Skype of business have an application for Linux? Every company meeting where a developer isn't involved is run on sfb. Being on Ubuntu it is hard to attend any such meeting. Any meeting between developers is on zoom so we're good.
We can't really convince every one (other than developers) to start using zoom.
Do we have any other alternatives? Is this a lost cause?20 -
I get that I'm new with this programming stuff. Yet why is it I feel I'm fighting the UI of Android than actually programming. Why is it so damn hard to display something in a nav draw. Really depressing when I can't get the damn ui to work to make the click events. Fine I got the damn menu to show. F**k if I can get the child's to show up to continue on the f**king project. F**k me with a cactus.2
-
Need to rant / maybe some advice.
Working remote is hard.
New company, remote on boarding. I feel like my coworkers are robots, and I'm being tossed into the deep end with minimal guidance.
The codebase is so unnecessarily complicated, its impossible to read. I've been trying to figure out how things work for a whole month, still not sure.
My mentor that is supposed to help onboard me is a robot, and answers questions in a somewhat acceptable manner, but it still feels like a lot of "figuring out" is still left for myself.
My other work partner that is also a newbie like myself is also a robot - doesn't talk or ask many questions whenever we have a sync up meeting.
The codebase is huge and feels quite overwhelming, I don't feel like I got a team "with my back", I don't enjoy work as much as I have before, I barely do any coding (mostly reading code and trying to understand how everything is working by setting breakpoints and debugging tests that take foreeeever to run), and some days I'm seriously considering cutting my losses and jumping ship just to save my sanity.
Am I paranoid? Am I just dumb? Should I just suck it up and be happy I have a job? Is this how Remote work is supposed to feel like? Why does it feel like my soul is dying?
Anyone in similar situations, or who can give some insight/advice/etc, I would highly appreciate it.
And this is supposed to be a good company too from the reviews. I don't know how it can be so crappy in reality. Did I make the wrong choice joining? Should I jump ship sooner rather than later? I've only been here about a month or so, and maybe its too soon? Halp!12 -
We've got a big legacy app which we have to rewrite. The current client applications are only working on XP(!). We have to move the clients to the browser so we can finally get rid of all XP vm-s. The db schema is complex but still 1000+ stored procedures and functions and about a hundred tables with 13 years of data.
So I ask the guy responsible for maintaining the DB code. (he is ~25 years older than me)
me - Where is the source of the database. Which project?
he - Where would it be? It's in the db.
me - So we've got a huge db without VCS, upgrade/downgrade scripts, etc?
he - Yes. I don't get why young developers always want to use shiny new tech like git just because it is cool. It has nothing that an external usb backup drive can't do.
me - VCS has been around since the early 1980's...
he - If you really want, you can put it under git or whatever, so you can sleep better, but I still think it is stupid and a waste of time.
I get that it's hard to keep up, but getting personal... -
Well it’s Sunday so last day to leave my thoughts on probably the only topic that’s current to me.
I think you should pay teachers a competitive salary.
The problem with teaching CS at high school level especially (in university there are grants, actually competitive salaries between unis and other perks) is if a person is versed in programming/cs theory why would they settle for a $40k job? When the alternative is finding a job in the field where salaries are around $80k+ (this figure came from my head, can’t remember the source) it’s hard to justify going into teaching even if you would enjoy it more than a desk job.
If the salary difference was smaller then one could maybe justify liking work over pay but here it’s basically double difference... Kinda makes you understand why some comp sci teachers seem incompetent in even using their own computer. Yes there will always be that odd person out who will teach (or go to a private school and negotiate a workable salary) but until education becomes a priority for government salaries there will be very limited progress, if any.
You can do anything to the syllabus, make it more verbose, make it appeal to the lowest common denominator, but if you can’t find people to teach it (and know it themselves) you are really screwed.1 -
Why is so hard to find engineers that actually care? It feels like the majority of people always want to do the bear minimum, no one wants to fix their shitty code even when it clearly violates the project or company standards. Everyone constantly comes up with shit about why they can't do things properly or how they'll fix it later and then get their mates to push their shit through review. The majority of lower management usually care equally as little so there's no point explaining the situation to them and the lack of care probably goes much higher. It seems like so many people go from job to job getting bump after bump in salary, which granted is absolutely fine and probably advised, but have nothing to show for it. Usually very little skills but alleged mountains of experience and a lazy piece of shit attitude. I hear all the time people saying you'll never change anything so why try and it feels like that most of the time but more because everyone keeps saying it. If everyone pulled their fingers out their arse, maybe we would stand a chance. I'm sure a lot of people on here have a real passion for computer science, whichever division you're in and love to learn and improve and reflect. What I really want to know is how you deal with people who are just taking their paycheck and enjoying the ride but don't actually care and how you discover these people as early on as possible to get shot of them.14
-
After playing et and wow a few year it all started when I hosted my own ts2 server with npo license. Rented a server for 90 bucks as a highschool student (13) with no job. (Who the fuck rented to me? I had my own bank account and lied about my age. Had a credit card at 14 but that's another story)
*Shit is expensive*
How does one get some value out of a server? Oh right, let's host Webspace and ftp accounts.
That got me into server administration and bash.
After dropping wow in bc i started playing on private servers.
*Shit is buggy*
How do you fix wow server? Let's learn c++ and push patches to arcemu. Why is this part crashing on this one server? Let's look at the binary. Wtf is this? Oh assembler?!? Ok let's try to read this. Ok I get it now. Let's fix the code.
Ok let's host my own wow private server. We need a website for account creation.
Let's learn php. Wait php is easy compared to mastering c++? I need an app for my first smartphone (iPhone 3g) to manage the server on the go. Let's learn how to do that. Why is this so easy? Switching to Android: wait java is even easier?
And that's how I learned that if you start with the hard part and grasp the concept, everything more abstract is significantly easier. If you start to read code to learn any language it's easier then following books (for me at least). If you get an error, track it down, you might learn amazing things in the way.
And if you want to get into reverse engineering, start by being passionate for the thing you want the reverse. It will be hard before it gets easier and you will need all the willpower you can muster not the just stop.
Programming for me is not a job but my passion. It's like I'm on vacation every day of the year (expect meetings, fuck meetings)2 -
Whenever anyone asks me why I dislike C++ I'm just going to point to this current app I'm working. Had a unit test with an extern method declaration that had 7 or 8 different parameters. No big. Problem is that the ACTUAL definition of the method had 1 less parameter than the extern declaration. It worked perfectly fine in x86. Ported to x64, compiled fine, hard crash at runtime. Debugger not a super lot of help. Took me a couple days to figure that one out. Also I am broke so I can't even drink the pain away. Neat.
-
FUCKING PIECE OF SHIT USB STICK. What the actual fuck how hard can it be to format a usb-stick? Excuse me?
Basically, flashed arch .iso on my usb stick. After stuff was done I want to format my usb stick again so I can put files on it. Normally thats a super easy process. I tried a shitload of things.
1) On windows: Quick format -> Windows was unable to format.
2) Went to Linux. Opened GParted. Gparted didn't detect the usb drive? Wtf. Rebooted then it showed up. Tried to delete all partitions, tried to clear the entire drive. Gparted just freezes. Ok... wtf is going on?
3) Tried to go the bruteforce way and zero out the entire drive with dd. After a few seconds dd freezes and is not doing anything anymore.
Wth is going on lol? Why can I not wipe my usb drive? Any ideas?10 -
God why is it so hard to let go with people around, especially potential friends or partners... It could be so easy to just have fun and do the things you always think about, but then you mess it up and that somehow.. purposely.3
-
Why the fuck is it so hard to find a proper guide on porting a custom rom(LineageOS) to a device?!1
-
Why does noone implement autoupdater, especialy on linux side? Is there a reason i dont get? Sure, most system stuff is better in apt, but if i install servers, i do not want to wait for these stupid linux release timings! If it were hard, id understand. But most of this is possible with something like GitHub API and 20 Minutes of time. I mean, yeah backwards compatibility and what not, but then handle that internaly.
Example: I use dnsmasq on a raspberry pi. RPI is running raspbian. Raspian is debian 8. Debian 8 has a version of dnsmasq with a pretty annoying bug, which prevents me from using dnssec, as i cant open any cloudflare pages. Why, o why isnt this updated at MY will? Then, if it isnt, why is it so impossible hard to compile this myself, no docs for that, no binaries, NOTHING? Dear server devs, please add atleast basic autoupdate functionality without having to rely on the base os.
Or, give me easily deployable binaries, if you cant write something integrated.12 -
"My generation's obsession with having established careers before 25 has led to everyone being hyper competitive, opportunistic, self-centered and deeply insecure. I wish everyone could relax a bit!"
I came across this quote few days back and I don't know why but this did hit me hard. Every word was so so true, I wish I along with everyone of this age group could relax a bit and enjoy this wonderful life.
Do you feel the same as I do, or is it just me ?10 -
i always assume that my code is right so when the compiler gives an error, its hard for me to find out why it gives an error and why it doesnt work. my mind is too convinced that it is correct.
i guess i have to sleep it off 😴 maybe tomorrow it will be easier to fix5 -
Why in the fuck is it so hard to see buttons when kb selecting with tab in a browser? It's like:
"Tab....Tab.....Tab Tab Tab... oops, went too far,
Shift + Tab, Shift + Tab.... fuck!, too far left.. wait, is that button actually highlighted, oh it is too, wtf."
It's 2019, why is this still a thing?8 -
Why is it so hard to explain to people that
The speed of time = 60 minutes / hour
I mean, I didn't come up with this shit!!! Come on
Also, in other annoyances of today:
VS code updated and ended with a crash, even tho it now says it's actually updated... Should I trust this bitch or not?!?! -
"Exception has been thrown by the target of an invocation"
This error message pisses me off. I know the SSIS Script component is capable of catching exceptions, you can wrap all your code in a try/catch (please don't) and get an exception. So would it be so hard that if the Script Component throws an exception that it tells me what it is instead of sending me on a goddamn scavenger hunt?
The whole bullshit system of errors is why I hate SSIS. Just tell me what went wrong.
I did what I wasn't supposed to do, wrapped it in a try catch and it gave me a stack trace and an error message and all sorts of actionable shit. But why the hell can't it just do that on its own?
There is literally nothing worse, except maybe Hitler, than a goddamn vague error message.4 -
Why does everything installed via npm sux so hard?
Why the fuck does any minor update in their bullshit packages either forces you to change config files:
E.g. now should be "@babel/core" instead of "babel-core" - WHAT A FUCKING SIGNIFICANT CHANGE!!! Rewrite all you configs motherfucker, that goddamn "@" in front of our shit is SO IMPORTANT that we will break everything to add it
Or breaks the code internally:
Consider the recent fail of fucking Terser [https://github.com/gatsbyjs/gatsby/...] that breaks fucking webpack and FORCE YOU TO ROLLBACK TO ANY VERSION THAT WORKS, why you nerd retards, can not run a simple dummy project BEFORE YOU RELEASE YOUR SHIT???!?!!?
Why any fucking update from *.*.1 to *.*.2 turns into hours of googling of what the fuck got broken this time??
The way that webpack, babel and other npm packages are released nowadays is absolutely retarded. I really have a strong feeling that it is better to keep old error-proof working config and NEVER UPDATE, than constantly suffer from butthurt
p.s.
Of course I am sorry for all the hate and caps in my post, and have respect for guys that develop amazing stuff for us for free, but I need to share this5 -
WHY IS IT SO FUCKING HARD TO DOWNLOAD SOFTWARE FROM MEGACORPS??
Yes, am looking at you EMC, Oracle and IBM. Either they have tons of portals-e-delivery-shittorama or their softwares suddenly disappear for n amount of time without notice. Mix this up with broken links or CONSTANTLY REBRANDING YOUR SHITTY PRODUCTS SO YOU NEED TO HIRE A PERSONAL ASSISTANT THAT ONLY WORKS WITH TRACKING THESE PORTALS TO HELL
Also, your websites are slow as shit.
Thank you.1 -
android development is shitty af, it will make you super zombie computer nerd that sit on his chair for fking several hours just to find the where the fk is null pointer exception is coming from not only this but for all kind of errors,logcat looks like someone just hacking nasa, you know what im the one who is shitty af i would have opt web dev instead of android dev , this retarded studio and emulator takes too much time to just load a simple fking thing & if i make some change in it i've to install that application again ,it's so pathetic and horse shit thing i've ever encountered , kotlin is fun it's actually great language most of the features are so helpful in it,but the google codelabs,it's all documentation , adding dependencies whole concepts are trash imo, why can't we install the dependencies using terminal what's problem in that ,but no they chose the hard way for no fuking reason, i've successfully wasted a year learning this shitty tech stack, hopefully this NY i will choose different stack , will work till ass off .gonna build some cool projects and will eventually try for internships and all. done with android dev, idk how senior dev's are alive in this field6
-
Why is it so fucking HARD TO CLONE THE FUCKING C: DRIVE! WHY THE FUCK!? I JUST WANT TO CLONE THE DATA TO A BACKUP SSD AND THIS SHIT ISNT FUCKING WORKING! I DONT WANNA PAY FUCKING MONEY FOR SOME extremly safe high quality backup FUCK THIS!7
-
Why in the fuck are twilios typings so spread out and tucked away in a hundred folders? I have 8 separate imports to deeply nested directories (whose path includes fucking api version numbers) and at the end of each path are generic garbage interfaces. Autocomplete suggestions show handfuls of identical interfaces and types, and autosuggest for import paths is cut off because the paths are too long. To make it worse, they’re cut off at exactly the name of the directory for the actual resource I’m trying to get types for. It shouldn’t be this fucking hard, twilio.2
-
Okay soooo.... I have this laptop that I use a little less often but is bugging me about. So WINDOWS just decides to RAMP UP THE HARD DRIVE TO ALL HELL WHENEVER I NEED TO USE IT.
I have a few options:
- Replace the 1TB 5400RPM with a 120GB SSD and do Linux
- Replace the 1TB with the 120GB and do a fresh install of Windows
- Replace Windows with Linux, keeping the 1TB
- or reinstall Windows
Which do you suggest and why?4 -
I'm so done with auth
it's more than a nightmare
it's a disgrace
why can't someone just be like "you know how auth and identity is hard? why don't we make it easy?"
I would pay so much for that9 -
why is it so hard to get a job, why do they make it hard to literally get a job so you can feed into their system and make profit for them anyway. false sense of scarcity makes me so angry and interviews or applications always ask questions completely irrelevant and even after you get a college degree that just makes you have the ability to even apply to half the places. i get that you want the best person, because if you have to pay them a wage at all then they better work for it (get 4 part time jobs and live paycheck to paycheck), but seriously??
humans need to work, it is as natural as eating or sleeping, its such fucking bullshit that the bourgeoisie made working unbearable enough that the few people the government deems unfit to work obviously wouldn't, because working sucks, but then they are seen as lazy. sometimes i just want to go out and do some cyber-terrorism yk ? /j10 -
Ok Rust help you write robust safe code and is very fast.
But at what cost ?
But why on earth the syntax is very disgusting. It takes time to familiarize with the horrible syntax.
And I feel like the sadistic rust cult members actually enjoy making it hard to read so that they can jump on any occasion to shout at you : you still lacking rustlang skills
Fuck that shit I'd rather write in golang or just deal with C++ . At least their syntax doesn't make me wanna puck11 -
I think the one of the more common reason for imposter syndrome is that a lot of smart people constantly get told as children the "you're so smart/capable, you can do everything!" too much, and when you hear it enough times, it gets to you, so you think everything is just easy. And then when they start hitting roadblocks, instead of helping or explaining that it's normal for things to be hard and it's normal to fail, usually parents and teachers and whatnot tell them "Oh it's okay, don't worry about it, you're smart, you'll get it" and so they at first it works, maybe it just takes more time but they manage, but as things get harder and they still put little effort because "don't worry, you're so smart, you learn so fast/easy" and as they find out more and more things they don't umderstand or don't know they start to feel a dissonance, which builds anxiety.
And this is where I thinks it actually starts: at some points there comes a situation where they either share this anxiety with someone or someone notices their worry, and(at least from what I've seen from others) usually the response they get is something along the lines of: "Nah, you're just worrying too much, you're smarter than you think, don't be so down on yourself, you need to worry less", which, maybe I'm wrong, but I'm not sure telling someone that thinks he has a problem that he doesn't have a problem, helps their worrying.
And on one hand the amount if things they don't get/know/understand or fail at grows(cuz you can't just be good at EVERYTHING, so the more things you know about, the more things you don't understand) while mentally still being in that "Wait a minute, you're smarter than this, you should be getting this!" mindset that's been drilled into them, and so at some point the illusion shatters, and they start to think "Maybe I'm not so smart after all", and because they think they were wrong about their level, they feel like they have "oversold" themselves in the past and that makes any past accomplishments feel like lucky accidents instead: "If I'm not actually smart, the things I did manage to achieve must've been just accidental", which makes them feel like they've lied to themselves and everyone else when they "took credit for an accidents" and that their life is just a snowball of pretending.
Now, is that actually a cause or is it another one of my crazy 1AM ramblings? I don't know xD
I'm not an expert in any of this and I don't really know any psychology so hell if I know if that's how any of this works but that's just my theory of one of the reasons why. *shrug*. I've had this theory for years, but I don't know.
It at least makes sense to me, but not everything that makes sense is true soooo.
Anyways, wall of text is over.
Oh, and for anyone struggling with imposter syndrome: I just want you to know, it's okay to fail, and it's okay to not know shit, especially in the dev industry where every "insignificant" detail can have an entire rabbit hole of expertise behind it, nobody can expect to know every part of it. And it doesn't make you any less smart no matter how much you fail. Tnis shit is hard, so I hope you stay strong and I hope you succeed in whatever it is you're struggling with.
*Massive virtual hug* <31 -
Avast stoping my benchmark and reporting it to me is like a dog that proudly brings a bone to you while you walk with him on a cemetery.
I know about it before I started the benchmark so i deactivated it for 30min, but then for some reason (i may have accidently clicked on the symbol) the ui opened and everytime it does that it for some reason resets the option so it was active again. Now it deleted parts of the Software and I have a hard time making it run again. Fml and fuck monday. Why isn't there an option to make a fucking exception or remove something from their fucking virus container if it was a false alarm?6 -
so... is ReScript just a bunch of butthurt javascript developers who couldn't hack it to learn TypeScript (older, better tooling, better community, massive support with library typings, etc.)
seems like just a lot of extra, seemingly pointless and useless differentiating syntax rules
why do we need to keep reinventing the wheel?
"Our type system is guaranteed to *never* be wrong."
seen statements like this way too many times in my career... welcome to programming pain world, i should just read the rescript issues on github just to get a laugh here
but again, just a 🤡 giving his two cents
update: confirmed, all i've found on the web is rescript shillers trying REALLY HARD to defend it, and mostly failing3 -
Doing pair programming while I was navigating on somebody else's computer, we hit a weird behavior that our code changes weren't reflected.
Trying everything it turned out: I forgot to save.
Yet: Why though would you make me save? And why did the IDE not warn me about compiling unsaved changes? I think it was eclipse for Java, oh well. What can I expect ...
Anyways, I have gotten so used to my editors autosaving content for me as I write it, that I completely forget about doing Ctrl + S myself.
I never understood the need to hit that key combination manually as if I break something: `get reset --hard` will help to get me to a working state. (And even if I mess it up differently, my IDE's local history also let me restore recent changes.) And if it is a workign state, then I like to commit early and often. and
I am really dumbfounded why people insist on hitting save themselves.7 -
Okay, THAT was trippy.
Soo.. I slowly srart feeling uncomfortable. It's that feeling when you want to move your body to make it go away. Stretch an arm, move a leg or smth... Alright, no biggie - let's move something. But then my focus is overwhelmed by darkness. Hmm... I must be asleep. There's some soothing humming noise in the background. And that feeling's still there. Aaaahh, the numbness is now going away - I must've moved smth! Good job! Drowning back into sleep now. It's ssooo ssweet...
*outage*
*notions of awareness*
huh? What's that? Oh, right, I need to move again. That humming sound is so relaxing.. I'll move smth to change that status quo. There, much better now. Let's keep the eyes closed and drift back to sleep. It's so dark though...
*outage*
*notions of awareness*
ahh, that feeling again. Come on, I've moved like 4 times already. Well alright, alright, it's better to move that open my eyes or roll over.
Wait...
I can't roll over.
I can't even move my hands. Fuck, must be that sleep paralysis kicking in again. No biggie, it'll wear off if I stay aware long enoug........
*outage*
*...?...*
...nough. What? Did I nod off? That's weird. Meeh, nvm. Why is it so dark though... Okay, let's try to open the eyes. *attempts going on for ~a minute*. No luck. That humming sound, so soothing...
I feel some clothing on my - must be the blanket. So warm.. Nice.I'm feeling - prolly the paralysis is wearing off! Good. A few more minutes and I'll be free to roll over
let's try the eyes once again. Hhhrhrhhh! Nope, not working. Wait, what's that? I turned my body! But somehow...Weirdly. Too easy. There, I did it again! Why is it so easy and I am still feeling paralysed...? Wtf is going on...?
That humming. What IS it..?
Wait! My eyes opened! It's pitch dark in here. Why...? Usually there's at least *some* light in the room. Am I still asleep? Naah, that's not it.. I'm turning my body again. Why did I do that? Wtf is happening?
That humming sound is getting louder and louder, taking all of my attention now.
What is it I'm feeling with my feet? It's hard. And cold.
Wait... AM I STANDING??? What the fuck?!?
Why am i standing??? And that sound - that's... That's... A vent fan in my bathroom!!! Am I standing asleep in my bathroom...? In the middle of the night...? Facing the mirror...? With the lights off....?
WHAT THE FUCK DID JUST HAPPEN?!?!?
HOW THE FUCK DID I GET THERE?!?!?
How long have I been here...?
I HAVE QUESTIONS!!
Fuck it, I'm tired. Time to go to bed. It'll be one mindfuck of a storry tomorrow though...5 -
Ok, all of us have seen the memes about how nasty Stack Overflow can be, this is why I usually try to find an existing SO post to read instead of making one. This time however, I found an error that I couldn't fix. A nasty C runtime error. I decided to ask a SO question for help, and awaited answers. I came back, and the question had been flagged to require more info, so I added more. I came back later, and someone told me I was doing it the hard way, and I should be using Visual Studio (I'm on Visual Studio Code), which ticks me off, because I don't want to use the hacky way around the problem, then this same person closed the question! They didn't even answer it, they just offered a simple workaround then closed without an answer. Man, SO sucks sometimes.15
-
On the one hand, as an avid programmer having a non-programmer partner, we (I) once wanted to mod some Gameboy Pokémon games (Crystal), but the games were written in Assembly and I was definitely not getting myself into that. My partner was rather sad, as this was quite a big project for the both of us, but it was never finished, and it was still complicated to explain to him why Assembly is such a bitch. Nevertheless, we found other projects to have fun with (simplest of them: random movie picker that chooses a movie based on title/genre/etc. from our own movie list file).
On the other hand, explaining and making programming exciting for people who are not into it, so you still seem like an interesting person for new dates (poly relationship), is really hard. But I would also blame my introverted self and not only programming for unsuccessful dating :D -
Why is it so hard to make friends with other developers?
Nobody understands how hard it is to sit on my ass all day while my wife complains about the lack of attention I give her. Anyone else relate?7 -
As a web developer who focuses on accessibility, why is it so goddamn hard to get buy-in for accessible design?!
If you design to be the most accessible possible regular users benefit from an experience that works, for as many people as possible, in more situations than most test for normally!5 -
Fuck C# for real, like why in the FUCK DO YOU NOT AT LEAST THROW A FUCKING EXCEPTION WHEN I TRY TO CONCENTRATE A STRING WITH NULL, I SPENT 40 MINUTES DEBUGGING THIS SHIT JESUS FUCK
Edit, note: I'm having classes that return null when they don't find something. Why is it so hard for the fucking compiler to at least warn me or some shit!!!!!!!!!!!!10 -
LINUX. I'm sure everyone heard this term. But I still don't know why do people want to give up their life and try this piece of crap. I know many of you might be offended, but, to hell with that. When I heard about the Linux, and everyone was praising it about it, I thought that I should give it a try. So, I installed Ubuntu (obviously, because I was a beginner) and the installation failed. I thought that I've made some mistake. Tried again, FAILED. So, I waited for next version. After downloading and trying to installing it, Voila. I installed it. Then comes the part when I actually started using it, for as simple as watching a video. I didn't play. It gave an error of some codec was missing. I installed the codec and then I payed the video successfully. Then, I want to install the Oracle Java Development Kit, and literally it was a pain to install. It took me half an hour to install and configure it. Then after using it for a couple of days, I found that my WiFi was acting weird. I booted up my Windows just to check it and it worked perfectly on windows. Then why the heck was it not working on Ubuntu. Don't know. On searching about it, I found that my WiFi adapter's driver was having some issues. Then after using it for more days, something very weird happens, the Ubuntu booted but with terminal only. No GUI, No Unity, nothing. I against searched for it, found some commands, ran it and it started normally. So, the point that I'm trying to make is that even for simple and basic tasks, I always have to search about it every time to get it working. I mean if their are so many steps to be taken for every simple task then why people keep on recommending it. With the Linux installed, I was very much distracted from my primary work. Instead of doing my work I was searching for installing JDK. I mean wtf. In Mac or Windows its as simple as downloading the file, installing it and you're done. But in Linux I don't know. And the whole Linux community thinks that Windows sucks. I mean on windows I was more relaxed and more focused on my work. Whenever we search for the Linux, many people say that Android is a Linux. I get it, but in Android, many developers have worked very hard to make it as what it is nowadays. But what about Ubuntu, Fedora or any other distribution. I haven't seen any distribution which makes me feel that I wanna use it again. None of them. So, Linux is not a great OS according to my experience11
-
Is there anyone who has ever used frappe/erpnext?
It drives me nuts, as much as I like the framework doing any thing that needs some basic scripting is a pain!
I MEAN, COME ON MAN, WHY ARE DOCS SO HARD TO COME BY? WHY DOES YOUR "CUSTOM SCRIPT" EDITOR LACK BAISIC LINE NUMBERS? WHY ARE YOUR ERROR MESSAGES TELLING ME EVERYTHING BUT THE LINE THE ERROR'S ON, SO I'LL BE HOPEFULL THE ERROR IS IN THE DEV CONSOLE? WHY NOT USE MONACO, SOMETHING, ANYTHING THAT WILL SHOW SYNTAX ERRORS? I'VE WAISTED HOURS ON LITTLE AUTOMATION SCRIPTS!!!! WHY WHY WHY WHY????1 -
Why is it so damn hard to integrate an external api into Android in a non messy non tedious way... I mean yes I'm new to this but it's unnecessarily tough..
-
Microsoft is always at it.
Hello, I recently discovered this eye candy of a looking website and how good the CSS looks (Kudos to whoever made this) , and I decided to post a rant of my own. And its about MS Edge and other applications.
So I built my own ATX tower a while back (Loving it) , and I found that it was WONDERFUL to have a computer that was brand new, that didnt have candy crush preinstalled on it when I got it.
Windows 10 users, do this:
Press WIN+I to open the settings menu.
Go to "Apps"
Scroll down the list....
How many applications do you see there that are actually useful , or that you have downloaded?
I never downloaded a Realtek Driver... and I never need it for anything to work. This is the case for 90% of the things you may see in the applications.
Why is HULU installed?
Why is NETFLIX installed?
Why is MINECRAFT BETA INSTALLED? THE BETA HASNT BEEN OUT IN YEARS?
But I digress, this is the case when I work on a computer such as my grandmothers who, bless her soul, isnt very adept at basic file management. Heck , she uses free Norton Antivirus against my recommendation to use the PAID active firewall application on her computer (VIPRE)
So needless to say she needs help. All the time.
So here comes microsoft recently, reinstalling like 15 different programs on her computer , including MS edge. Who else is tired of bloating? I know I am.
I recently found this program on Git!
Its the Sycnex Windows 10 DeBloater
But guess what? DONT USE IT.
Wanna know why?
Because if you do, it works, and if it works, it disables:
- Cortana (basic search engine for your OS, good luck finding candy crush).
- Microsoft Store (That means no XBOX games pass either)
- It breaks part of the file explorer
Wanna know why? BeCaUsE it geTs riD oF Ms EdGe
And believe it or not, apparently MS edges source code is Mandatory for certain functions on your computer. So even If you try to uninstall the browser, it stays behind in some form.
So there you have it. They hard coded it into windows.
Enjoy!
So its not even the author of the GITHUB programs fault, its just a real techincal limitation of the platform.
I hate that stuff man. I really do. There should be 20 things installed on my computer and thats it. Everything else is just, space for games on a solid state. Or Eclipse Photon, etc.
I would post links to show you guys a few things but. Unfortunately I cant post URLs yet!
However, thats my first rant. Hope you liked it.20 -
Sometimes i cant fix a bug for days. Like 3 days of brainwreck. Then on the 4th day i wake up. So whatever i love. Take some time for a rest. And then begin working whenever i feel like it. I start working at 2 pm. Try to solve the same bug again. The first thing that comes to my mind is Hold on, why dont i try to change this? I did and it worked. My first thought has solved a 3 day old bug.
Can someone explain this phenomenon. This is proof that a man is unproductive and cant work good if he doesnt feel like it.
You know all of those bullshit andrew tate quotes "i work even when I don't feel like it because that's what men are supposed to do. I train when im happy and i train exactly the same when im unhappy" but thats bullshit. I can not be productive if i am unhappy. I tried so hard and the harder i tried the more i failed. And now when im no longer unhappy i solved it on the first try.
Nobody cares when a man is unhappy. No one gives a shit. It's not fair1 -
Finish at least one thing I started in 2021
* Learning Latin
* Learning Unity
* Learning Flutter
* Working on a personal app idea
God, why is it so hard to follow through with something I started? :/14 -
Hi All !!!
Woah this is my first Post after 3 years not opening this website.
i don't know why.
but maybe between 2017-2020 my live got better so i don't think will have any Rant again.ahahaha *kidding
but today i see email, that i got sticker from devRant, woah i think i will go to devRant again.
wow devRant more cool than before , i don't think this website still open. i just want to check it. i forgot my password too. but luckily still got an access to my email.
So i want to tell a story about this weekly Rant,
Family Support? what the he** is it.
my family only look for money.
at my first job finding, i always pushed for find work in Factory/Oil/Goverment that will give a BIG money.
my first reaction to this i tell i won't do that. but overtime i think i will not talk about it again.
i just want to get Dev Job anywhere.
i don't know if this is the meaning of passion or something like that.
but from the first time , i try hard to get job only is software development.
and hey Maybe my Pray Listened by Almighty God.
so i got my first job as Fullstack developer that luckily accept me as self taught software developer. i don't have any formal education.
actually i only learn software dev from Lynda.com(not promotion) .
i learn algorithm, pseudocode . then i got passed the test of psudocode.
Then because the money is good in there. my parent just accept my first job. not complaining again till now..
maybe this is what they called ikigai??
i love software development so much....
but still i always have a Rant every day about it.
someday you like it, someday you hate it.
someday yo miss it, someday you regret it.
maybe that what is called Love.Damn... -
Javascript makes me wanna blow my fucking brains out.
Why the fuck isn't appendChild working? It shouldn't be this fucking hard to get a simple result.
p = document.createElement("p");
p.textContent = String(new Date().getTime());
doc = document.getElementById("todoList")
doc.appendChild(p);
Done from within a listener function for another element, listening for onkeyup. Using bulma.
Jesus fucking christ and this is the profession I chose.
At this rate by the time I'm fucking competent I'll be replaced by wage slaves from india who started training at the age of ten because their government actually gives a shit about investing in their people instead of saddling new generations with trillions in bank debt so goldman fucking sachs can hire more underage prostitutes from epstein and mossad.23 -
Story time!
I was with some friends, one a CS student and the other one's a mechanical engineer student with coding like a hobby.
I was listening to a song from which the band released the stems (individual tracks) of a song, and this dude made an anime version of it.
Me: Oh God, this is awesome
Mech: how did he do that?
Me: What? The song?
Mech: Yeah, how did he split the voice and everything, is the music like an Ajax request and he queried for the voice
Me and my other friend lock eyes and began to laugh so fucking hard.
Me: that's not how it works, why did you though that?
Mech: I don't know -
Wow..so i can’t believe this but i just got told by my “senior” in company that he “knows his shit” when i tried to give him constructive feedback on why doing calculations for users on backend is a bad idea and is not going to scale very well.
I mean we could do those calculations on frontend using web workers ( if they are so complex ) and that would have been clearly a better idea.
I also tried to give him feedback on why its a bad idea to couple backend apis with frontend. Honestly, i don’t feel like giving any sort of feedback anymore. I don’t even feel like trying my best to “improve” the codebase because if its going to be maintained by shitheads like him that get their pride easily hurt, then no matter how hard i try to improve it, its going to end up shit either way.14 -
CGI is fun, websockets are fun, why on earth is it so fucking hard to have both of them with proper switching using at most one extra program apart from my handlers?
By proper switching I mean that you actually track connections and upgrade headers to decide what to do, rather than forcing websocket connections onto a separate HTTP resource just to tell the difference.4 -
!rant
Just wanted to get back to my last rant on here: https://devrant.com/rants/1617720/...
So, even though the team still is slimming down we actually did manage to get the two applications live by the deadline. It took my saturday and a lot of hard work, but we managed to pull it off somehow. I'm so happy :)1 -
Why are hooks so awful?
What justifies having everyone using React relearn how to do things when hooks do not bring any new features to React?
Why does getting setInterval to work with hooks require a ~3000 word blog post by a maintainer which constantly assures you this IS a step forward?
Is scrolling up and down a class component really so hard that this clusterfuck is worth it?
>:(6 -
I know the world doesn't owe me anything but why is it so fucking hard to get a job in this industry?? Unless you have a few years experience in a job behind you. Well if I can't get a fucking coding job in the first place how the fuck am I supposed to get work experience. The world is deluded fucked up place. Rant over!8
-
Migrating an existing report from old system to new.
Business: We reviewed the differences you raised and why they're acceptable and this seems fine. But before we provide approval for your productionization, we would like these changes...
*1 month later, changes are made*
Business: you reported new differences. We can't give you approval until you tell us explain them all
Me: `••π÷¶×¶π|``•√÷÷÷π√^°°¥®^¥€€!!!!!!!
Can someone give me a new job so I can just walk in, say fuck it, I quit!!!"
Sometimes I just want to do that now but getting a new job is hard.... for reasons unrelated to how well I can code... -
!dev
https://epicgames.com/fortnite/...
This url brings to error page with invalid email address that will actually autoreply "We're writing to let you know that the group you tried to contact (do-bug) may not exist, or you may not have permission to post messages to the group. A few more details on why you weren't able to post"
Okay, sure. This may happen to indie stuff etc.
But we are talking about bigass company thats fucking trying to assasinate steam (and so far kindda fails). You dont want to show customers error messages, sure, but at least, if you do it, and you tell your customer to send email to admin, make fucking sure that you provide an actually fucking working email. Is it so hard?
No wonder they cant conquer steam. And thats positive side3 -
I’m so over software engineers asking me questions when they’re more than capable of figuring things out themselves. Why do you rely on me so much for answers. Half the time I don’t even know the answer and what you’re really asking is for me to go and do the hard yakka to figure it out! Fuuuuuuuuckkkk6
-
Told my boss that i don't understand Laravel because i never use PHP in any project before.But he told me that it is so easy and give me 2 week to explore.
I know java, c#, python but don't know why it's hard for me to understand Laravel framework.15 -
Javascript in a nutshell:
Function in a teaching example for a framework, checks for validity of input, dev returns null instead of false when it isn't. In another place, uses !variable to check if variable is 0.
fucking follow the semantics of the code you write cunt why do you have to do this why is it so hard to write variable !== 0
I'm sorry, this really triggers me.
https://media.giphy.com/media/... -
Following from https://devrant.com/rants/1516205/...
My emacs journey day 0-1
0: quickly realised what I was getting myself into, wow that is a learning curve. Head is buzzing with different key commands (and thank you to everyone who's helped out in my original post). I've been here before with Vim, but it's so hard when I am proficient with another editor, one of the most difficult aspects is getting it set up to even format my code appropriately (the right tab width etc), but I press on, something tells me it will be worth it in the end.
1: I come across a tutorial for clojure and emacs (https://braveclojure.com/basic-emac...), this looks good, oh sweet it shows how to load a good configuration, some more useful commands, feels like I'm getting there. Then it hits me, I manage to put my finger on why I decided to take the plunge: emacs isn't an editor at heart, at its heart is lisp. From its core it is scripted using one of the most powerful types of languages. Rather than some bolted on domain specific scripting language.
Now the real learning begins.2 -
Budding Developer here...
I've tried to teach myself Web Dev over the past 10 yrs on/off... Sad. But now I'm actually in a developer role moved up from IT helpdesk a year ago.
In the past year I've learned SQL, SSRS, SSIS, database concepts, and.... VB6. I am a master at none due to having to cram so much in a year while taking on various projects, issues, and learning the organizations software infrastructure and processes. I also taught myself current HTML, CSS, and basic Javascript. Learning the different basic concepts with each.
Over the past couple months I've been given a new project and now learning ASP.NET and C#. Actually trying really hard to get adept at these as I'm finally doing Web Developing in my role...
I am also dealing with multiple major family issues and a near 2 yr old that we cosleep with that still doesn't sleep through the night.
Why the crap is it so easy to convert an enum to a string but takes 50 functions to convert a string to an enum???
Cast, convert, parse... Why so much logic???
When the online teacher says type why do I have to rifle through 7 different meanings in my head before I know what kind of type he's referring to??4 -
Why is it so hard to find backend Java developers?
So much work to do... so few people to do it with... -_-11 -
I spent the last 3 *fucking* hours trying to get bloody BibLatex working on my machine. fuck me upside down with a rusty chainsaw >:( How hard can it possibly be to get 1 fucking reference working for god's sake!!? Referencing its basically the whole fucking reason people use latex alongside typesetting math, why is it so fucking hard!! And to add insult to injury it was working fine in Overleaf, but i have to go through fucking hours of pointless googling and swearing if i wanna do the exact same thing in TexStudio. Fuck! LateX can go to hell, i could have written so much in this time if only the piece of shit bibtex would cooperate a bit...1
-
Here is why developers should be involved in project planning.
I had a meeting with a Product Manager and a backend dev about rolling out a new rewards program. My employer has a primary website and a lightweight app that’s can be used in an iframe. It has a hard deadline because the contract for current rewards vendor is expiring.
Me: So is this new rewards program also being rolled out in the LW app?
PM: Users earn rewards on the LW app?
Me: Yes.
We’re in a video call and I can’t see the PM’s face, but I know he’s thinking “fuck.”
Me: So are we going to bring in another front end dev to code the FE for the LW app since we have a hard deadline?
PM: [clearly sounding panicked] Another dev?!
Me: Well, I’m effectively coding the frontend twice. Sure both use React, but they use it in different ways. LW app uses React Redux. I can’t just code one and copy and paste it into the other.
To be fair, this PM wasn’t the point person for the LW app. But this is why devs need to brought in on planning.3 -
Anyone seeing this rant from Sydney? If yes, why is it so hard to get any IT/Dev jobs for an international student? Sucks.
-
Dealing with clients is probably the biggest personal challenge. I'm not much of a people person, and I find it hard to converse with friends and people I've known for years, let alone clients who are looking for answers for why things aren't working, and wanting you to explain exactly (but in simple terms) why a thing that seems simple is so complicated.
Another challenge, which is somewhat related is expressing myself. This again, stems from not being super great or comfortable in conversations, but as a dev, even among other devs, your opinion on things gets asked a lot. For someone who was used to sticking with the status quo and mostly agreeing with things, stuff like peer code reviews, or giving pointers on how to implement something is a big challenge (but I'm improving)2 -
tl;dr: why is it so hard to build a pc?😒
why is it so damn hard to find the right pc components for developing/image editing/gaming/...?😟
i've been googling around and watched many youtube videos on what components to buy/what to watch out for/tips/problems/etc...
i want to build a decent pc for web, mail, office, developing, running linux as VM (for experiments), edit images, doing most in multitasking (and maybe also play some games) ... basically everything, but i can't wrap my head around what to choose😟
every time when i think (for example) "ok, ryzen 5 2400G, that must be it!' there's always smth negative about it, come on!!🙄😤
i wanted to make an AMD setup for 1000€ max
i feel like as a developer/"kinda it guy" i know what i need, then again i feel dumb as fuck, not knowing what to choose and i'm almost certain i will pick smth wrong😪
do u guys have any suggestions for me/any help?21 -
Few months ago we move into a new Building, Company buys new Polycoms for 2 of the boardrooms - fancy ones with the Skype for Business and stuff.
Provision the boardroom accounts get them set up and all is working well.
Director asks if we can swap 2 boardroom phones around because their dept. just got a remote user and video calling would be awesome.
I set to work changing sign in details, provisioning accounts, assigning licenses, etc which is a long process because 365 needs to update throughout.
Finally get everything right, time to login... Failed...
Login fails on the Polycom, my laptop & an android tab - all 3 with different errors.
Decide to test account by logging into the web version in OWA - logs in perfectly.
Why Microsoft?? Why must you make it so hard? Why not just work?2 -
Dear Microsoft, I see what you were going for, and I love you for it; but for the love of god, please fucking fix the clusterfuck that is Nuget.
I use a private feed for client work, and I have the public source registered too, so why would installing a new .core template from Nuget fail just because it tried the private feed first and shit itself?
It really shouldn’t be this hard.
Sincerely,
Brolls -
Me : .. but sir without sass/js compiled, how can we address the issue?
Boss : that is not an issue, issue is with on approach we have taken?
You sick fuck, you take other developers un-finished work, expect me to finish it (which it did) and when the other developer is not smart enough to copy paste the solution, you give an "update" to me, I mean how the fuck, what ever..
I really really put efforts to make this shit happen, I know very little about your commerce cloud shit, but when you question my logic on basis of someone who will pay you to finish her work, it is very unethical and hard to swallow it down.
Maybe this is my first real job, that is why this is so hard, but I gotta do what I gotta do -
So I see posts about an interview question/challenge of inverting a binary tree. I don't use trees very often (mainly file related or parsing server nodes), but I thought I would learn how to do this.
I saw a page that started talking about different ways to invert enough to understand that one type of inversion is swapping left and right nodes. So I stopped before they showed how.
Then I created a test program that has a tree structure and also can display a tree before and after modification. This was kind of fun.
So then I wrote the inversion function. It was less than 10 lines of code. Wtf? I thought it would be harder than this.
Then I started wondering where trees were used. So today I have been learning how they are used and why I might need one to solve a problem. One use I intuited was parsing regex or a language. Apparently it is useful there.
What I am learning is that a lot of these interview questions are really test to see if you can comprehend instructions when stressed. Or you will ask questions to clarify the task. It doesn't necessarily test your ability to solve hard problems.
One thing that perplexes me. If inverting a tree is swapping nodes left<->right, then why not leave data in place and just swap roles in the functions. Maybe I completely misunderstood what inversion means or why it would be done. I guess if this is not inverting I have the structure to try other methods now.2 -
So, working on real multi language support today I was searching for countries and country-codes. Yes this one is easy peasy. Also easy if you want every countryname in your supported languages.
But why is there no source for the states or provinces translated in every language. It's so hard to find...
Anyone knows a source for it? Is it worth to create a project for such translations?1 -
Holy shit! Why is it so hard to find a JSON viewer for android that doesn't absolutely suck ass?
I want a viewer that:
-reads json from the clipboard
-queries json for strings in context
-allows copying of values, not the key and the value put together
Major bonus points:
-JSONPath querying
-Free/pay version without ads7 -
Why is it so hard to find a good work from home position? I love my home office and I honestly don't get distracted so it would be perfect for me.8
-
!dev
People that call you, get to voicemail and, instead of leaving you a message (especially if it's something important), just hang up.
Why is it so hard for people to just leave a message saying “Hi, I'm ${PERSON} and I'm calling you because of ${REASON}, to let you know that ${WHATEVER}. Please call back”?
I don't know if it's like that in your respective countries, but here in Spain people seem to have a phobia of leaving voicemails and it's fucking annoying.3 -
Just need to vent out a bit. There's already been a few times at work where the senior developer asks me why I take so long to do something, and I'm unable to fully explain why.
Now, I could think of several reasons. Maybe it's my lack of experience; I just start researching on Google for solutions, start putting things together, and then I guess things start to get too complicated for me to be able to explain clearly. Maybe I end up "over-engineering" to solve problems that could be solved in a simpler way.
And this leads to my second reason, and that is there's no code review going on. I've wanted to just tell him, "If you'd just take a long look at my code, you'd understand why it's taking me so long! So you can tell me if I'm doing it right or wrong, or if I'm making it too complicated!" But, of course, being the junior developer, I also think that when he's explaining how to do something, I'm just not understanding it right.
I could ask for clarifications, and believe I've done that on some things, but my third reason is that he's just not good at explaining things, or that there's some miscommunication happening. English isn't his first language. His English is ok, but I know there's a lot of room for improvement. I also notice that our other co-workers are also having a bit of a hard time but it seems they already developed some sort of adaptation to communicate with him.
So yeah, there's my rant, and I'd love to know everyone's input on this. -
Why is React.js so hard to learn for someone from a JAVA back end background? I'm constantly asking myself "so should I set param as string? or int? Array? so many methods that's returning html tags! what collects all and makes it appear at WHERE??"9
-
I've been reading about quantum computing in finance and other applications (fascinating read, althought really dense), but one question now won't stop bugging me.
Context:
1) Blockchain applications are based on NP-Hard asymmetric cryptographic problems, and how hard it is to solve such problems in a really short time.
2) So called "Web3.0" is based mostly on Blockchain applications, but would still need significant advances in order to be practical.
3) Affordable and practical cloud-based quantum computing is not so far in the future, and could be used to crack most NP-Hard problems in short (polynomial) time.
Thus, my question: Is Web3.0 obsolete before it even begun?
I mean, if quantum computing takes on fast enough, it could snuff out Blockchain applications by giving those a shelf life so short it wouldn't be worth to delevolp for it. It would be like announcing the iPhone 14 and the 15 on the same breath, saying the 15 is only a quarter away - why would anyone bother with the born-obsolete tech?5 -
Was about 13-14 years old, on my first laptop, a HP Pavilion G6. I had Ubuntu on it, and tried to write an iso to a USB with dd. Didn't work, so I forgot about it for up to maybe a week, and was playing Minecraft one day when my laptop froze and nothing was responding, so I did a hard reboot.
No operating systems found.
Many tears were shed that day.
Took me maybe 6 months to realize that the "botched" dd probably caused the wipe.
Still don't know why my computer was still running... If anyone thinks that the dd didn't cause it I'm curious what your theory is.4 -
!dev
I love donating anonymously. But sometimes, people just make it so hard to stay anonymous to donate! -_- I mean, if a thousand people are donating for you, its not like, you gonna go to each and everyone's house and thank them. Its not like after 1 year, you're gonna be able to remember at least half of their names. So why bother? If someone wanted to be public about their donation, they would do that even if you don't call him and ask, "Who are you? Why you are helping me?"
I'm helping you because I can and I want to. Helping others is something that makes me happy. But I wanna be anonymous!
I want to be the devilest person on the outside but I also wanna be the softest person on the inside. So, let me be it!2 -
!rant
If any of you were wondering why all the panic when we keep hearing reports of so few people personally knowing anyone with covid19 symptoms, I think I just figured out why.
So as of yesterday, assume unofficially fatality is 15%. Yesterdays death total was 3861.
If we assume roughly 15% death rate, based on ten days average for a case to recover or die, then the cases that would be recovering today on april 1st would have been infected or started to show symptoms on march 22nd.
At that time there was 32882 cases total in the u.s.
Therefore for april 1st, that would mean by the end of the day today, if the ~15% fatality rate is accurate, there would be at least 4,932 fatalities logged today.
I don't know about you, but here it's almost 9am, not even halfway through the day, and we're already at 4067 deaths.
And now we get to the part where all this shit starts to make sense.
For a long time since this outbreak has started somethings been bugging me and I couldn't place what it was till now.
Why did it seem, no matter how high the numbers climbed, no matter how much this spread 'like the flu', no matter how hard I looked into it, very few people seemed to personally know anyone *in real life* who died or at least came down with this?
I mean we'd all heard the rumors that it was more lethal, and then mums the word, it seemed like media the world over simply except the official "it's only 2% lethal" line. Same as the line about it only infecting people of asian descent.
And it didn't make sense to me why the numbers were so high, and why all the panic if it's just the flu? I knew in the back of my mind it wasn't I just didn't have a specific reason why.
Here it is: This thing is still pretty contagious, but not as contagious as it *could* be with a lower fatality rate. And with a fatality rate at 15%, combine with *just sufficient* spread, it would continue to burn and fester in communities for a year or more until those panic-numbers we see on the news would become a real thing. And then no matter HOW flat we made the curve, it would be x5-x50 times worse than a bad flu.
So we get panic and fake numbers. Because you really don't want to catch this thing. It kills 1 in 6.6. And it spread just enough that it is hard to effectively fight.8 -
CSS (and all of frontend) is hard. The last few braincells left in me are slowly dying.
I just wanted a progress bar. HTML 5 supports <progress> out of the box. But all browsers want to act differently. Add more boilerplate for each browser type. Somehow got a transparent background on progress bar but it still won't let me change progress color.(Surprisingly, only IE let me change the color) At last, settled with a transparent div with a colored span inside, + js to handle value. Was this really the best way? Nope. But this was the only thing that worked,(other than importing a JS library, which would render a SVG to replicate a progressbar)
Why is front end so convoluted? Half of the things do not even make sense to me. Is this really the direction we want to go in the future?9 -
WHAT THE FUCK! why is it so fucking hard to add a startup script in Fedora 15. ARE YOU FUCKING NUTS?7
-
Ugh, making a game engine (It's more like a framework than an engine but idgaf) and it's all based around easy to make content and everything is built using 'mods' hence its name, The Mod Engine but I've been trying to come up with a logo for the engine... Why is it so fucking hard trying to make a logo!
Anyone have any suggestions? :-/1 -
Why are devs at google making it hard for android developers? They release libraries so frequently and completely overhaul everything. It was fine till a limit. Now again they are releasing jetpack compose which is a completely new thing. I don't have problem learning new things but the rate at which they release new stuff is far swift than other frameworks. For example they release a new dependency injection hilt while recruiters still look for dagger 2. Android is just getting overwhelming. What are your thoughts?5
-
Why does it have to be so incredibly hard to get an nvidia card to work under Linux? The driver is in available, we have the technology but every time I try to get this damned thing to work I end up in front of a fucked XServer and this stupid "Something went wrong" gdm screen only to apt-purge nvidia from my drive and start from the beginning once more.5
-
Joined a startup, pretty happy with the company over-all so far truthfully. Secured a large project yesterday with higher billables so job security wise things are good. However... The project I've been working on is a mix of a Spring boot webapp and a game. Two separate applications that interact with each other.
Two teams. A home team, and an away team, plus.... 2 "AI's" to play against... Well.... whoever designed this "AI" designed it so they can only ever play as the away team. Why... every function, every method, every bit of logic is coded around what "Half" of the inning it is.... Now I had the bright idea of picking up the hardest task on the ticket list, of making these AI's be able to play as the home team.
WHAT A TASK, and to make things worse. Instead of using some kind of proper inheritance with actual structure, we have TWO COPY AND PASTED AIs where the other has more hard-coded team sided logic that needs to ALSO be adapted.
17 points my ass.
I do love my job though.4 -
During my small tenure as the lead mobile developer for a logistics company I had to manage my stacks between native Android applications in Java and native apps in IOS.
Back then, swift was barely coming into version 3 and as such the transition was not trustworthy enough for me to discard Obj C. So I went with Obj C and kept my knowledge of Swift in the back. It was not difficult since I had always liked Obj C for some reason. The language was what made me click with pointers and understand them well enough to feel more comfortable with C as it was a strict superset from said language. It was enjoyable really and making apps for IOS made me appreciate the ecosystem that much better and realize the level of dedication that the engineering team at Apple used for their compilation protocols. It was my first exposure to ARC(Automatic Reference Counting) as a "form" of garbage collection per se. The tooling in particular was nice, normally with xcode you have a 50/50 chance of it being great or shit. For me it was a mixture of both really, but the number of crashes or unexpected behavior was FAR lesser than what I had in Android back when we still used eclipse and even when we started to use Android Studio.
Developing IOS apps was also what made me see why IOS apps have that distinctive shine and why their phones required less memory(RAM). It was a pleasant experience.
The whole ordeal also left me with a bad taste for Android development. Don't get me wrong, I love my Android phones. But I firmly believe that unless you pay top dollar for an android manufacturer such as Samsung, motorla or lg then you will have lag galore. And man.....everyone that would try to prove me wrong always had to make excuses later on(no, your $200_$300 dllr android device just didn't cut it my dude)
It really sucks sometimes for Android development. I want to know what Google got so wrong that they made the decisions they made in order to make people design other tools such as React Native, Cordova, Ionic, phonegapp, titanium, xamarin(which is shit imo) codename one and many others. With IOS i never considered going for something different than Native since the API just seemed so well designed and far superior to me from an architectural point of view.
Fast forward to 2018(almost 2019) adn Google had talks about flutter for a while and how they make it seem that they are fixing how they want people to design apps.
You see. I firmly believe that tech stacks work in 2 ways:
1 people love a stack so much they start to develop cool ADDITIONS to it(see the awesomeios repo) to expand on the standard libraries
2 people start to FIX a stack because the implementation is broken, lacking in functionality, hard to use by itself: see okhttp, legit all the Square libs, butterknife etc etc etc and etc
From this I can conclude 2 things: people love developing for IOS because the ecosystem is nice and dev friendly, and people like to develop for Android in spite of how Google manages their API. Seriously Android is a great OS and having apps that work awesomely in spite of how hard it is to create applications for said platform just shows a level of love and dedication that is unmatched.
This is why I find it hard, and even mean to call out on one product over the other. Despite the morals behind the 2 leading companies inferred from my post, the develpers are what makes the situation better or worse.
So just fuck it and develop and use for what you want.
Honorific mention to PHP and the php developer community which is a mixture of fixing and adding in spite of the ammount of hatred that such coolness gets from a lot of peeps :P
Oh and I got a couple of mobile contracts in the way, this is why I made this post.
And I still hate developing for Android even though I love Java.3 -
Background: I am working on task x. On successful completion of task x, task y may be given to me. Task x is haaaaaard. My group is not the only player and any fuck up will break my group and at least two others. Now here is my story:
Me: Yeah I am doing this hard thing and that hard thing and getting ready for these hard meetings.
FormerCoWorker fcw (): wow that sounds hard.
CurrentCoWorker ccw (): yeah he's working on task x and task you.
Me me (): what? No I'm not. I am working on task x. Don't go randomly assigning me tasks like that.
ccw: well if you finish task x you will be an expert in section z of code. So it is only natural you take on task you.
me: yeah but task x sucks and task y is why several engineers have quit the company. You never know. You could be assigned task y and quit. Why do I have to take on task y and quit?
NGL, I will do it of they promote me. I may be a whore, but I am gonna get paid. -
We are a remote team of two android developers for this startup. I have 3 years of experience and my protege has 1 year of experience.
One month a new guy with 10 years experience joined our team and hes working onsite. He's supposed to be scrum master and be good ad dividing and delegating tasks, but what he's doing past two weeks is appaling to me.
Basically we got a request for a new feature. He skipped discovery and planning steps, went straight to implementation and one week later showed us his implementation.
Note that at that moment my remote team was not informed about anything. He started reinventing a library to capture a picture and video, while there are tons of other well developed libraries out there.
What makes things more difficult is that his english sucks.
I don't understand what he's doing but now it seems that either he's playing office politics and is trying to stay ahead by not informing us so we would be forced to follow his implementation. Or maybe he is totally oblivious and don't have any sprint management experience, so he's just trying his best by working hard and trying to prove his own worth.
Eitherway it sucks that he is not able to communicate specifications from HQ to us, because even I did a better work with planning our sprints by communicating remotely.
So now I started asking him questions and turns out the guy doesn't even understand specification. He already half implemented the feature and can't tell us why we need it and why we are not using what we already have in the app. So now he's back to square one: doing discovery. It's fcking ridiculous.1 -
OMF you motherfucking Eclipse developers. All I want is to build an application with SWT. WHY THE FUCKING FUCK is that near impossible.
1) why are there no SWT maven artifacts= only 3 year old ones on a custom github repo?
2) why is is fucking rocket science to even find a guide on how to build this fucking piece of shit yourself
3) WHY THE FRIGGIN FUCKING FUCK OF FUCKS is it so hard to build it your self - outdated docs .... nice, dead links and repos, nicer .... referenced maven artifacts from a non-existing, none-documented repo, ... wow you're really kickin it here.
All I want is to fix this nullpointer in this fucking piece of shit you call framework ...
Have you actually tried to read your docs (can we really call that shit docs?) from a none-100years-swt dev's point of view?
Noone understands shit!
Why is there no standard build system, like maven, grade or for fuck's sake even ant?
It almost feels if you devs don't want anyone use your abomination, so it can die in peace.
Arg, I could puke ...5 -
After couiple of hours (Yes, apprently it's insane how hard is to add a new NIC to a linux machine and make it start on boot), I finally got my connexion working !
Story :
Server has original MB 1Gbits card. Internet connexion is 1.1 Gbps. So 1Gb card only picked at 940 Mbits download
I bought a 2.5 Gb card (new nic)
Pluged it in : Nothing
Couple of ifconfig -a etc, bring device UP : Yeah working !
Reboot : Nothing
/etc/interfaces : nothing
And why it's not eth0 and eth1 etc as before but some thing cryptic like enp3s0.
Well, at least now everything working (Apperently there is a new "network plan" config file in yaml... what a waste, DO FUCKING JSON YOU RETARDS)
Ping is awsome tho ! Same cable on windows Machine, I get 5 ms.4 -
I've been using go for two days and I'm already pissed at it. Don't get me wrong, I like the language itself, I love the simplicity, the tooling and frameworks are the problem. Like, why does everything have to be so hard?
Why do I have to spend around 4 hours in total just to configure a fucking linter?
Why does everything have to live inside the fucking GOPATH?
Why the fuck can't I put a src/ folder in my project so I don't mix code with config files, docker files, etc?
Why the hell does documentation for frameworks/libraries/tools suck so much? Looking at you Gin and Gorm.
Why can't gin-swagger just find out what routes I have?
I must be either dumb or chosen the wrong frameworks and libraries, but the "development experience" I'm having sucks. Nothing works first try and documentation is shit and vague.
I want to like the language, but I can't, at least not if it's always going to be shit like this. Does it get better? Am I just a noob? Or should I just jump ship and look for something else?4 -
I don't know maybe it's me. I'm sure that at booking.com they have hundred of GUI/UX/UI experts, product owners, A/B testing and whatever.
So, please, can you explain to me in a professional and scientific why, why the fuck, when I search for an hotel in a place for a date, by default, they show me UNAVAILABLE properties?
Like, "hey sorry, there was this great hotel, right in the center and very cheap, but you missed it!! hahahaha, you poor moron"
And every time I have to ACTIVATE the fucking filter myself "only show available properties".
Excuse me? Who want to see in first position the hotels that are NOT available?
Are there some users out there who wants that? If I were hired at booking.com as Product Owner or UX/UI expert, I think the first thing I'll propose is to quit the fucking filter whatsoever or at least to enable it by design.
So why is that? you want to show off? slap me in the face, with your hard cock-list of hotels you have anyway, but not for me?4 -
Why is it so hard to find a way to make nice frontend on Visual Prolog. I trully hate interfaces that looks like Windows vista.1
-
Why the fuck is it so hard to write a simple bash script. Syntax so strange and so many symbols you need to know. If you need to do calculations with floating point numbers, the mess is perfect.11
-
So after 5 days of trying to figure out why the fuck nemID (danish online id) is a piece of shit and doesn't want to show the pdfs I'm sending, so that they can be fucking signed, I've finally found a way to produce pdfs that it doesn't choke the fuck out on.
Just fucking open the fucking pdf in fucking Acrobat and fucking print it to a fucking pdf using fucking Microdick print to pdf... TWICE! WTAF?
So guess what I'll be creating an API for today...
Also fucking give me a proper error code when your shit doesn't work! Why the fuck are you sending me an error code stating that the checksum doesn't match, when 1) I didn't fucking send you one in the first place and 2) it doesn't work because you fucks didn't implement the entire fucking pdf spec! So when my fucking pdf contains some fucking pdf-element that you decided was to hard to implement a web view for, tell me that!1 -
Can someone tell me why the fuck is it so hard to choose where to install electron apps? Selecting installation directory is a default feature in pretty much anything installable. Is electron somehow above that? Is clicking the two a extra buttons to choose a second drive too mainstream nowdays? What? Why? I use Atom, VS code, postman, cycligent, boostnote among others . The idea is good, the apps look beautiful and responsive. But bloated as fuck. Atom alone takes 1.4Gb! And I am ok with it! Really I am! But why the fuck not let me install it in a drive where I have 70% of space free and instead make me use my crammed SSD? Why? WHY?1
-
Fuck virtual network networking holy shit why is it so hard to just setup simple architecture that took me 2 hours fuck fuck fuck fuck fuck i need a hard scotch
But so satisfying now that i understand it.1 -
Tldr; Rust community could definitely be way less annoying, but it's way more annoying listening to everyone bitch about it all the fucking time.
rant()
Tired of the Rust hype? Too fucking bad. Quit complaining that people like well-designed languages more than shitty ones. Yeah, rust devs can be real fucking zealous, but at least the language is good. If you don't like listening to people say "why not rust?" ignore them or ask yourself the same fucking question ahead of time so you don't feel defensive when someone asks it later.
Read some shit about how "it doesn't matter what you build it with if the software is good, its all the same". Ever heard of "right tool for the right job"? Rust has applications all over the place, so people are going to talk about it a lot. Also, just no. Like, Python shouldn't be in the Linux kernel for a lot of reasons, so the tools you choose can constrain whether or not your software is actually "good."
Ever heard of "unsubstantiated trust"? Yeah, you might be good at writing C, but you can get that shit to compile with nasty fucking problems and C's a straight up foot gun in my hands. It's hard to write shitty functioning Rust that does what you say it does, which is less unsubstantiated trust.2 -
Update:
I've been trying to leave DoD for a couple of months now. Translating my 10 year's experience with complex Intelligence enterprise level systems to something relatable to the civilian IT world. Grabbed a few certs to help out A+, network+ and security+ with Linux+ as my next target. Photos of me working on unclassified systems, radios, cell towers and servers. I'm a teacher for military UAS so this shouldn't be to hard to get even a basic job in IT right.
No one will hire...
Linux admin: Nope
Network admin: Nope
Assistant Network admin: Nope
IT call service: Nope
Pool cleaner fucking nope
Many interviews and nothing
I'm broke and sold all of my personal valuables. I can't hold out much longer and really looking at becoming homeless. But I'm kinda ok with it, one last payment on my apartment and car is all I can do now. My parents think I'm in Afghanistan working a six figure job lol
DoD: we see you're trying to leave we'll pay you alot to teach A+, Network+ and Security+ traveling all across the country and staying at hotels with all expenses paid.
FU FU FU I want out please tell me someone has a job, I'll be a janitor of a server room Idc I just want out. Fuck the pay
I start Tuesday...4 -
So I got the new macbook pro 15 with touchbar .... this is my first macbook that I have ‚issues‘ with.
* the new butterfly keaboard doesnt feel as good as the old one
* ... abd its friggin loud!
* the keyboard backlight just randomly drops out and forces me to cold reboot WTF??
* they bigger left/right cursor buttons make it so hard to feel where you are, that I constantly confuse up and down
* the touchbar is basically unusable for a keyboard centric person like me. It forces me too look down to the keys!
* I constantly hit the esc bc im used to have one finger there to hit it if needed, but now im forced to hover it bc otherwise it is pressed
* and why of fucking why did apple remove magsafe??? Now i dont even see anymore if is is being charged without turning the screen on
* i hate the usb ports too, why not even add a free usbc to usba port? (Well, i guess bc it would make the macbook even more expensive... free wouldnt be free anyway i guess)
It is way more powerful though, but the time i would buy a personal one is over and will probably never come back.
Im a happy hackintosh user btw 😅3 -
You people ever heard of the BeamNG game? The detailed vehicle physics simulation...
The question that has been bothering me lately is: why the hell are BeamNG videos so addictive 🤔 I get those videos sometimes in my YouTube feed; and once I start watching those, I usually cannot stop.
Like, the car with parts stripped from it over time. Or the truck carrying an ever-increasing number of rocks uphill. And the crashes, of course
But the question is: what do I find so fascinating about those videos? Why is it so hard to stop? On the surface, it is nothing special. Just some silly experiments involving vehicle physics
Weird; so weird... ☁️2 -
Why oh why it's so fucking hard to update perl on gentoo!?
It just shows how broken portage as become.
And everyone seems to have it's own magic incantation of emerge/qlist
Fucking fuck piece of shit gentoo is becoming2 -
I try to log in via SSH to a remote server. In the beginning all is well. It asks for my password, so I enter the password. Next thing: connection closed by the remote server.
So I wonder what the problem might be... I guess that perhaps I forgot to specify the username. Indeed when I try the 2nd time with my user name added in front of the host name - it works just fine.
But why is there no error message? Why not tell the user what's wrong? "User name is required". Can't be that hard?
Sometimes I see stuff and it just blows my mind why on Earth some things function so poorly. SSH exists for dozens of years yet the error message is not there -> it's guessing time.11 -
Why must pixel perfect scaling be so fucking hard... It all works perfectly but I'm limited to a max of 540p for the games camera view but as soon as you drop your resolution bellow 1080p you get stuck with 300p or lower... Ughhhhhhhh
Why did I choose to do pixel art... Wonder if converting everything to vectors would help, wonder is smashing my head into a fucking wall would help... -
Today marks the second day of me having to build an email template and I never hated anything more in my life than that. WHY DOES IT HAVE TO BE SO COMPLICATED? WHY CAN'T THEY UPGRADE THEIR STUPID RENDERING ENGINES SO WE CAN USE MORE MODERN METHODS?!? Sorry but I don't want to create an E-Mail and having to pretend its 1995. The table view is so outdated and I'm aware of the fact that some clients support divs but not Outlook (Outlook itself sucks pretty hard but thats another story). I just wanna be able to use grid, flex, etc. to build my template.
I HATE MY LIFE5 -
So I have this habit of copying all my family pics and kids videos onto portable hard disks. Have a 500GB Western Digital since 2012 and another WD 1TB since 2016.
Had one portable HDD failure before that back in 2010, but that contained only old projects code {when I didn't know git} .
So any advice you guys have for me on managing backups of these life memories? I mean I don't trust cloud storage - Google Drive, DropBox etc. And don't want any 3rd party poking into my stuff. That's why these items go straight from Camera to HDD.
What should I do to prepare for another failure? And is there any kind of RAID available in the form of portable solution?
Is it a good idea to change HDD every 5 years or so?10 -
Why is it so hard for some programmers to gain the maximum performance and not to waste any resources?4
-
Bloody fucking Android! Updates, updates and more updates! My development Nexus 5X won't allow me to sideload apps since it updated... Hello, printf debugging! Goodbye, profiler and debugger!
My hate for Android grows with each version after 4.0.$something... 2 was shit, I missed 3, 4 was OK, and since then it's going steeply down.
And don't get me started on Material Design...! Good luck figuring out what's a button and what's a label...
And what's up with the "let's keep all apps running all the time to save a few ms on start" philosophy!? Who thought that is a good idea!? Yeah, System.exit(0) works, but... Is it so hard to determine when it's not needed anymore (has no services running etc.)? Why should a web browser (for example) stay in memory after I quit? Minimize is a thing (Home button), why make it so confusing?
Another thing - feedback-less async tasks - why? I like to know when it is working in the background... How the hell am I supposed to find out if it is supposed to do this or if it is frozen?
And Android deciding to kill your process whenever it pleases without any callback... Happened to me once with an Activity in the foreground (no exceptions anywhere in my app, it just quit). How do you do IO properly? It seems you can't guarantee some file or socket or something that must be closed doesn't stay open (requiring to restart Bluetooth 'cause the socket wasn't closed, for example)...4 -
That feeling when you inherit a script to automate something that takes 10 seconds. Why would they even write this? It's not like the task is hard....
...
And why would they write it this way? I'm sure if I just move this part and ....
That feeling when you spend several hours improving and redesigning a perfectly functional script to automate a 10 second task for zero gain aside from cleaner code. "But the code for this quick-and-dirty script I'm never going to look at again looks so much better now!"
... If only it did a bunch of complicated parsing, regex matching, and error checking just so I can answer one less prompt.... Unless that parsing fails. Then it should still ask me for that prompt... And also validate that the answers I give are valid and correct....
That feeling when you spend a whole nother day starting from scratch to implement error checking and complex parsing logic knowing full well the original task takes 10 seconds to do manually and is needed at most twice a day (for a grand total of 20s a day)
WHY AM I LIKE THIS?!?!?!4 -
Remind me again why we have to use/support a weird entity creating framework across all microservices? So that every entity is consistent? (Who cares? Microservices shouldn't) Because hibernate is hard? (It isn't, and it's better documented than this, which needs hibernate anyway).
I'm just building a fragile distributed monolith. -
2 weeks ago I ask my coworker, who btw hates me and try to sabotage me every time he can, for a login for our brand new dev-system (webserver + dbserver).
I needed 8 days until he told me "no, work on the test envoiriment".
I escalated it to my boss, but he told me "no time, do as he says"...
Well okay.
So 3 days ago our bosses boss boss came to me and told us to do this very very important things - or we all will be in HUGE trouble and someone gets fired.
So I do it, I work as hard as I can, finished yesterday.
Today my coworker decides to play with the testsystem, because it is a testsystem, and boooom - accidentally kills a few databases and stuff for this very importent thing. Non recoverable.
And that is, guys, why you never work on testsystems.
He will get fired friday.
Karma5 -
I hate AWS ec2 instanced with it shitty handling of environment variables...Why in hell it is so hard to set an environment variable which will be re-set in case the instance will be restarted? For hours I'm fighting through manuals and non of the described procedures work2
-
<rant> Why is Apiary's editor so weak? It has no support for navigating from request to its code, it hides inheritance (so in the end you end up navigating source code via ctrl+f which is very cumbersome) and is buggy as hell. It randomly scrolls around, after awhile is laggy, syntax highlighting often breaks on a blank line with few spaces and so on... I wish so hard it would have had a plugin for IntelliJ IDEA with proper navigation and request preview. The web "editor" is just so clunky and generally bad :(.</rant>
-
Just bought a Chromebook Pixel. Love the hardware - Chromebooks in general are a great way to get a Linux laptop with guaranteed driver support.
But why is it still so hard to get decent HiDPI support in Linux (or for that matter Windows) desktop environments?
I realise Apple had an advantage in using vector-based Display Postscript, but massively divergent screen sizes and resolutions have been around for YEARS now, so why is it still such a faff?1 -
So i tried getting some games i play on windows to work with wine and steam.
After swearing and installing all the shitty dependencies it doesnt feel any good. And worst of all i knew not all games are going to work though.
As i wanted a good and portable setup i thought alright maybe this is going to be a good use case for docker. But its a pure nightmare to get everything running fine. At the end i gave up that shit.
So dual boot is still the only way for me to be able to play games without hacks and an unreasonable amount of work.
Using gpu passthrough to kvm is a pure nightmare too. I mean what the hack, the best way to use it is to have two fcking video cards?! And yeah the integrated intel shit graphics are no option.
I mean why the fuck is it even necessary to perform dirty hacks because the most game publishers dont give a fuck about linux.
Seriously it isnt that fucking hard! And Proton is a good step for some games, but only as a temporarily solution, that only exists because of shitty game publishers.
It is horrible, its 2020 and i still cant get fully independent from windows, no matter how hard i try.
Is it that fucking hard to add builds for linux to their shitty games?!14 -
So I've sent emails to a couple of people (some of which I found on devRant) that were offering work. Typed a small story about myself and why I'd love to take the work.
No reply whatsoever.
Like, I get it if you don't want me, completely understand that, but how hard is it to let me know that.
Like c'mon guys, don't be a dick.
Disclaimers: I got the email address right, they did not land in my spam or whatever since I did receive an email from them in an earlier part of the correspondence. I did give them (what is in my opinion) a reasonable time to respond. They also didn't die or something since they are still active here...2 -
why is it so hard to find an example of nesting some data in a table row that can expand with a click....2
-
So I have a xaml object that is designed for pagination on web pages, and the current page must be at least 1.
But the web service used for the data that go with that object starts its pagination at least at 0.
So everytime I must assure that the xaml object has 1 and the web service has 0 for the first page.
That's not hard, but that's the kind of thing that's annoying, why doing it that way -
I love watching how all these retards who were laughing from people who took the virus seriously from the start turn into the same ones they made fun of and thinking they are the smartest and best. Fucking proud of you all, thank you for doing such a service for all of humanity. Or people who think they "can't" get sick so they endanger the others. Why are people so stupid and they wake up only if it is already too late? Is it so fucking hard to stay at home? To not go skiing? To not be selfish and sit on your fucking arse at home? Fuck!1
-
So I’m tryina put together a resume and I see a lot of dev résumé talking about increased revenue from x to y or user base from z to w.
What I don’t understand is while yes the user base did increase from z to w it wasn’t just you that caused it. The entire company was working hard at it to get there so why are u claiming that it was you. And apparently recruiters love these kpis that u make out of your ass.
Should I give in and just put them in there anyway?
I worked in a startup so my job didn’t really have a definition of what to be told to do and do I had to deal with building front end with vue to figuring out how to automate our deployment flow and it’s really hard to quantify my performance like sure 3000 tickets solved but u don’t know what portion of them were full blown features what portion was just a one liner.2 -
Why is making a git UI so hard? I've tried many and they seem all suck in some ways. Newest is gitKraken, and with that you can't even trust that it pulls the latest version of the branch you are on.
So what I did was:
1. Open a repository
2. Press Pull button
3. gitKraken says pulled successfully, you already have the latest.
4. I wait 2min, then check the gitKraken again, and it says there's 4 new commits ahead of me. And trust me the person has pushed those long time ago.
I just wonder how can you screw that kind of basic operation in a git client? They must use some kind of internal cache layer there, that takes time to update that the user does not have the latest version yet.13 -
NodeJS and MongoDB. And tutorials.
Everywhere tutorials show simple example of console.log output of findOne. Good, that works... But when I try to extrapolate example to assign results to variable, it won't work. Inside that fetch anonymous function it works... But outside, simply undefined no matter what I try. Return doesn't return either...
Why it is so hard to make tutorials and examples that would be actually useful. I've spent hours with this already.
And on top of that it is really hard to find tutorials staying with minimum extra dependencies. Like most tutorials in this case throw mongoose in the soup. And I don't want that.
Sometimes makes me question why I try to learn these new things, when I have knowledge of other technologies that I could use faster and easier...3 -
Why is it so hard to find a low-profile 105-key mechanical keyboard with MX Clear switches and no RGB fuss that's delivered within the EU? 🙃1
-
Saw my colleague debugging. He's got a try-catch, then I asked, "Why aren't you logging the stack trace?". He answered, "I don't cause it will be a security risk". So there he was having a hard time debugging.🤯
Can you guys confirm if what he said is true?4 -
I've spent weeks trying to figure out how to set up Visual Shit 2017 with wxWidgets and still haven't figured it out. None of those settings I modified (project properties) worked at all. Months, probably, but just gave up at the end everytime. Nothing I tried worked, but the first time I tried setting it up for CodeLite on Ubuntu, it worked like a charm. All I wanted was to be able to develop cross-platform applications with wxWidgets, was it really that hard? I haven't even thought about cross-compilation from Ubuntu for Windows yet, the very though fills me with dread.
Why the fuck is it so hard to develop something so simple using Windows?1 -
Why can we deprecate a regular language like Python 2 (26 months can't come by fast enough) but yet it seems web development is impervious to the idea? If you want to make a website, you must use HTML, CSS, AND JS (or a transpiled language).
I get we use it for backwards compatibility but this combo makes web development so messy and weird, it's hard to understand from a newcomers perspective.
Maybe I'm just too stubborn to understand 🤔3 -
Why is Drupal counter intuitive and unwelcoming! Why make it hard for new comers!
If you are looking for a feature, you have to code it anyway. So much code under the hood but you always end up using contributed modules or create your own. fck fck fck. So many buggy modules.
fck fck fck1 -
Okay, can anyone explain to me why this is the third time in a row that I have to re-disable "fast startup" after a windows-update?
I know, some of you might think that windows sucks, and I agree, to some extent, but I still want to be able to play my games there.
So, is there any rational explanation for the fact that windows seems to suffer from some kind of amnesia when it comes to settings? I don't believe it was either bad intent or complete incompetence from the developers...
Is it a certain design decision? Or is is that hard to implement "persistent" settings storage?3 -
Why is it that nobody can seem to figure out you need a god forsaken "cause" field of type Error in your Error class
How is this so fucking hard to understand for language makers3 -
Yes but you see this function everywhere so why is it so hard for us to implement?
Next time i’m gonna say that this function is everywhere, but why is it so difficult to design? -
Me: I hate our current graphing frontend, its super hard to do anything more complex in here and it looks like it was made in the last century, we need a more modern solution!
Also me: Uuuugh, this modern graphing frontend lags my browser soooo much!
Why is dealing with graphs so hard? D:1 -
Having some issues with my laptop seizing up in graphical linux desktop environments, probably due to some peripheral power management. I saw there was a bios setting for "make linux work" but I couldn't find mention of it in the manual (why is this usually so hard to find, anyway?), so I googled a bit before I messed with it.
https://forums.lenovo.com/t5/...
Worst case I guess I'd just reset the bios, but it always blows my mind seeing issues like these go seemingly unaddressed. That's a 12 page discussion from 2018 where you brick your laptop - a fairly high end one at that - by flipping a bool and the latest response is "Same issue here".
Is it just PR practice to not acknowledge these things or is it likely that they are legitimately unaware? Does it not get escalated properly or do they reckon there's not enough benefit to address it?
Whatever the case, my faith in Lenovo is certainly starting to show cracks. I used to see it as the "correct" laptop brand, but nowadays I'm equally iffy about all of them.3 -
I just submitted "a lower price found" on GrubHub for an order I just made. Haven't gotten back to me yet but apparently if they agree, they'll give a $15 credit.
I think other services have this gaurantee too... So wondering...
How hard is it to write an app coloring menu prices between all these services...
Could get a lot of credits... And why haven't they done it themselves.
I'm not really up for the task at the moment but basically you just generate a table with all the prices from each service and highlight the ones that are different...
Then profit!!!6 -
Why are apple so fucking back assward and stubborn when it comes to their app review process?
So, at work I made an app. It's a simple one, but it's an app.
It makes it so that the user doesn't have to enter their credentials to sign in to a system developed on our platform.
If you give it a hard oded config it will only connect to that server, if not, it fetches a list of available servers and the user has to select which they want to connect to.
I've uploaded basically the same fucking app thrice, twice with and once without a config.
Two of them when somewhat smoothly through the review, but the last one has been stuck for almost two fucking months! And guess what it's one of the ones with a config!?!
How is that in any way consistent?
They fill us with shit like "your screenshots aren't representative", so I update them.
They go "this is not an AP for the public", I tell them I give less than a steaming pile of fresh dung from a retarded donkey, the intended users are freelancers, so just fucking greenlight it.
Then they go "your screenshots aren't representative", so I tell them to pound sand or specify which screenshot is wrong or what they think is missing.
How are they so fucking inconsistent with their process? Isn't is this process that they used as of defence for their shittastic monopoly, that they don't want to call a monopoly?
I'm so fucking tired.5 -
Alright, I found the root of the issue from my last project post.
It’s the damn MEM indicator.
In my project, I want to be able to load presets from an SD card in order to let the user switch from preset values to values determined and calculated from a potentiometer.
So it’s pretty hard to discern when you’re using the memory and when you aren’t without some kind of indication.
Every fucking time I try to put on that indicator (a red “MEM” at the bottom of the screen) it completely fucks the entire display.
I HAVE NO IDEA WHY!!!
Might be possible that there is a VRAM space issue... idk.
Will probably use a LED for indication instead. -
So I love what Apple is doing with the new Macs, great hardware, streamlined optimization, blistering performance.....great stuff.
But here's the thing. I think I'm gonna get a ThinkPad and just install fedora on it. It's far cheaper and outside of only going up to 16GB of ram it meets all my needs.
But between you and I a big factor in why I'm finding it hard to go Mac is the system settings. Like why is it like that? Why when I click something a separate window opens.....odd.6 -
Sigh millions fail
Millions make up bad ideas
Millions more commit crimes
Millions more squabble and weaponize laws to steal the lives of others unsuspecting and innocent or evil
Millions fail at everything
And stress is overwhelming
If we wrote software like this country works random servers would turn off
Coding teams would give up
Make code that didn’t do anything
Redirect requests from one service to another service randomly
And turn off peoples comps
Not to mention set server rooms on fire
Why is it so hard to fix the basis of
Our society so we don’t have to view the same failed commercials with some hyper method yelling about “you want to learn to code !”
And all this other regard shit -
Laravel docker ports configuration sucks. There is no fucking documentation in fucking laravel docs how how to fucking configure ports. I have set wrong port, wrong host with my docker setup and it was just giving fucking stupid error where lot of stackoverflow solutions do not help. FInnaly I found the solution here https://stackoverflow.com/questions...
which finally helped. So the host needed to set to the mysql instead of fucking localhost - I had found this in another SO answer but it was not enough. How the fuck can I know. Why it is not written in documentation. https://laravel.com/docs/8.x/...
And then port - it was needed 3306 - how the fuck could I know that I need it instead of 3000 which I have set in docker setup? Wtf.
Finnally when I made query "laravel docker what mysql port to use"
then I found this stackoverflow answer. Why need to make things so hard? -
Typescript is so fucking frustrating sometimes to deal with
The snippet above AND below do the EXACT SAME FUCKING THING. But because you double tap, it loses the fucking (not needed) type before the mapTo. If you aren't paying attention, you get this extremely fucking aggravating wall of red.
God damn it, can't this be better? RxJS is pretty fucking important, so why is this so god damned hard to just get some coherent fucking code highlighting!?
/rantover4 -
i am back after a struck of some shit virus. our team has been created and will be executeing our first mods will be consist of apk editor, xml, quickedit, possibly game guardian / block launcher scripts i know getting people to watch like and sub to your videos is hard but its worth a try.
Items-
QuickEdit + by rythum software used to corrupt data
apk editor used to dupe any app or modify it
probably used for our mod menus idk
for gg im not rooting my device so rip, i hope over clock sells his airpods so he can come back on his tablet. he litrally posted a video about why he wasnt on his tablet rip )= SPO team is not gonna bust.13 -
Why is it hard to improve privacy on IM?
I am improving again my online privacy these days. I was not using Twitter anymore for a few years, so I created a Mastodon account these days. I am still find interesting people over there, but it was quite simple.
But for IM, things get harder. What to use? XMPP? Matrix? Both appears to be good and bad sides. And it makes no sense I just install any of them and try to connect to random users. I actually need to make people I know to use the software as well.
Not only that, I will still need to keep other APPs on my phone, as they are necessary for some people. So I will still need a bunch of installed software. -
Why in the world wide web is it so hard to use JavaScript to dynamically create a custom web component element after the page has loaded!? I swear I must be missing something obvious. I know it isn't working because document.currentScript.ownerDocument is null and I use that to get the template and it works great if the elements are on the page already but it fails as soon as I try to use JS to create a new element of that component and I can't figure it out!
I could easily change the pages to be pre-rendered with data and it'd work fine but I plan on building in a service worker to cache the page skeleton and store the elements in IDB.
(This has been just a fun side project for me this week, until now it's turned into a frustrating project I spent most of my night on)1 -
Fuck xrdb and it's shitty documentation. Why is it so hard to setup pywal ? Why can't you put simple docs? Configuring anything sucks!1