Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "dont do it"
-
Boss: we need to make a website.
Dev: we fired the web dev
Boss: you do it then
Dev: I am a mobile dev
Boss: dont care you are a developer
Tbh he isnt wrong but i just hate web development.12 -
Phone rings
Uh oh
Answers the phone
Its my boss
>the latest tool you made isnt working
Um... Yes it is?
>we cant run it because its a jar file
Um..
>how to you run a jar file?
Um... You click on it?
>it doesnt work, nothing shows up
(Maybe if you fucking read my documentation, you would see that it just generates the files you need)
>there are no files
Yes there are we tested on every possible hardware, theres no way to fuck it up
>there are no files
Okay maybe you just dont see them on your desktop, move the jar to an empty folder
>how do i do that
*hangs up*26 -
Dev1 - hey we need to run some test to ensure delivery on our emails, how should we do it?
Dev2- I dunno, just put {RANDOMSTRING}@somedomain.com and send it. Dont bother to ask @Linux about it, it is a good idea
Dev1 - sounds like a great idea! I'll send a couple of thousands, ok?
--------- TODAY ---------
Me: Hey why are we on blacklist?14 -
Went to go help someone with their wireless printer.
Client: my printer doesnt work.
Me: okay let me take a look at it.. (took a look at it and saw the power core wasnt plug in)
So it seem like you forgot to plug in the powercord. Do you by any chance have it with you?
Client: well it said it was a wireless printer so i didnt think i would need it. I threw it away.
Me: well yeah wireless as in you dont need a usb core to connect it to your computer you can just do it through wifi.. but it needs a power source in order to turn on..
Client: well then why did it said that its a wireless printer if it needs a cord? Thats false advertisement.
Me: Sir the printer is a wireless printer but you cant get power wireless you need a power source in order to turn on the printer.
Client: you probably dont know what youre doing.
Me: *its okay hes only 79 years old*8 -
Here's a recent interview I had for an Android Developer job:
I: Interviewer, M: Me
I: hello, welcome
M: hi, thanks
I: do you know Kotlin?
M: yes, I've been working with it for 1.5 years and have written 3 projects in it
I: do you know RxJava, Dagger, Retrofit, and how to make Custom Views?
M: yes, I'm comfortable with them *explains*
I: do you know Room?
M: yes I do, I've done a lot of practices in it, but unfortunately have never needed to use it in production
I: what architecture do you use? Do you know MVP?
M: I'm currently using MVVM, but not MVP. I've debugged projects in it so I know what's going on in it
I: ok, do you have any questions for us?
M: how did I do?
I: I'm sorry sir, but you're not even a junior here
M: what? Why is that?
I: well you don't know Room and MVP?
M: I said I know them, just haven't used them in production.
I: well you have 3 years of experience but you dont even know Kotlin!
M: Kotlin was your first question and I said I have 3 projects in it. Did you even check the samples you asked for in the job posting?
I: SIR YOU'RE NOT A GOOD FIT FOR US, THANK YOU FOR COMING.
:/56 -
*meeting with boss about a quick site for one of her clients*
Boss- "okay so basically I just want you to copy the content from -already made site- and put it on the new one"
Me- "okay sure do you want it verbatim or "
Boss-"no but something similar"
Me-"okay so you want me to paraphrase this list that's on the homepage?"
Boss-"Well no we dont actually need the list at all as it isnt relevant to us so just take that out"
Me-"okay well that is the only thing on the homepage so what should I replace it with"
Boss-"I dont know, something similar to the list. You can figure something out"
Me-"....I dont know anything about the clients business. I am not going to just make up content, you guys can at least give me some direction there"
Boss-"i didnt think it would be that hard"
Me-"it's really not hard. You're making it harder than it needs to be for me though. Anyway, do you wanna keep the same exact pages as the other site or only transfer some of them or"
Boss-"something that resembles that website but isnt exactly it so some of the pages but not all"
Me-"which ones"
Boss-"the ones relevant to client's business"
Me-*closes notebook, stands up, starts to leave room*
Boss-"where are you going"
Me-"I'm going to get another two cups of coffee cause I didnt have enough this morning for this bullshit"
Boss-*raises eyebrow*
Me-"dont tell me to copy paste a website at first and then continue to tell me its going to be "similar" but different and then further continue to be as vague as possible about what is expected of me to be done in order to make it different! Take the time to decide what it is you want exactly and then tell me, with detail, what you're criteria is so I can do the thing!! I cant read your mind."
Boss-"..... I just didnt think it would be that hard to jot in a few sentences here and there"
I left the room at that point. Irritating as fuck. You dont know tech stuff, don't expect me to know enough about YOUR job to write about it as if I'm a professional. I cant fucking read minds, I have no interest in researching anything just to create the site content myself, and its fucking rude that they wont even take the time to sit down and decide what they want for a website that THEY are paying for. For fucks sake people get your fucking shit together13 -
Holy fucking shit.
Why do people always expect you to know absolutely everything the second they ask?!
PM: "Yes yes of course we can do that!!! We've done it a million times, we do it for breakfast HAHAHAHAHA"
ME: "Well not really, we've never implemented a solution like that one, its gonna take some time to figure it out"
PM: "HAAAAHAHAHA HE'S SOO FUNNYY LMAOFUDKSJ DONT WORRY WELL HAVE IT READY FOR TOMMORROW :P".
Holy fuuuck I understand you wanna make the sell but you need to give the costumer a realistic look at things, at least give a reasonable deadline for what he's asking! FFS ASK ME HOW COMPLICATED ARE THE THINGS HES ASKING FOR BEFORE TELLING HIM WHEN THEY'RE GONNA BE READY! MAKE A FUCKING ESTIMATE, WE'RE SUPPOSED TO BE A TEAM!
Oh and this rant is gonna happen, dont care if I get fired.This needs to change.3 -
One of our CEO: “we dont have the internet speed that we have paid for - I will check it out”
Developers: “please dont, remember last time?”
CEO: “the net will only be down for a couples of minuts”
Developers: “please dont touch anything, and do it after hours”
1 hour later we still dont have the internet restored.
FML!6 -
Client: Please fix the logo.
Me: Okay, what needs to be fixed exactly?
Client: Put this word next to that word(shows me an example).
Me: Okay, no problem.
*after 5 minutes*
Client: You did not do what I asked for. Please fix the logo. Make it look better. Make it bigger and more outstanding. Dont change my logo
Me: Okay, I will revert the changes.
*Reverts to the old logo, and only does that as I do not fucking know what to do with oudstanding for fucks sake*
Client: I will talk to your boss. No one cares. My web site is not even finished and no one cares.
*It is finished, now the client looks for small things to make a big issue of*
Me: Could you please tell me in detail, what do you need to be fixes?
Client: I want the wording better. Im going to talk to your boss...
well fuuuck fucking fuck Im pissing blood!!!!!!!!!8 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Dev: So how do you want this feature fixed?
Manager: It should work how it worked before.
Dev: I'm new to this feature, I don't know how it worked before or what is broken about it.
Manager: Well just make it work like it worked before.
Dev: I DONT KNOW HOW IT WORKED BEFORE THAT IS WHY I AM ASKING YOU. PLEASE TELL ME SO I CAN DO MY JOB.
Manager: Just how it worked before!
Dev: ...
Manager: ...
Dev: fuck you17 -
🤣🤣🤣
Somehow, my boss got his son, 19, working in a team of developers last week.
Son: i got ton of money and i dont need to do this. i inherit lot of properties from my dad.(trying to sound funny, superior, and boasting of his inheritance knowledge he might have learned in school during java class probably.)
A guy in the team: No you dont. You are like us.😎😎😎
Son: minds his own business now.
Damn that line made my day.
🤗👏👏👏👏
++ for this dude for insulting morons like this at work.
I may have to remove it on boss request if he see it. But for now hit as many ++ to show that idiot no body likes people like him.rant boss eat your money knowledge is power respect your senior morons at work worship the job i love my work workplace8 -
Do you also like the idea, if devRant would have patreon or paypal for donations?
++ the rant if you like the idea. Maybe @dfox and @trogus will consider it then 😄
Servers are not cheap and it would be great if the community would finance itself.
Sure devRant got a Store, but I live in Europe and ordering/shipping is not so cheap, we got huge taxes for it. And I dont wont to order a stressball or sticker every month.
Also every dev wishes for a beer 🍺 😜6 -
I really, really hate it when someone has a problem/question, and I really dedicate my heart and soul to write a really good answer that even a stupid person would understand - with drawing, explanations and shit. And they answer is just:
"Thanks"
"Ok"
"I dont get it"
"Can you please do it"
"you spelled that wrong"10 -
Client: We want a contact form on our site that accepts files.
Me: OK. Here are the backend options (custom built, WordPress, third-party service, etc).
C: Mmm... why is it so complicated? A simple form doesn't need a backend.
Me: FFUUUUU Y DONT YOU DO IT THEN! DIDN'T KNOW BROWSERS SEND EMAIL?!
Me: *backspace*, *backspace*, *backspace*
Me: Browsers cannot send emails; you need a backend to process the form.3 -
Oops, i bought a new one - I dont really know what i wanna do with it - but it was on sale so 😅
#4GB-RAM15 -
Recently i had to interview a guy with 10 years of frontend experience for a react developer role
Me : Do you know what ecmascript is ?
Him : Yes
Me : Which version would you prefer to use and why ?
Him : I dont use it. I am more comfortable with JavaScript.
Me : (totally confused) 😶
Him : (trying to be oversmart) I know you young guys prefer to use these fancy frameworks because you dont know how powerful raw javascript is.
Me : (Trying hard to not "react") Ok.
How would you "react" to this ?31 -
!rant
Yes! finally 4588 people got fed. I am targeting 10k of people. Get free food from my food bank. Previously people dont know where to get it , now they know it from my platform.
It is so satisfying to see people help the needy get food and groceries.
All of us can do this, as Malaysian government fuck themselves, the rest of us citizens can help each other...4 -
This is my first post. Had an exam in php, xampp wasnt working, assistant came and said i dont know to configure codeigniter, after 30mins of calling he came, tried and sad "well this isn't working". He then called administrator to reinstall xampp. I lost more than half of exam time. I didnt finish it in time, he said that i could do it in a less time by his opinion. It was full working php site with crud and customer view. When xampp started working i had 1h to do it all. After some time and arguing i got a a new date to do it. It is tommorow. Help me god hahhah.11
-
while we were in the car...
mom: so what are u doing in your new job? you code in java?
me: no, i code in javascript, html, css and php..
mom: so thats java. how nice.
me: no, its javaSCRIPT.
mom: theyre still the same.
me: java and javascript are not the same
mom: but most people use java so why dont u just do it in java?
me: thats what ive been asking myself too in the past few weeks, why did i even accept this job3 -
Based on a true story that happened right now.
Dad: "how do i download youtube videos?"
Me: "just google youtube downloader and download them from some site, thats how i do it"
Dad: "WHAT!!??? You want me to fucking google it? I dont know how to fucking google for those things, you're the IT guy and you should know how to do this, if I wanted to google it i wouldnt ask you for help. You know what, get the fuck out of my face i dont need ur help, get out"28 -
Pm: '[...] So when will you set up the server its urgent'
Me: 'look buddy i applied here as a java dev, ended up doing fronted. Fine, i like js, i can do that. But then dont fucking ping me daily with server stuff what has been overcomplicated and i got no idea about, theres a backend team, ask them.'
Pm: 'you said you would do the frontend'
Me: 'yeah that doesnt contradict a word i said'
Pm: 'you took responsibility, fix it'
Me: '?????? THATS WHAT IM SAYING YOU FUCKFACE COCKSUCKER ASSHOLE THAT I DIDNT AND I WONT, FUCK A HORSE'4 -
This week Im firing a guy who I hired 5 weeks ago. I cant take it anymore. I setted up a nice environment for him and he keeps taking whole day sometimes two or three to do a 2 hour task. He came from electrical engineering background and never had a software dev job. As a person hes more creative type not logical based type. I dont have nor patience nor resources nor time to teach him basics that be could google but simply doesnt have the mindset to do. Sorry bill gates not everyone can learn how to code, or at least not everyone should.
Advice to other people hiring new hires: test the shit out of them before hiring, dont hire from gut. This guy was giving out a nerd vibe, but the only nerd thing that he has is nerdy puns, other than that as a software dev he know less than I did when I was 12 years old.25 -
I'm 18, asking my granddad a basic question. It was in danish, translation may not be as funny.
Me: Do you have a phone with a screen you can press?
Granddad: Yes
Few moments later...
Granddad: But i dont know if anything happens when i press it.4 -
Dad: [this company] is coming to town soon.
Me: I know
Dad: yeah maybe you can get a IT job
Me: I dont do IT
Dad: You never know what you do until you do it.
Me: *getting an aneurism from sheer ignorance*
I DO IT EVERY DAY HOW WOULD I NOT KNOW WHAT IM DOING THAT I EVEN WENT TO SCHOOL FOR?17 -
So my classmate just decided to write "printf("Suck my balls I dont remember how to do this);" in a programming exam and forgot to delete it before handing it in.
Well... after saying "sorry" like a hundred times the teacher accepted his apology.8 -
Late to office due to traffic. Thought would do some work. I get this the second i switch on my laptop. I am so tired of it. I dont want to even rant about it.19
-
Teacher: "Will this SQL statement work LavaTheif?"
Me: "you need to put a 'WHERE id.."
T: "but will it work like this?"
Me: "well it wont do what you're trying to do, so it wont work properly"
T: "so will it work?"
Me: "no."
T: "wrong. It will work, but it will change everything in the database, which we dont want"
Thats what I was saying??
Also, he spent 50 mins out of our hour lesson explaining how to use SELECT, INSERT, UPDATE, and DELETE. I just wanted to get on with the work tbh.7 -
How devrant changes me #1:
I'm a little bit more active on devrant since about a week. Improvement so far:
1. I spent only 20% of the time on Facebook i usually do
2. I really enjoy the nice community
3. I even more enjoy that i notice there are more "dudes like me" :D i mean.. I'm tired of telling my "normal" friends how happy i am because i wrote some awesome code and just get a "eeeh.. Nice." back because they dont understand and often dont even try to understand whats so special for me.
4. Even if my english is still kinda bad, i notice that i get better with every rant i post. I mean.. That post cost me about 3 min. I swear 7 days ago it would have cost me minimum 7 minutes to get this lines down :)
Thanks devrant :)5 -
Man it's midnight and all I want to do is work. 5 hours from now I'll be dragging out of bed to go to work where nothing gets accomplished. In 17 hours when I drag in from work I can do real work for 7 hours before crashing while wishing I could just code through the night. It's an infinite loop and I dont know how to fix it!10
-
Oh you want my homework Solutions?
WELL NO! YOU WONT GET MY SOLUTIONS YOU PRICK! YOU ALWAYS TREAT ME LIKE A PIECE OF SHIT! I WONT GIVE IT TO YOU!!
AND I DONT FUCKING CARE ABOUT YOUR SHITTY GRADES! THEY ARENT MINE! AND YOU KNOW WHY?! BECAUSE I DO MY FUCKING HOMEWORK AND IT PISSES ME OFF TO ALWAYS GET REQUESTS FOR MY FUCKING SOLUTIONS! GET YOUR SHIT TOGETHER, PUT IT IN A BAG AND TAKE IT TO THE SHIT STORE!
WHY?!
BECAUSE I DONT CARE! THATS WHY! DO YOUR HOMEWORK!
AND MAKE GOOD GRADES!
BYE!!5 -
Our CEO/Boss thought up a new idea for an App
Boss: I got a new idea, i dont know what it is, but its very easy. How long you can do it?
Us: •.•3 -
devrant is not stackoverflow people. stop copying and pasting rants. It's likely we've seen it before. You're devs, use yo brains. #rant4rant #ctrlCctrlV1
-
😂😂😂
(I hope people dont find it offensive to post it here... Like if you do, let me know in the comments I'll delete the post in that case)8 -
I dont hate PHP, but I do hate when lazy admins do stupid things.
Why can't the PHP-maintainers do a proper website? Why the fuck can't I subscribe to mailing lists?
Well, it seems like when I do a request, the webserver sends a email with MY EMAIL. And guess what, the listserver REJECTS it because it fails DMARC.
They also refer to the manpage of ezman, but they have disable ALL the functions there too.
What kind of retards is doing that shit. I completely understand why people hate on PHP now.6 -
I was talking with a guy who is making an android app for his thesis but hes "shitdamn awful in java". I offered to help because im so fucking nice.
"oh but i dont have facebook, is it a problem?"
Nah sure i dont use facebook anyways, got telegram?
"No"
Riot? Irc?
"Nope"
Then what do you use???
"Skype"
?!!?!??!??!!???!??!7 -
FUCK SAFARI!!!!! I am developing our new company website and have a deadline tomorrow. It is built with flexbox WHICH SHOULD WORK EVERYWHERE BY NOW. The new website works FINALLY GREAT in all browsers now and then I just tested it in Safari (which I did not do before) on my mac and SO MANY THInGs doNT WORK! WHATTA FCUK?? I EVEN GOT EVERY THING TO WORK IN EDGE?? Is safari the new explorer?! What happened?!4
-
"Son ur always sitting at home at computer, ur a computer guy so how come u didnt buy one of those crypto coins and become rich with all that computer knowledge you have. I hear in news all the time how people get rich with crypto. If i had the computer knowledge like you do i would be rich a long time ago. Why dont u buy crypto and be rich from it? U study computers so it should be easy for u to do it"
- dad
my blood before: 🩸🩸🩸
my blood after: 🩸🔥🩸🌋🩸♨️🩸🔥🩸🌋🩸♨️🩸🔥🩸🔥🩸6 -
WHY THE FUCK! WHY THE FUCKING FUCK! DO I HAVE TO WAIT 3 FUCKING DAYS TO GET A FUCKING VIDEO RENDERED! i didnt buy a new fucking 2080TI for this! WHY THE FUCK DOES THE CPU RENDER THE FUCKING VIDEO!
I mean, we can do fucking REAL TIME RAY-TRACING! And yet, no fucking idiot came to the Idea, "hmm we could let the GPU its intended purpose and dont use the CPU that much." I MEAN, IT HAPPENED, BUT FUCK IT! FUCK ALL OF THIS! FUCKING 74 HOURS!! FOR AN HOUR CLIP!
(Its 4K tho)
Fuck.21 -
Boss coding.
Boss not fan of tests at all.
"Hey I'm doing all of tests" - boss to me.
"Cool, are they automated? Or do you want me to implement'em?" - me to him
[long speech about why tests are irrelevant including "...once I tested, it is tested, we dont need to have automated tests."] *im teaching you because you dont know voice*
Please, help meeee5 -
I just realize that companies dont value a good developer, they just want a developer that can do the job done for clients to get money, i understand that just recently and im sad that some people are just in it for the money not for the love of the craft and technology.8
-
I have not remotely had the energy to post here. Nor reply. And it is a shame because most of you I consider friends. And if not friends, at least excellent aquitances.
People make comments, I dont reply. People make threads, and I dont respond. People make ++s, and I'm a ghost.
I enjoyed shitposting, and asking questions, and hopefully entertaining some of you. I really do.
I'm just in a funk where nothing seems to matter right now and I dont know why, pr how to get out of it.
I have threads, and responses from scor, nanos, nachoscode, and a dozen others I usually enjoy interacting with and it's like all the life has just been sucked right out of me.
I feel isolated and alienated from everything and everyone and I dont know why or when it started. Its just..there. nor how to talk about it.
I think I'm becoming a misanthrope or something. The more I go on with this sensation, the less I want to be around people, and I dont understand why.15 -
DO NOT be afraid to argue with people. It doesnt matter who they are. Senior engineers, tech leads, delivery managers, if you know something is wrong make it heard. I made a point of telling my Project Manager that the current project is the worst ive ever seen. The technology is awful and we all hate the development. They need to know this stuff. And if they come to you with a deadline that you dont think you can make, say it then and there. Then they cant come back and say why isnt this done. Basically dont just do as youre told. If we needed that we would get robots to do our job. We need people who think and have opinions and make those opinions heard at the appropriate level.2
-
Am I the only one?
Do {
I want to know EVERY FUCKN SKILL A DEV CAN POSSIBLYHAVE, but I want to know it all NOW..
googling 30 times for tutorials and posts about a topic,
opening 30 tabs,
then spending around 30 seconds on each one ...
Trying 1-2 tutorials,
not understanding why I dont get this shit...
this is stupid
loosing interest in 3..2..1...
Aaand let's try and learn this new skill..
} while(true)
Welp5 -
I dont get people, who work in the IT business but does not have a genuine interest in it.
Everything they will do will be bad
They will not learn nice stuff
They will do stuff slowly
They ask stupid questions all the fucking time2 -
Why do a lot of people on this site get away with typos? I mean, we're supposed to be devs, typos kill us.. From 'postion' instead of 'position', i can do this all day.. i get it, the point is getting the thought across, and, by all means, the thought came across just fine.. it just irks the mind thinking its supposed to be a dev community yet, quite ironically, it is peppered with typos.. dont even wanna get started with the your/you're, the there/their/they're and the than/then.. i mean, how can you not know its proper usage? Is it really that hard? If you can't use it properly, then don't.. if you can't form a sentence without using it, consider not saying/posting and get back to school first..
Imagine an internet where one corner could at least be decent enough to be proficient in the simplest thing: using words..70 -
But what the FUCK VULTR!!!
It is the third time in two weeks that I actually have to reopen issues because your staff do not know how to troubleshoot correctly!
If there is routingproblems, please check from an external server and not from the same network!
I dont know, but Vultr has significantly lost the servicemind during this year...
Time for another host?7 -
school is TERRIBLY designed.
why the FUCK are our grades dependent on EFFORT and NOT KNOWLEDGE.
im sick and tired of kids who scribble on homework and fail tests but still get a's, while i ace tests but dont do any homework.
how long ago was it that school was about LEARNING. to gain knowledge. kids who dont SHOULD NOT GET GOOD GRADES.
fuck you🖕16 -
hey buddy mate pal friend bro nacho
IF YOU FINISH A TASK NOT ASSIGNED TO YOU THEN FUCKING ASSIGN IT TO YOURSELF SO WE DONT WAIT FOR SOMEONE TO DO WHAT YOUVE ALREADY DONE6 -
At the ranters who use Vim as their primary IDE. How do you manage to get some autocompletion working?
I want to be one of the cool kids and use Vim for coding but I am so used to a good autocompletion like the one IntelliJ offers.
I want to be able to browse through every method of an object or function of a module. But Vims build in engine sucks ass and YouCompleteMe doesnt seem to work that good either (only tested with Javascript, Typescript and Elm). They dont show all the correct identifiers but they do show some other random stuff.
How do you guys manage to be productive? How do you make it show only the usefull stuff?9 -
Me: We did [technical debt] and [next feature] is hard to implement because of it. I suggest we do [actual 5 min solution] before proceeding to implement [next feature].
Colleagues: Agreed
Team Lead: We don't have time for this I dont want to change anything because the way we did [technical debt] already works besides we can [more technical debt] code go brrrrrrrrrrrrrrrrrrrrrr3 -
teacher assigned me a task for a school project that i dont want do.
i thought "F*uck why i have to waste my time on this shit!?!"
luckily I just discovered that it just required 2 lines of C++ and 10 lines of js.😊1 -
Sooooooo since a few days im feeling more and more depressed.
There are some things that might cause it :
- school
-My last frienhship broke (not like i care about sociality. lol)
-my parents being so strict.
What can i do except for going through this, eyes shut?
I alceady had a depression i dont wanna get back there :/51 -
Le me...
*installs devRant*
wew, nice app, digs a bit here & there.
* jumps on the settings*
*sees JOIN THE DARK SIDE?*
*slides the slider and endsUp getting Join devRant SignUp page* :/
*thinking....*
may be there is some uncensored shit is going on a dark side of devRant.i dont want to miss it. :v
*creates an account*
*clicks on JOIN THE DARK SIDE? With over 9999999 excitement*
ends up getting the DarkTheme aka NightMode. ;___;
*cries in the corner*
*y you do dis*8 -
My boss (also a developer) walks in regularly to tell us how annoying it is when her boss is walking in when she is working on something.
So you keep us from working by doing the exact same thing you find annoying? Sometimes I dont mind but sometimes Im doing difficult things you asked me to do, dont get me from my work for something useless....1 -
Tried mx 17 linux today. Was completely blown away by how fucking good the system is. I am really tempted to nuke my windows installation in one of my computers and just run this baby from it. Nothing is really holding me back from it. I already have two other macs and another ubuntu laptop. Can think of a reason why i would need windows at this time but i am still hesitant.
Plus...i am taking on a big rails project.....might be good to have this thing set up for it as are the other two macs. Mmmmmhmm decissions decissions.
What do y'all think? Yes or nah?4 -
I got an interview with a big multinational software company as a senior dev - the kind of place I never thought I would be privileged or knowledgeable enough to work for and wasnt expecting to get In to...
I aced it. They gave me an offer but - FOR DEVOPS 😬
basically my skills fit in perfectly with the server/ scaling issues they have and are far more valuable there. I know they do, I also know I can fix the issue and will have alot of fun coding it - I just dont think I want to monitor it or anything else.
I mean I do devops stuff all the time in aid of anything I code but their stack is a full time job- im scared that once the toolchain is automated ill be pulled towards sys admin like duties and lose touch with my craft... what do you guys think? Anyone shifted from dev to devops?9 -
Fuck google cloud platform. My server has been down for last 4 days. Stupid reason google gives me is that it does not have resources available in my zone. Why the fuck do you start a hosting company if you cannot provide RAM and CPU. On top of that their support is so bad that after 20 emails, 4 chat tickets, 3 phone calls nobody knows the issue I am facing. They just give the links to their ultra stupid documentarion.
Now all my 6 projects are down. Clients are getting impatient. I cannot do any work and googles support is the worst.
They dont even want to understand the issue, dont know how they will solve it.
I have created AWS instance now and migrated to AWS. But i have old backups which are useless on AWS. To get the latest backups i need google cloud instance to get started but stupid google does not have resources. How hard it is to add 1 CPU and 1GB RAM?18 -
I present to you the rubber duck I use for debugging.
that's right I dont have one. I just to talk to myself really. but what's curious is that when I do this, I tend to cock my head to a side, or turn slightly in my chair as if I was talking to someone just behind me. I didnt realize I was doing this until my cousin pointed it out to me coz it was creeping her out.
let me also mention that I used to have an imaginary friend growing up. his name's Jesse. I dont know if it really is just a weird mannerism or maybe I was still subconsciously talking to him.3 -
i remember how my father was angry at me, that i "only play games" on the computer. Cause what else can you do there? We had multiple wars about how much nobody will i be. Well I wasn't playing I was learning. Now i have my own family, got many life goals done. i dont consider me as nobody but my father still thinks of me as a young boy, at least he's sometimes proud. Sorry guys gad to lay it off. :-)3
-
Customer: as soon as you get a proof of concept could you send it to me?
Me: sure *sends app to test* here is what it currently does and does not do.
Customer: thanks, here is a list of 59284 things that dont work or need changed.
No shit sherlock. It's not done, you wanted a very early version, and of the things you listed I already mentioned half of those.6 -
I contacted the creators of Nova Launcher because I want the full version. They have both an google play upgrade as an input code upgrade.
Since I dont have any google service anywhere I contacted them to ask how to get such a code because I dont have any google service. This was their reply:
"You would need to purchase the app via the Google Play Store, then once you have, email us a copy of the receipt and the email you used to purchase the app with, then we can give you a Direct License to use since you don't have Google Play Services."
How do I buy it if I dont have any fucking google service?17 -
So im in college right? I dont have a licence to drive yet so I wait for my ride after class. My friend usually waits for me but this time was different..
I went to his car with him while having our normal conversations, we get to his car he puts his stuff in the car..
then.. it happened.. (pretend this is italicized) he pulled out a fucking hacky sack. THEN WE JOKED ABOUT IT BUT ACTUALLY TRIED TO DO IT AND BOUNCE IT BETWEEN EACH OTHER LIKE ACTUAL COLLEGE STEREOTYPES
Im making too big a deal out of this but ive never actually played hacky sack and its most likely the highlight of my college career4 -
> Have nothing to do with programming
> Starts shitty coding bootcamp online, possibly for free
> Learns html/css/js course
> Builds to-do app (dont know how to deploy it with anything but github pages, but who cares)
> Takes a week to finish course
> Gets e-certificate and posts it on LinkedIn
> Adds web and front end dev as Professional Skill on LinkedIn
.
.
.
> Complains how bad the tech industry is for 'new entries and beginners'2 -
Imagine asking your friends to help you rate your app on the google play store and instead of saying NO I DONT WANT TO RATE YOUR APPLICATION no... they decide to fuck with your mind.
1)
I will rate it tomorrow. (she never rated it tomorrow nor the next couple of weeks later)
2)
I will keep it in mind and rate it later :). (she never rated it later)
3)
I rated it haha (less than 30 seconds later they deleted the rating)
4)
Send me a link and I'll rate it (i send the link, they never respond or read my message again)
5)
I dont have memory on my phone :) (because 13MB of memory is a lot of storage requirements but taking 1 million selfies of up to 25GB is completely fine)
6)
I dont have memory on my phone what dont you understand :) x2 (this is the second girl)
7)
Your trying to give me a virus?? No (i got blocked multiple times)
8)
You want to hack me by making me install this application from the link that you sent me that leads to google play store? No (blocked)
9)
Rate your app? Haha i dont care about it because it doesnt bring me any benefit only the fat cocks that fill my pussy up satisfy me and not ur app haha
10)
Haha send me a link ill rate it (i send link, 8 hours later no reply or reading my message, i text her back if she had done it and im still put on ignore)
...
N)
more
----
Notice how none of these people have said the 2 letter word: "no".
All of these 10 examples are based on a true story.
All of these 10 examples are different people.
---
How hard
Can it be
To just
Write
no
---
.
---
For all of you who are about to trash talk saying i am desperately trying to beg people to rate my app:
i know all of those people for a long time. But when it comes to asking (and not forcing) someone to do you a favor for free that takes no more than 30 seconds, no one seems to have 30 seconds of their free time. Dont get me wrong, some of my friends did politely rate it and left a review, even the people who i barely knew left a review and rated it, but the people with whom I was closer by, didnt.
---
In the beginning i used to not care about this at all. Then i started falling into depression because of it. I fell then into deep depression. Then i sunk so deep that i couldn't feel any emotions anymore so i laughed as an anti depressive mechanism whenever something depressing happened. Now i cant even laugh because i have no more energy. Now i actually leave man tears
---
The only thing more valuable than people, any materialistic thing, animals, coding and even money - is time....
----
why do you waste my time
if i ask you to do something that takes 30 seconds and you dont want to do it
why cant you just say no
why do you drag me
why do you say you're going to do it when you know you wont do it
what do you gain by unnecessarily lying to someone for such a small thing?
to someone who has been a good person to you?
do you feel superior?
is your ego bigger?
----
This experience has taught me that not even a human from the same blood can be trusted.
All of your are fucked up in the head in your own style and i am guilty of it too, all of us are.
But i have never seen the human evolution went from simplicity to overengineered complexitory bULLSHit where you have to lie to someone and waste hours, days, weeks, months and sometimes years of his time just because you dont want to say a 2 letter word, no.
But when that person becomes more successful than you and achieves higher status, Theen you have those 30 seconds of free time. All of you are fucking cynics. and i am so much overly disgusted by all of this fucking bullshit....
-----
This experience has proven to me to simply focus on investing into myself and learn and improve myself and no one else. To not even bother asking even for a small kind of help, a feedback from my work because people don't have 30 seconds of their free time. That is all.12 -
DONT do production stuff on friday afternoon. This friday evening we had an issue on production and just wanted to do a quick fix. The fix resulted in a ddos attack that we accidentally started on our servers in an IoT project. We contacted all customers' devices and asked them for response at the same time. Funny thing is that the devices are programmed to retry if a request fails until it is successful. We ended up with 4 hours downtime on production, servers were running again at 11pm.4
-
[See image]
This guy is wrong in so many ways.
"Windows/macOS is the best choice for the average user. Prove me wrong."
There are actually many Gnu/Linux based operating systems that's really easy to install and use. For example Debian/any Debian based OS.
There are avarage users that use a Gnu/Linux based operating system because guess what. They think its better and it is.
Lets do a little comparision shall we.
- - - - - Windows 10 - - Debian
Cost $139 Free
Spyware Yes. No
Freedom Limited. A lot
"[Windows] It's easy to set up, easy to use and has all the software you could possibly want. And it gets the job done. What more do you need? I don't see any reason for the average joe to use it. [Linux]"
Well as I said earlier, there are Gnu/Linux based operating systems thats easy to set up too.
And by "[Windows] has all the software you could possibly want." I guess you mean that you can download all software you could possibly want because having every single piece of software (even the ones you dont need or use) on your computer is extremely space inefficient.
"Linux is far from being mainstream, I doubt it's ever gonna happen, in fact"
Yes, Linux isn't mainstream but by the increasing number of people getting to know about Linux it eventually will be mainstream.
"[Linux is] Unusable for non-developers, non-geeks.
Depends heavily on what Gnu/Linux based operating system youre on. If youre on Ubuntu, no. If youre on Arch, yes. Just dont blame Linux for it.
"Lots of usability problems, lots of elitism, lots of deniers ("works for me", "you just don't use it right", "Just git-pull the -latest branch, recompile, mess with 12 conf files and it should work")"
That depends totally on what you're trying to. As the many in the Linux community is open source contributors, the support around open source software is huge and if you have a problem then you can get a genuine answer from someone.
"Linux is a hobby OS because you literally need to make it your 'hobby' to just to figure out how the damn thing works."
First of all, Linux isnt a OS, its a kernel. Second, no you dont. You dont have to know how it works. If you do, yes it can take a while but you dont have to.
"Linux sucks and will never break into the computer market because Linux still struggles with very basic tasks."
Ever heard of System76? What basic tasks does Linux struggle with? I call bullshit.
"It should be possible to configure pretty much everything via GUI (in the end Windows and macOS allow this) which is still not a case for some situations and operations."
Most things is possible to configure via a GUI and if it isnt, use the terminal. Its not so hard
https://boards.4chan.org/g/thread/...21 -
I dont need DuckDuckGo,
I dont need any VPN
I dont need all of this "Internet Privacy Service" BULLSHIT which my ISP wants me to use,
I DONT NEED ANY OF THIS FUCKING SHIT!
AND I DONT WANT IT EITHER!
I HAVE MY OWN PI HOLE!
AND THATS FUCKING ENOUGH FOR WHAT I NEED! STOP TELLING ME ABOUT ALL THIS "We are clearly not logging your shit" WHILE YOU DO!!
Because I have my own shit!
Thx10 -
Taken partly from an article I just read.
Russels paradox is a problem discovered by Bertrand Russel in 1901 when studying set theory.
He describes a set that contains all sets which do not contain themselves. The set of all pornstars does not contain itself for example, so it can be include in Russel's set, as well as many others.
But what about Russel's set itself? It doesnt contain itself so shouldnt it be included as well? But that would mean it DOES include itself which means it DOESNT belong to the set. And it would keep switching like this, monotonically, forever. Hence the paradox.
If it is monotonic then where we begin in the sequence doesnt matter. So lets do away with that bugbear.
Now if russels set IS the set of all sets that dont contain themselves then we get a paradox.
However if russels set merely *has* as a single subset, all sets that dont contain themselves, then shouldnt russel's set with one level of indirection, contain itself?15 -
Do not change username in win10.
Messes up ownership.
Ex) You have set your username as Loren. Used computer for a while. Installed bunch of programs.
Then you change your u.c to Ipsum. Some installed programs adapt to new u.c. others dont. New programs set the installation folder to either c://Loren or c://Ipsum making chaos.
Then the computer gets messed up.
...........
Opens Git Bash.
Ipsum-blahblah ~ git blahblah
Close it.
Open again
Loren-blahblah (uhh!)3 -
Hey so this may be a harsh one. Me and my friend are computer science and game development students and he's now in Programming 2 and he's not understanding day 1 concepts (i.e. "you dont have to redefine a variable every time you use it", "That's a string why are you setting it to 0?", "the program needs to take in user string input how would you do that?", etc.) and at this point I don't know how to help him actually understand and retain information. What do I do?13
-
balancing school work between life and sport and programming is so hard. i mean, school is complete bs. what’s the point?
ffs it’s not *just* that im never gonna use the shit im taught, but that if it dont learn it, im punished. even in some classes (code.org), information that we’re taught is blatantly incorrect. either way, being able to find the foci or an ellipse and the latus rectum (hehe) of a hyperbola isnt going to make it easier when i get my job and just adjust css to my bosses’s specifications. i maintain a 4.0, and i fucking hate it. my friends are working hard, and getting into mit for racial diversity, while im doing just as much work, for what?
i want out. i really do. but this redundant thing called a degree is holding me back. i really want to have some way of proving my skills without a degree. i’m currently building a social media application i believe will take off, but frankly, i dont care.
take off or not, hopefully it will be enough to prove my skills. i’ve been working on this for two weeks now, and, well, that’s my story.7 -
In my past job,
Boss: We need to send the build by day end. Here is the FTP details you asked for.
Me: But password is missing in it..
Boss: I dont care, do whatever you can do... google is there.. fix it anyhow...
Me: ......(Banging head on wall)..... -
Corporations... huge, old, monolithic
We want you to automate but will do everything we can to prevent you from getting resources to do it. Restricting policies, decisions by managers on "what they do not want". No procedures on how to achieve the result within policies. Half the business lives in a gray zone and sea of policy exceptions.
We finally decided to get at least Azure subscription instead of trying to develop similar framework internally, but wE DoNT WANt YOu to dEPlOY thERE As WE Don't cOnSIDEr it sAfE ENough.
Like pissing against wind.6 -
!Rant #motivation #hugeProject
Yesterday i started a new app and i designed some of it but classes i coded will speed up the whole coding of other parts .
Anyways today i needed to work on the server side of the project and when i was working on setting up the databases structures i realized how big is this project (it uses like 3 APIs) so i was unmotivated because its a side project and it takes alot of time and overall it dont worth it and even app may fail or may be successful.
So i said i dont care about how it will turn out
Im gonna do it , and im gonna do it right now
So i did now its 6 am and the server part is almost finished ! 75% done .
It was a secure login system and signup with verifications and more security stuff and the codes that provide the server status and most of the user parts . And some of the features of the app .
The most hard thing remaining is to setup the in app purchases and the APIs .
So if you see a project that is huge .
Dont give up . Just do it as long as you can
And you will see how much you progress !
And the huge project will be a big project ;)
Then a normal project , then a tiny project :P
Good night1 -
"could you fix my computer this weekend?"
hmpf...
"kay"
"i already found an infected File and removed it"
"WHAT?"
"yes, Windows tried to prevent me from deleting but I opened console and removed it"
"where was it?"
"somewhere it a folder called System or so"
HOLY FUCK WHY CANT YOU JUST LEAVE IT AS IS IF YOU DONT KNOW WHAT YOU EXACTLY DO????2 -
Does anyone else here have coding-fatigue?
Like if someone gives me a problem (BIG or small), I can chalk out an architecture or "oh you can use this-n-this-n-this"
But if you ask me to code it, though it's easy as fuck, I dont want to and will drag it until I gush 2 coffees to force myself to do it.
You give me a junior dev who knows NOTHING and does the typing and I can guide him and make him do it all, but by myself? nah
PS: this only applies to work-code that isnt "fun" per-se. My own projects? no issues at all10 -
I fucking told them that yes, i can do frontend but im in no way expert, so dont expect much.
"Yeah, cool, use angular"
I was full of questions and tried to reason with them that angular is literally just an unnecessary load and would slow the development down (its a really simple site).
"No, use angular"
Ok fine whatever. So i built the site, it was ugly as fuck, half the functionality was hacked in with jquery because i have no idea how these fucked up frameworks work (or apparently dont work) when i realized that i get jackshit from the backend.
Turns out most of the json responses were totally disregarding the json standard, like {1: tag0},{2: tag1}, where a json arrat should have been used. The other half was xml. Yeah. Also of course they used spring so the backend took like 3 months where it could have been done in like 2 weeks.4 -
I, after a very long time, had to use Windows.
My Ubuntu system died yesterday with faulty hard disk. Good for me that all my data is on cloud and I dont lose anything apart from the software installations. I have ordered a new hard disk and it will come in 3 days time.
In the meanwhile, I wanted to continue my work and I have my wife’s Windows 10 laptop. She doesnt use it often ever since she got a Tablet last year. It was a good chance for me to try out Windows after a while.
The laptop hadnt been used for a while now(probably Dec 2020) and when I started it, I got all sorts of notifications for updates - Windows update, Browser Updates, other Application updates. Coming from Ubuntu world which has a single notification for all software updates, this was just too many notifications. Plus, for some applications you dont get the update notification till you open them.
And by far the biggest frustrating part of this is the Windows update which takes like forever to first install update after all applications are closed, and then installing and configuring some more when the system boots up. And all you do while this happens is watch the screen with progress indicator moving 1% every minute. The system is not usable and even more so, I dont know what application or package is updated.
I started this activity today at 10AM and its 11:53am now, and I still havent been able to use the system to actually do the work. Its a half an hour work on a Google Doc and I have been waiting for it for about 2 hours now.
Its so amazing that Windows system is so screwed still. I dont know what will it take for Windows to have a consistent package and release management. Its so frustrating to update each application on its own.10 -
So my teacher doesnt like us sharing code with eachother cause: "Y'all learn it better when you figure it out yourself."
FFS if ya dont figure it out yourself, you'll end up having learnt nothing. So I ended up uploading every library and exercise solution I wrote to a github repo and shared it with my classmates. Prolly gonna get into some trouble for dis if my teacher finds out. But I dont care. I've written it so I can do with it whatever I want!5 -
After drilling yourself with links and resources, documentation and cant execute what you want. You leave it.
Some time later you go back and you are like why the hell didnt I understand this it's so simple :/ and it literally says what to do.
This is when I became a calm developer. Don't rush yourself. If you want to quickly do something. READ dont just look 🙃
Also, don't persist with understand the official docs. The third party explanations will show you flames 80% of the times if you are learning something new.2 -
Getting high during work sounds cool, but once it caused me real trouble.
So, I was just finished with the service I was building and I had files ready to be uploaded on server but I was high at that time and I completely forgot to secure my backend files and BOOM.
Server stopped working. Server support was shocked because overnight we utilized 300GB bandwith .
It was some WORM and it kept coming back.
We were helped in the end though and provided fresh IPs.
P.S. Dont do important stuff when stoned1 -
So i was workin fron home and there was a bug that was pissing me off since morning. it was a small bug but really annoying, so i threw my pen at it and somehow it hit the bug. Yeh dont think i could do that again1
-
i am a weak developer, i dont know that much of what im doing, unexpected things come up, i dont like time estimates (estimating time is harder than complexity estimates), some school of thoughts dont like estimates https://youtube.com/watch/...
my manager posed a thought exercise to me, imagine im a contractor (im not, clearly not skilled enough to be) , contractors can estimate how much time precisely a task will take to do their work, get jobs, etc
is it possible to learn this power? how does one git so gud, walk in learn how existing code base works, change, edit , build on top of it, ideally doing quality work9 -
I have an old macbook pro (mid 2010) which I dont use anymore. Im thinking of installing linux on it. Just for the heck of it.
Do you have any suggestions? Have anyone done it?
*I dont need it for any day to day activity.11 -
[Working on some really "urgent" report for an about to publish project]
dev: client, can you explain what this value is? we can't figure it out and we though tha...
client: im gonna stop you right there, DO NOT Analyse! we dont have time for silly questions, if the design says there's a 10, just put that freaking 10 in that place...
dev: but sr, we need to...
Client: what did i say? just stop saying things and build it!2 -
So I am only 15 and I am trying to find local businesses that will allow me to either build them a website or let me redo their current website.
Doesnt sound thay complicated right? I have gotten to do it once, for a laid back coffee shop owner whos business went out of business a day after i emailed him about it being done. I mean how the hell does that even happen!
I have tried different types of emails and shown all of my work, which it is all good sites that look professional. Issue is alot of people dont trust email offers or dont trust me cause im 15. I am not much of a person who can walk into a store and talk to the owner about it, i am not social in that aspect.
So anyone have any ideas?5 -
I really loving coding but i cant stand people that take coding for granted, theres no single way to code there are a lot of ways to make a single function work and you can code it in different ways, i hate it when people dont use their imagination, in coding you dictate what you want to do, thats the power of coding1
-
OK, lets again talk about net neutrallity
The FCC said they dont give a shit about the people and will not listen to them.
OK. Got it?
So, what now?
Write your ISPs about the Problem! Thats literally the only thing I can Imagine to do! But honestly, I think its still useless... It still wont help... Were all doomed6 -
Mentors dont understand the power they have...
My mentors boss (non technical) will ask me to do something that either makes no sense or technically impossible. Without a mentor whos willing to say "that makes no sense to ask" or just "he will need an extra week to do it" can change an internship from a horrible nightmare to a great experience1 -
is Bachelor or Master Degree necessary for a web developer job?
ps: i am currently persuing BCA degree 5th sem and it has so many subjects i dont like or not related to my Aim(like microprocessor and assembly language). So.. dear seniors what do you recommend me?29 -
Aaagh...... 2022 this year has been shity for real..
So its now 1 year and I've been a fullstack developer for this mid tech company as the only developer
so I've been trying to get these guys to hire a second developer. and try to also upgrade equipment and these guys didnt even bother to attend to my requests and during my evaluation meeting on friday these guys where down my neck about why projects are taking time to complete i MEAN WTF!!!!! told them its bcoz Im a 1 man army and most of the times Im chocked with the "any other duty" thing and how tha fuck do they expect them projects to be done on time
I'm the only developer some times i get sick 2weeks and where i left off is were i continue from and thats 2 weeks work of progress down the drain
I'm so fucking pieced off ryt now I feel like droping this shity job and find a much better organization
they want me to build them a developer department and they dont even equip me with the necessary tools to do so WTF do they think they are doing they think they know better than me?
so let them build their fucking dev department without me
this has been a fucking stressful experiance
wrote them a later to hire a second developer
I dont fucking care how they are going to do it
contracting or an internal dev if they dont in the next 3 months I fucking leaving this shit7 -
Who of you play/like Tabletop RPGs more than computergames RPGs?
I personally hate it when i dont have the freedom to be the character I want to be in a digital RPG.
So I started looking into Dungeons and Dragons a few years back and finally decided to start playing Pathfinder because it was gaining more and more popularity.
So do you play tabletop RPGs, if so how did you get introduced to it?12 -
Concept: an app that runs on a smartwatch that activates when you disable an alarm (temporarily, not through the settings) and uses the on board sleep sensors to re-enable the alarm so you dont over sleep. But if you do actually wake up the first time, you dont need to disable a second alarm.
I would love to know if this app already exists or if someone is going to make it6 -
To everybody who remembers my infinity rant. Lets do another try.
This time, lets try to make a stop motion montage.
Take a piece of paper and drow something that fits with the last image. Anything is allowed, but: after sending a picture, please wait a little before sending more.
Remember that this will be a gif with about 5fps. So dont make the jumps between scenes too big.
It surely wont look super nice. But i wanna see what the community can do. XD
So as said, no pressure. If you cant draw or your image doesnt tightly fit the previous ;)
Ps: i dont append a picture, so the first picture and thereby the theme of this gif is also decided by the community!!! XD1 -
5 months ago we are using string for identifying some stuff:
var abc = "badstuff/abc"
var isBad = abc.indexOf("badstuff")>-1
// fine
we later switched to id, so
var abc = 13;
var isBad = abc.indexOf("badstuff") > -1;
// well this is wrong
so I approached the colleague and said to her that we use id now, indexOf("badstuff") no longer works, and id can be arbitrary, like 3245.
-- ok ill do it.
I dont know 3245 looks really like a special id or not. this is the outcome:
var abc = 13;
var isBad = abc.indexOf(3245) > -1;
lol.1 -
For shit's sake, data stream processing really is only for people with high throughput looking to do transformations on their data; not for people aggregating <10Gb/day of data.
Fuck me DSP is going to be the new buzzword of 2020 and I'm not looking forward to it. I've already got stakeholders wondering if we can integrate it when we dont have the need, nor the resources or funds.10 -
Working 40 hours per week while doing freelancer stuff and now a fking masters degree due september this year. How do you guys manage it? I dont know if I could do it all... Fuck it3
-
Agencies... Just hate when people are given only time enough for doig crap code, because "there is no budget". Hate even more to work on changes on top of it, because people just dont get why you take so long to do changes that supposed to be simple, ignoring the fact that previously they asked for some slap-dash shit. What do they think, that with time the code cleanup and tidy up itself?
-
Crazy deadlines> Director: "You need to design a new architecture that has failover, multi-AZ, automated deployments, CI/CD pipeline, automated builds/tests as well, for our new SaaS product. You have 3 days to complete it"
Me: "Ok cool. Do we have the new product developed? Can I have the spec docs of the new software, libs and packages required for the env?"
Product Lead: "No we dont have anything yet. The POC is on my local PC, but I dont know what packages are needed to run it"
Me: "So I cant design anything unless I have the minimum requirements to run the new software"
Director: "Just get it up and running in a live environment and we'll take it from there"
Me: *sigh*..this is going to be a big mistake -
Just when i somehow accepted that Austrian part of team is naming theirs methods in Deutch, i almost got heart attack when i saw this. They're combining english with deutch, for example isOffen(), isLoeschenAllowed(), isEinsichtHinzufuegenAllowed() and so on... And most of the time these assholes even dont add javadoc, but when they do it something like: "Checks if *curentClass* is offen". Thanks a fucking ton.3
-
Yay today my power extender broke!
(the thing that allows you to connect multiple devices to one sockiet, i dont remember the correct term)
That means i need to buy the new one! Because the old one is using rivots it means i cant repair it!
Stupic fucking lead free solder! Why do you even use this shit for connections? It will create those tin wiskers (small wires) that will short shit! This is the reason why my 3 old power extenders failed! And it is propably the reason why it failed as well!1 -
Installing the nvidia drivers on my linux machine is the bigges nightmare I've come across sofar. As soon as I have installed it and reboot, blackscreen and literally no way around it. Starting the desktop, nah stuck in a crashloop. Installing different driver, same issue. Using diffrent distro, that shit wont even boot properly. Uninstalling the driver seems to fix it but whats the point of running only on third gen i5 graphics. Shit cant even handle 1080p yt properly. And there are ppl saying if it aint broke dont fix it. FFS I DESPISE MAKING COMPROMISES WHEN I FUCKING KNOW IT CAN WORK BUT ATM IT IS NOT IN THE FREAKING MOOD TO DO SO!4
-
Question Time.
Has anyone around here used Krita before?
https://krita.org/en/#
Im trying to find something Photoshop-like that isn't GIMP - i've never really liked it for what ever reason.
i dont do design work enough to pay Adobe's BS subscription, but something opensource / donationware would be more appealing.6 -
i dont know sql, gotta look shit up and dont much of it really internalized
i may be now being assigned somebody else's task to do some sql shit
fucking kill me3 -
I am 2 months in this job and I already hate it.
I love programming and building stuff and also the business side of things, even some meetings are ok if done efficiently.
This time its the coworkers. Nobody goes with the management decision to migrate the app. People intentionally deny help or at best dont care. Nothing is going forward.
I am a Junior but I am not just a warm body in the room. Still they really try to make me feel like I have to kiss some boots because of it. I really fucking hate this „family“ they call themselves.
How do you do? And how do you deal with a place you hate?7 -
So..there is 2 of us working on a Wordpress site, my job is front-end and make it look nice, the other persons job is to do some backend development(dont ask me what and why, I have no idea). Basically, I was waiting for the other person to finish his part so I can do front end development. I was expecting it to be just a theme, and then I fix it, add new stuff, etc etc, like usually..but the horror I saw, THE FUCKING "BACKEND" PERSON HAS ACTUALLY MADE A FUCKING THEME EVEN THOUGH IT IS MY FUCKING JOB. Now dont get me wrong, I wouldnt mind if I did almost zero work and got paid, but..THE FUCKING THEME WAS UGLY AS A TWO HEADED DICK SMOKING A FUCKING CIGARETTE. There was STRONG RED FUCKING EVERYWHERE, padding between posts was basically -20px. Well ok, I could have just started making a new theme, but there was already some stuff in this one we needed so I went it it and tried to make it look nice. And trust me, it is great now, great colors, fonts, shadows, button animations, everything, even looks great on mobile.
I started making some changes to the header, and I noticed that post title changes also..hmm wonder why..So I inspect element and what do I see, TAG OF THE FUCKING POST TITLE IS <HEADER>???? WHAT THE ACTUAL FUCK, IF YOU TRIED TO DO SOME FRONT END, AND YOU SAY YOU KNOW SOME, WHY DO FUCKING FUCK WOULD YOU DO THAT???????? WHY THE FUCK WOULD YOU DO MY JOB IF YOU SUCK AT IT??? DONT DO MY FUCKING JOB, I SUCK AT "BACKEND" AND I DONT FUCKING DEAL WITH DATABASES OR TRY TO MAKE THEM FOR YOU!!!!! AAAAAAAAAAAAAAAAAAAAAAAARHHHHHHHH FUCK -
Short question: what makes python the divine language for ML and AI. I mean i picked up the syntax what can it do that c++ or java cant? I just dont get it.19
-
when a senior and tech lead write conflicting PR comments ~1 week apart
i dont give a fuck, ill do it either way you want but you 2 need to sort out how the fuck you want it5 -
If you ever get a chance to refactor a 5/6 years old code , just do it .
Dont loose hope , you'll eventually have a great time .
Its totally worth the effort and time . I learnt so many things. (still in the proccess)5 -
Since ive started college my will to program has become non-existant. Im a self taught programmer since 12, it used to be MY thing and i loved it. I used to spend hours a day just programming personal projects because i love it. However since college has been getting serious with this being my junior year and having part-time contract work i dont "love it" as much. Im a little scared, i have no time to just code for fun and when i do have time it feels like work because thats the only other time i code.
What should i do guys, i dont want to fall out of love with programming, it's part of who i am and i can feel im losing it.1 -
I just want to thank Steam for making steam guard key in all caps. So I dont need to fucking think about if its uppercase i or lowercase L. It would be much better if they do it on all captcha services or just fucking dont use i l o and 0 characters. These are pisses me off. They are so fucking annoying.1
-
Him: "dont put your constants in a standalone class, it defeats the purpose of OOP. A class is for methods and such."
Me (in thoughts): THIS IS PYTHON YOU OEDIPUS, WHAT ELSE SHOULD I DO IF I DONT WANT MY CONSTANTS TO CLUTTER THE FILE??1?
But using the enum-class as superclass maakes it ok for him... -
best teacher? i wont really consider it teaching but it had really helped me a lot in my 1st year of programming.
me: *sends an email* hey i dont really understand how to do this part
teacher: i dont really know how to explain it so i coded it myself *sends me code*
me: oh thanks! *copy paste to mine*
after a week:
I GOT A PERFECT SCORE!! but ofc now i dont trust the teacher's code anymore. i deal with my own code.1 -
!rant
Guys, Im curious, what you would say about situation if you are in need of some quite simple tool and you write it but becouse you need it today, not tommorow, you just dont give a heck about all the fancy stuff and (lets say for php) you start to write all in 2-3 files like you was back beginner?
Or you just nope out of situation?
Do you refactor that when you bored just becouse this cant be on my disk, noone can see this abomination?
Or you delete after usage (only to relaize 5 minutes latter you need it back :P )
Im curious your opinion.
PS.
nope, if you came to bitch about any of opinions even opinion "well, i wouldnt give a fuck and just not do it", go away and get lost.
E: typo12 -
From now on, if I'm gonna have to deal with emojis fucking everywhere, I opt to use them to best describe the two greatest diseases of the modern age:
Apple and google.
Anytime they make their products worse, or do something stupid the response should be
#shitapple
Or
#💩🍏
This sign, brothers, shall be our banner! our labarum against the forces of the corporacracy and mediocracy. and with it we will go forth and conquer!
Unite against the forces of stupidity. Our weapons will be humiliation, degradation and hobbyist projects like arts and crafts, freestyle poetry aka slander, and casual arson (actually dont do that last one).3 -
I dont get it... I dont understand what my manager expects me to do when I am not really allowed to make design decisions, but there is no design at all! What are we doing here, manufacturing spaghetti? Today I asked my co-worker what our product should actually do exactly when its finished. He said he is not so sure either. And our manager is now on vacation so we cant ask what exactly he wants...
-
Running my own business is not going well. Hasnt for years now. Previous dev jobs were also just nightmares. I feel like i cant cut it as a freelancer, or as a full time dev. I do enjoy programming but my resume is crap and my worthwhile portfolio items are basically all locked down under NDAs or ambiguous accountability. I cant prove im even worth hiring and im almost too old to be considered for any junior role. Not that i think i could handle it. So im considering finding a new career and keeping coding as my hobby. But first i have to decide what to do about my remaining client. Which is fine because... i dont even know what i could do for a full time job now. Ugh, im so profoundly discouraged i dont even want to try and think about this anymore.
The weekly rant topic indirectly applies here but since its a bunch of self pity i decided it would be best to not tag it such...3 -
OHHHH. Now i get it
Senior means--dont fucking ask me ANY questions. Do it urself bitch
Medior means--its ok to ask some questions but not too much bitch
Junior means--its ok to ask questions all the time as long as you keep working on tasks4 -
How do you make up new cool features for your platform?
well you don't because UX and PM think it best to look at competitors and implement whatever shit they come up with.
once, someone came up with a cool feature and some basic prototype for it and they ignored it. the competitor thought of it years later and did it. when they did it, suddenly its a priority at our company to do it as well.
sure, why be the first to do the feature. im sure being unique and creative is overrated not like our profit comes from user subscriptions.
Some recent PM decisions similar to the one above are driving me crazy, its not like u dont know what to do we literally have a ton of ideas so stop ignoring them and prioritizing being a knock off app of someone else. FUCK YOU. -
TGIF & remember..
DO NO FUCKING PUSH TO PRODUCTION TODAY!
DO NOT FUCKING RELEASE A NEW VERSION OF THE CLIENT APP!
FUCK!!
have a nice weekend partners 🤗1 -
I get so irritated when i see people pirate things, i get it, they want it yeah but the fact that someone gets pissed off because i use opensource software, try collaborate and better the software and support by donating some projects. Then they try and convert me to their "copy and paste" mantra. Fuck no.
If only they knew the hours and time given up from their lives, taken away from famillies and social lives developers spend trying to make apps that alfeady makes everyones lives simpler but they dont see that, they are so use to having things given to them they wont realise hoe important it is until it was taken away.
Support the developers because if it was the other way around. Regardless if you wanted it or not, you would like support. We do do this because we love it and with everyones help, we can progress forward together.
I really dont care that i look like as ass to the guy now, i really dont care what takes from it but just venting i guess..1 -
So JavaScript/ES6 is kicking my ass. I'm not used to front end development as much. Idk when to use javascript and how. I dont know when I need to manipulate the DOM and how I do it. It's a new concept and I'm hoping PHP isnt gonna have as big of a learning curve..7
-
apple you piece of shit just let me have xcode i dont want to make a stupid fucking account, so can you fuck off?
and why do you HAVE to have billing address information to create a fuckign account or am i a retard who cant figure out how to make a fuckign account without providing it because your UI is not retard proof enough
fuck u3 -
Maybe it is too late for wk199 but i have interesting things that have happened recently.
1.After 3 days of panic buying shops still have stuff in them thanks to the logistic chain
2.I can finally focus on my project at home, i cant fucking belive that covid_19 did more for my education than my fucking university for past 3 years.
3.My dormitory has been captured by the military in order to be converted for quarrantine space. Noble idea IF I WAS FUCKING INFORMED BY IT BEFORE. Ok they had called me and explained thag stuff will be collected and put in separate bags so nothing will be lost... BUT THEY SAY THAT THEY MIGHT THROW AWAY FOOD
(my fridge is empty but i made a small stockpile of things like cereal or insta soups) If they will get thrown out i will GET FUCKING PISSED. Aparently that info was written in the newspaper but Im IN A OTHER CITY AND UNI ADMINISTRATION DIDNT EVEN BOTHER TO WRITE AN EMAIL.
I hope my bed sheets are going to be collected too i dont want other fuckers to be using my shit. Not only i have to share room and bathroom i realy dont want to share items.
So i hope they will do that fucking propely.
1.Collect ALL OF THE THINGS
2.Dont throw anything out
3.Segregate them from my roommates shit so it wont get mixed.
I know we should do something about that pandemic but that is just borderline stupid. YOU ARE SUPPOSED TO ACT NORMALY AND JUST WASH HANDS, NOT BRING MARSHALL LAW AGAIN POLAND!2 -
Is it okay if i dont know a programming terms but i know how to do it? Like they want me to explain what i've done and what i use when i done it. Example ( i use java predefine clases bla bla bla....). I dont really know or maybe i just cant remember the terms.9
-
welcome to devRantRant, where we rant about the types of rants we don't like rather than just ranting about our own lives and experiences
who cares if you dont like a rant? do you REALLY think anyone's gonna care if you rant about not liking it?6 -
what should i do, any ideas?
i'm a student and have a very good payed job (19h/week). Im stressed and have an ill feeling at work, not beacsuse of others but because i really Dont like the job and dont know if im good at it.
this feeling and the job is affecting my studies. I could take a job, at my university, which is muss less payed but really fun.
Do you have any advise guys?7 -
My boss' solution to whatever problem comes from a plugin:
spam emails to the plugin creator until they dont desperately give up and either block you or they solve your problem, 2 emails a day should do for first day, then increment every day.
I mean, if I ever get to make a good plugin and my boss will ever download it and can't make it work, I much rather remove the plugin from Earth than solve the issue of a spammer6 -
disclaimer i dont understand css to begin with so you can discard my opinion
You have all these options for width https://developer.mozilla.org/en-US... , but guess what none of them do anything different as you brute force try them all in the chrome debugger. Dunno what cascades except my butthurt
so fuck it ~1000% width works and has an ugly overhang, but fuck front end8 -
Guys i had a question...do people managers get more salary than developers? If they do then would i ever earn more than them in future and how long will it take for me to earn more money than them? Dont get me wrong, i dont have anything against them, i just want devs who do all these stressful complicated stuff to have more salary than people managers...your thoughts please, thanks9
-
Last night there was a hellstorm of weather that ripped off 10m thick trees out of its fucking ROOTS and smashed cars, traffic lights ripped off, some roofs ripped off, containers flying fucking everywhere, floods and it all went away within 2 hours as if nothing happened
Electricity is fucked and Of Course i lost my internet connection. I dont have my fucking wifi. Im using mobile 4g
I try to continue coding on my project AND LOCALHOST CAN NOT RUN IF I DONT HAVE WIFI??? WTF IS THIS HORSESHIT?
WHY a NEXTJS APP CAN NOT RUN AT 127.0.0.1 IP ADDRESS JUST BECAUSE MY INTERNET IS DEAD FROM SHITSTORM??? WTF DOES LOCAL NETWORK HAVE TO DO WITH THE INTERNET
I SWEAR MAN SOME HIGHER FORCE DOES NOT LET ME WIN
ALL THIS BULLSHIT AINT MY FAULT NO MORE ITS SOME BULLSHIT HIGHER FORCE TAKEN OVER RN9 -
Where do i start , if i am interested to contribute to Open Source projects in C ?
I have a good understanding of C language. Even if i am not able to contribute , it would be nice learn from those projects .
The problem with big projects like the linux kernel is that i dont understand or cant comprehend most of the code , except for few sections like gpios..5 -
I live in a college, sort of..
2 hours ago, the power was lost unexpectedly for less than a minute and then came back. Internet didnt tho.
They dont handle their own infrastructure in this college thingy, they hired a school to do it (it sounds fucked up, and it is a little fucked up).
Now little me is becoming impatient and offers my help. Gets rejected.
Additionally, i just started to have a fair sleeping schedule, and noe because the internet isnt working im about to fall alseep before lunch again.. i hate the people responsible for IT here..3 -
I dont like programming languages where "there is more than one way to do it".
There should be one way to do things, it makes it easy for developers to understand code others have written, it makes it easier to start working in new teams etc etc.23 -
So I'm gonna be honest. I dont know git. I do plan on learning it but I'm waiting to learn how to use it. But I'm seeing all this stuff about it on here could someone explain what it is and its function?6
-
I was studying a lot the last year, i learned a lot about Machine Learning/Deep Learning, Data Gathering, Data Analysis, ETL, Model Architecture Design, Training, Fine Tuning, Backend Development, DataBases, API Development, ORMs, Rest, GraphQL, OAuth, CI/CD, Docker, Deployment to Production environments like Heroku, Git and more stuff i dont remember while writing this. I built and keep adding stuff to my Github Portafolio.
Im not able to get a job. I started looking for jobs as Data Scientists, no response never. I take a look at freelancer sites, nothing seems to fit my skills. And when there is a minimal fit, they always want a Full Stack Web Developer, i dont know Frontend Development, i dont like do it.
Dont know what to do or how to land any job.
My options aeems to be:
1.Learn Frontend Dev and work as Full Stack in underpaying freelance jobs
2.Keep applying to Remote-Only startups, but they still wants people with 3+ years of experience.
i cant work in my city, here are not any company startup hiring no one, we are 30 years in the past here.
What you do in my place?10 -
At any given company, there are
those that do
and
those that do not
I've mostly (and sadly) worked with the latter
and those are the people who are like "ahhh yeah, no worries, don't worry about it! we need you to stay positive, not rage! why you get so worked up?" and i'm like YEAH YOU DONT HAVE TO FUCKING WORRY BECAUSE YOU DONT DO ANYTHING! YOU HAVE ABSOLUTELY NO RESPONSIBILITY IN THIS COMPANY AND ARE A FLOATING BLOB COLLECTING YOUR PAYCHECK, THAT'S WHY I GET ALL NEW ASSIGNMENTS AND AM RESPONSIBLE FOR THEM WHILE YOU ARE STILL WORKING ON TASKS ASSIGNED TO YOU TWO QUARTERS AGO!!!!!!!!
god who am i kidding, it'll never change
...man I am on an absolute rant rampage the past few days, feels good >:) -
Damn it I have to write a 5 sentence email to get the things going but I have kept myself from doing it because they might answer and then I would have to react to that and I dont know that I can do that right now.
-
Having Technical Product Managers who say "it doesn't work, I dont know what, but do your job and find out."
-
I dont know how to timeline projects. I tell clients that it will be ready in one month. But the project will be so big that it takes lot of time to actually code it and do all the procedures around it. I m just giving them timeline based on the speed of my mind.3
-
Is there anyone who actually likes using Angular?
I decided to learn it (im backend only for many years) to be less clueless in the frontend world.. and so far i find it horrible.
Is it just a "culture shock" or do frontent angular devs also find it.. not so fun to use?
What i dont like so far is the inconsistency of syntax.. i feel like similar things done differently and not following rules that can be learned, i can't remember/guess anything, everything needs to be googled
i.e- `*ngIf` vs `[ngSwitch]`
Not to mention 3 different syntaxes to simply bind a property..
I tried vueJs about 3 years ago and it was so fun and EASY21 -
Why do apps dont keep the black theme as default!??
From any ide to Twitter to even devrant!
Black theme looks so cool.. Why not just set it as the default one! Most users switch to it eventually anyways.
I am sick of searching it in the settings everytime I install a new app.4 -
How to disconnect from work after working hours? Im working for the last 4 months as a mid level dev in this company. I mean Im able to problem-solve and do my work but sometimes I get so addicted to problem solving that I get worried and become obsessed, hyperfixated (especialy if Im stuck on something for lets say a couple weeks). It goes to the point where I work from home 12-14 hours a day just to figure out some bug in the flow.
Thing is, our codebase is large and when doing every new refactor/feature some surprises happen. I dont have a decent mentor who could teach me one on one or even do pair programming with. All i have is just some colleagues who can point me to right direction or do a code review from time to time. Thats it.
I dont know why I take this so personally. For example I had to do a feature which I did in 1 week, then MR got approved by devs and QA. After that during regression they found like 3 blockers and I felt really bad and ashamed. While in reality our BA did not define feature properly, devs who reviewed it didnt even launch the code and poke around in the app, and our team's QA tested only the happy scenario. Basically this is failing/getting delayed because of a failure in like 6-7 people chain.
However for some reason Im taking this very personally, that I, as a dev failed. Maybe due to my ADHD or something but for the next days or weeks as long as I dont find solution I will isolate myself and tryhard until I get it right. Then have a few days of chill until I face another obstacle in another task again. And this keeps repeating and repeating.
My senior colleague tells me to chill and dont let work take such a toll on my emotional/physical/mental health. But its hard. He has 7 years of experience and has decent memory. I have 2-3 years of experience and have ADHD, we are not the same. I dont know how to become a guy who clocks out after 8 hours of work done everyday. Its like I feel that they might fire me or I will look bad if I dont put in enough effort. Not like I was ever fired for performance issues... Anyways I dont know how to start working to live, instead of living for work.
I hate who Im becoming. I dont work out anymore, started smoking a lot, dont exercise. I live this self induced anxiety driven workaholic lifestyle.6 -
i've been working in this company for a few months(this is my first job)
the only downside is sitting for long periods of time
it is so uncomfortable
i dont get time to walk
i dont have time/energy to execise or hit the gym
after the work
what should i do11 -
Okay so Im just stuck. Ive not programmed in a few weeks I wanna say, and when I do I go on the binge and then I "take breaks" to relieve the stress because I want to just relax but I dont force programming out of my life I also think about better ways to do stuff but I feel like shit because I want to just enjoy and relax with some games but I enjoy and LOVE programming but I just dont know what to do. because I want to enjoy some of the games I got for christmas but I want to keep improving and I feel if I go a day without it just that much shittier for not. and I cant see how much Ive improved. I just cant relax and feel good about it.
-
website dev on hold cause i am waiting for texts/images.
client: why i dont hear from you. site will launch on oct. 1st.(real: late oct.)
me: on hold tull i get those things from you as we said in mid aug.
client: i am really pissed of. you got 90% of the stuff so work with it.
the thing is im waiting for some images to create the design. now i am really pissed of. hate clients that wanna tell you how to make your job. what would you do?3 -
What do we do when the WiFi dont work
What do we do when the WiFi don't work
What do we do when the WiFi don't work
On Ubuntu 18.10
Disable secure boot and sign your own driver
Disable secure boot and sign your own driver
Disable secure boot and sign your own driver
Build it from the source code2 -
When you think you finally know a programming language really well but then you start a project and want to do it all on your own but you dont even know what to do... so basically I'm dependant on tutorials and Google.. until I am good enough to do it on my own..
-
NO! Use the description instead of the primary key because the key might change ................................................................................................................... vs the description .............................................................................................................. the key more likely .............................................. meh2
-
This is a little shameful, but i dont tell people i do IT since it leads to a , "wow you must be really smart, i could never do computer science" discussion.
Alot easier to connect with people without a plethora of stereotypes attatched to your SEO of a name3 -
I am a fresher at this IT giant and I was hired to work in a better role as a dev. They assigned me CMS copy paste stuff and I dont like the work here at all. I am preparing for better opportunities. The lead calls me up after working hours to do some more copy paste stuff. I conveyed frankly that I cant devote time after working hours as I have other studies to attend do. Did I fuck myself or did i do the right thing ?5
-
Hello guys..i dont know why i am posting it here...but i am really depressed..i am a fresher mern stack developer...i am applying everywhere but i am not getting any callback from any HRs..i am thinking of either running away or killing myself....i dont know what to do...my wife earns just 9500 rupees from her call center job and we both have to give 5000 every month to my mom for household expenses....it has become vert difficult for me and my wife to save money...i dont know what to do....28
-
So we have this local competition and i was tasked to pitch in some help. 2 weeks before, we get a problem with the database so we pull someone from another team to fix it since our hands our full. But his PRICK OF A TEAM LEAD is forcing him not to do it because "It's not priority". So day of the competition - EVERYTHING WAS A MESS. The competition was forfit. We tarnished our company name. BuT his PRICK OF A TEAM LEAD suddenly comes in POINTING FINGERS AT US SAYING "they dont communicate and dont seem competent enough" OHHHH SNAP YOU UNCULTURED GOOSE PRICK FOR TWO WEEKS YOU IGNORED US BUT WHEN WE WENT DOWN YOU SHOWED YOURSELF TO THE BOSS LIKE "it's because they didnt rely on me" WELL KISS MY ASS PRINCE NOT-CHARMING. I really like my company but some people are just TOXIC.
-
Hey I recently started working and had a few questions regarding fulfillment and sideprojects.
Although I am a game programmer now, the game we are making is not at all something I find interesting. I find myself wanting to work on some side Projects at home but its difficult to manage my time (obviously) and I cant really relax.
I do enjoy the work making the game, like, I like making the systems, I enjoy programming it, but I dislike the gameplay and the games thematics, so its a mixed bag.
I only worked there for 2 months and the game takes at least all of next year to be made. I dont want to quit, because its my first job and all and it would be stupid I dont really habe a reason to quit.
I guess I just want to hear how others are handling a situation like this2 -
I think I am going through burnout.
How do I deal with it?
Joined a startup with crazy work culture in Jan.
Have been working 14 hours a day for months starting march 2020, and even that was only to barely keep up with my colleagues. I have been one of the top performer in my previous jobs.
since the beginning, It always bothered me seeing people working on weekends, and falling behind if I didnt, to not have time for anything else, but I started really hating it a couple of months back.
Work has slowed down a bit now, but I just can't do it. Cant focus and get even basic tasks done. Still getting by with last minute efforts but I hate it!
Dont have the guts to leave the job, but also realise I am not doing enough and will get kicked out eventually anyway.
What can I do, to get over this?16 -
Yesterday i went coding, tired as hell. I told myself “Atleast i get smth done“ i was wrong. Redid everything and now expect many merge conflicts when i get home1
-
How do people deal with this.
Customer: my trial is finished, and I dont have a bank card?
What do I do say post me the money every month send it by pigeon mail?4 -
(Mobile) Devs, how important do you see joining a company before starting your own Business? I have been into android for a year now and freelancing for 6 months. I want to start a company and sell some apps B2B. My girlfriend however says it would be better to join a company first and get enterprise experience, I dont see the point becausw nowadays there are countless of blogs and videos in the internet that teach you anything you want to know. Opinions?4
-
Stupid manager/boss
my good idea always get rejected first so badly.
Someday ,i proposed a good idea. after meeting with client he said "yeah we actually working on that by using this and this idea" like he's the one who found it, then he said do that idea of yours.
Then someday, i do split the repository to make things clean in approval of my other boss which is more weird. Then after split it up i got bashed from him infront of other team.
But after critical phase that make me night work. He says "we need to split it up to make this easier". Fuck. If we do it first. We dont need to take night work.
Come on, actually i never do something only based on my task. But i do want create better environment on the office. At least morale up your fuckin employee dont bash them everyfuckintime.
But yeah, like buzz said.
"Stupid people, i see stupid people everywhere" -
I dont understand how am i not fired. I literally dont know how to do shit in this legacy 30 year old junkyard code. I am literally alone working on this project on a giant codebase and have no one for help. The project is burning on fire and scrum master is talking shit for breaking deadlines and i cant do anything about it. Why dont they just fucking fire me that would be such a huge relief bro40
-
Team of 5 post-grad students working on a single big project for final grade. Been working on this project since last 3 months. 2 of the memebers of my team doens't even know what we are building and we have to present it in 2 weeks, their contribution is less than 5%. How do people not think that its a project for all of us to do and its fucking 30 credits when the course itself is 90. The professors have asked us to give feedback for each member privately and i dont want to give negative feedback about them as they will lose way too many points for it.4
-
I've kept training to those dumbfucks how this damn app works... Now they ask for a MANUAL, a fu****g PICTURE BOOK... INCLUDING PICTURES on how to confirm a fu*** email!!! How do you even live without brain at all?! Should i put a picture of a computer in it so these dumbfucks dont type on empty desk... JESUS!!!4
-
Working 8 hours a day and then having 8 more hours to do what i want (i dont count sleeping for 8 hours since i do nothing then), IS NOT ENOUGH FUCKING TIME. SELLING MY SOUL TO the devil for 8 hours a day, every day, 1/3 of my life FOREVER? This cant be fucking it. This cannot be LIFE. Life is MUCH MORE than this. Fuck off. Im so fucking pissed off22
-
You know what really rustles my jimmies, the fact that a lot of people (especially older people) disregard your profession or refuse to talk about because "i dont understand dem computers" so they generally have no idea what you're actually doing and you cannot give an explanation.
Ffs, I don't really understand chemistry but I would still like to know what you do at work/school and maybe even learn sonething. There is no fucking reason for why this also shouldnt apply for IT.5 -
When and how do you improve documentation?
I dont mean "added new/refactored code, gotta document it" but active improvement.
Which feeback channels do you have for your docs?3 -
Let me rant! I don’t usually do this but this is just frustrating and draining. Please tell me if im wrong. We have authentication that needs to be refactored. I was assigned on this issue. Im a junior btw. I also attached an image of my proposals. The issue of the old way of our signup process is that when validation fails they will keep on accepting the TaC (terms and conditions) and on our create method we have the validation and creating the user. Basically if User.create(user_params) create else throw invalid end. (Imma take a photo later and show it you)which needs to be refactored. So I created a proposal 1. On my first proposal I could create a middleware to check if the body is correct or valid if its valid show the TaCs and if they accept thats the moment the user is created. There is also additional delete user because DoE told me that we dont need middlewares we have before and after hooks! (I wanted to puke here clearly he doesn’t understand the request and response cycle and separation of concerns) anyway, so if middleware is not accepted then i have to delete the user if they dont accept the TaCs. Proposal 2. If they dont want me to touch the create method i could just show the TaCs and if they dont accept then redirect if they do then show form and do the sign process.
This whats weird (weird because he has a lot of experience and has master or phd) he proposes to create a method called validate (this method is in the same controller as the create, i think hes thinking about hooks) call it first and if it fails then response with error and dont save user, heres the a weird part again he wants me to manually check on each entity. Like User.find_by_email(bs@g.com) something like that and on my mind wtf. Isnt it the same as User.create(user_params) because this will return false if paras are invalid?? (I might be wrong here)
This is not the first time though He proposes solutions that are complex, inefficient, unmaintainable. And i think he doesnt understand ruby on rails or webdev in particular. This the first time i complained or I never complained because im thinking im just a junior and he hs more experience and has a higher degree. This is mot the case here though. I guess not all person who has a higher degree are right. To all self thought and bachelors im telling you not all people who went to prestige university and has a higher degree are correct and right all the time. Anyway ill continue later and do what he says. Let me know if im wrong please. Thanks4 -
Proof i typically underestimate my own self: I just remembered building a browser In Visual Basic in middle school, in a day at my friends house…. How the hell did I do that?? I recognize some of the syntax, but i don’t remember Visual Basic… but THATS how I know it looks like C… AND I DONT KNOW C! so wtf!21
-
I have no burnouts. I dont have kids, I'm full of energy, I'm ready to crush it. BUT every goddamn time i come to a company they run out of work/clients/projects. I end up doing nothing or some video tuts, and then change the company. I WANNA WORK! GIVE ME SOME REACT WORK, PLEASE! I WANNA FEEL DEADLINE PRESSURE! I WANNA COMPLAIN THAT I HAVE BURNOUT! I'M TIRED OF VIDEO COURSES AND TO-DO APPS!
I'm paid money to do nothing. As appealing as it sounds, it's not when you're a junior dev trying to get some experience.
Am I doing something wrong??? -
Exercise do the pyramid of * and I looked up how to do it but so many people are able to do it without looking it up I dont know why shit to do with nested for loops makes me feel so dumb.
I know it's not a big deal to not know how to do every single thing but I'm always even stuck on the smallest exercises that apparently more people can do than not. Like how am I supposed to have thought about that or figured that out. How am I supposed to learn all this shit. Like for example just look up a list of basic exercises and I cant do any of them. I'm not good at this and its stressing me out because how will I get better or hell even a job if I cant solve these simple problems? How am I supposed to get better at solving these simple problems? I cant just keep looking at the fucking solution because that wont stick or teach me anything
Most stupid thing to rant about by far4 -
JS isnt the problem I have. I have realized. My problem is my lack of knowledge of the language which is not really a problem because I am new but its more the side I dont know how to write code that will do it. and lets say I do I get so fucking confident and it doesnt work and I think its some small error I made but no its just how I write it and it wont work and that gets me so down because when I ask for help my code 100% of the time gets rewritten. can I just not do simple shit on my own? and the problems Ive been coming across are just small projects to get better like "Create a function that outputs the most common item in an array" or "Write a simple JavaScript program to join all elements of the following array into a string" or literally any of the projects on this site: https://w3resource.com/javascript-e...
I feel so embarrassed because these are simple and I cant even do majority of them in langauges I'm better and more experienced with (python) I can think out a problem I cant convert that to code. algorithms in general I cant do as well and Ive never done any "big" or "serious" projects so I dont know what I have to show for the last 3 years of my life.10 -
Story about someone elses rant
A = coworker;
B = random guy from company, but from another office;
C = manager we like a lot, cause he has IT background;
A asked B about a problem, because B worked with the that thing. B answered I dont know. So A asked C, and told him, im asking you, because B said, he dont know. C went nuts and pulled a shitstorm on B, like who WTF do you think you are, that you cant give at least a hint to A on the problem or Cc someone who may know more about the problem.
what i wanna say is, shouldnt it be common sence if someone asks me about a problem i navigate him to a person, who knows more than me? Even if its the first day i the office, I know this is my team leader he should see the bigger picture of the problem, so ask him. But telling idk is like, go fuck your self. -
why do all erp solutions i know have a poor design?
one of you guys surely works for a company which sells erp solutions. as i am a user AND a programmer.
i just have to ask: do you have the feeling that your UI is bad?
and if - why is it like this?
i dont want to attack someone. just want to know the reason why all of the solutions i saw have bad UI or are just "user-unfriendly" (like you would say in german :D)1 -
Men fo real! I dont rant so much because I think its a negative attitude but let me do it anyway! Listen. My boss boss told me to create a dynamic drop which I did. A backend request then display it on the frontend which is easy, then on code review he ask why do we need this error handling. Bruh as soon as I heard that question, I got covid. Bitch we do need that error handling because if theres error on requests it will set to default options, but I didn’t say anything tho. I just ask what will happen if there’s an error?, he said I don’t think a simple request will respond error if you did it right. Then I agreed and remove the code. Hot damn! Mind you guys. When they started the app there are no test code. 0, nada, nothing inside the spec folder.7
-
is it just me or do you people find it strange to find smth written in your own language on devrant for example in german?
(no i dont mean English native speakers)10 -
SO's accepted answers being "no dont do what you want to do, use this corporate™-certified library instead, we ALLLLL use it too"
Like bitch if I wanna kill myself with a knife, tell me which vein to cut, dont recommend me a gun, I dont want it. ffs.9 -
Not really a rant but..
I'm really into programming. My problem is that i dont know what to do. I know the basics of a few languages like C++, Java, Python, HTML(+CSS), js but i want to start doing some more advanced stuff. I just don't know where to start.
What im trying to say is that im not a complete noob. It's just really fucking annoying when you want to start working on something but you dont know what or you come up with an idea that you abandon later because you can't turn it into a complete project.
Any help would be appreciated.12 -
where is offensive security actually being taught? i know for a fact it is not at any university because universities only teach technology that is over 20 years old. they dont give a fuck to learn something new. so, if i wanted to learn that, where do i go?9
-
Lessons learned:
Dont fuck with firewall rules when intoxicated.
I was on a weekend, my mailserver was acting weird again.
I do my shizzle, git commit, push.... And it broke
And i was too far gone tp notice on time where the forward rules were broken... That made it stop completely
At least it was not an open firewall -
Okay so I have been thinking about transferring to linux. But I'm not too sure because of a few things I'm hoping yall can explain to me.
1st problem.) The operating system just feels so empty
2nd.) Theres a lot of customizing I would have to go through (which isnt really a problem it's just difficult getting it to look good)
3rd.) I'd have to learn to use the terminal more (which might be easier than I'm thinking)
4th and final.) I dont think I'd be able to use C# I know .NETCore is a thing but I dont think I'd be able to do as much with it.
I know these would probably go away after awhile but I've tried using it before but im afraid of making it my main OS I'm also putting aside games in my problems cause I know they recently made gaming better on linux I just dont know the extent to that.
Any help is appreciated and please go easy on me 😅12 -
Any SUPER AWESOME patient... JS PRO that wants to help me with a few problems it would be appreciated..
Okay so I'm having trouble with JavaScript and this can apply to other languages but for now focus on JS. so I'm learning how to manipulate the DOM and I don't really know how to start I picked out a tutorial but I'm afraid I wont learn a lot from it. here are my concerns and yes they don't all have to do with the DOM
> I don't know how to learn without mimicking what the person is doing and when I try something that's related I cant use the related information and techniques because I either don't remember, dont want to do the literal same thing for something slightly different or dont know how and somethings not working even though it should be.
> I do it one way and when people offer to help its just me getting responses of how it could be done completely different and I dont understand why either way should be used
> Why should I have to generate a webpage or div if I can just use HTML5
>whats the difference between JSON and Arrays???????????
>I am not good with arrays, lists, dictionaries, (I'm stretching to python with lists and dictionaries)
>I recently tried the basic quiz project and it was more complicated and fun than I was giving credit for but I want to do it a different way to show myself I learned but I cant because I dont understand how the person managed to loop through the entire array printing the individual questions and answers to the div. like I understand the parts that use the html tags in the code but I dont know how when or what to use it all
>any good javascript/dom resources?
At this point Im just stressing because all I want is a basic skillset with JS but I dont feel like Im learning anything and I dont know how to apply my knowledge or improve upon the programs ive been learning from or trying to make. and arrays have been tripping me up to especially since I have no clue what the difference is between them and JSON and why I should use one over the other and dont get me started how shit I am with manipulating them. FUCK IM STUPID10 -
Hello, people at devrant, i have this problem. When i apply to jobs, most of the employers dont answer, then for the few employers that do answer, when i reply back, there is no response, even when i ask them about it. I was wondering who here has a similar experience or know y they do this or how to fix it.13
-
Customer Service(cs): clients complaining our site crashes on their computer
Support: they dont have enough resources, its their computer
CS: customers still complaining, how do we fix this?
Support: tell them to get a better computer
CS: lets borrow their information and see whats going on
Support: reluctantly moves customer data over
CS: I dont see anything wrong here. It works just fine
Support: ... ... ... -
How do i get the motivation to keep working on a job which requires me to constantly edit different excel files , knowing that it will only decrease my chances of getting a better job in tech in the future !? I dont think i can even find jobs which pay well now.1
-
I've been selected as an amazon echo tester for my country.
to agree fill this survey and you will receive a free Echo:
*fine*
do you have WiFi?
yes (you already know that i have a fire tv stick so you know even the password)
what mobile os do you have?
android (you already know also this i have the amazon app installed in it)
where do you live?
*my city* (you know that from ip address & shipping addresses)
imagine what them will now that i will introduces an open in mic in my room....
(i think that i will keep it behind firewall when i am not at home and when i dont want use it)2 -
Im beginning to think im stuck in an infinite loop of learning. This fucking bullshit never stops. I just continuously keep learning new shit and the more shit i learn the more i realize how much bullshit i still have to learn
It creates an illusion as if i know nothing
Just when i thought i see the end of the horizon and reach it only then i realize it just keeps on going into oblivion, as a sphere
Its like im trying to catch and find a corner of a sphere
There aint none
Its pointless
Is it also pointless to keep learning like this?
Perhaps this whole existence is pointless
Real talk now whats the point of existence bro
No matter what you do or dont do it doesnt matter
No matter if you're successful or not it doesnt matter
No matter if you learn all the bullshit in the world you're still gonna die and it wont matter
No matter how much i learn, it still and will always appear as if its not enough to these shitface recruiters and companies, to them it doesnt matter
Nothing matters. Everything is empty and meaningless. The entire life itself is. I dont value life. I dont care if i live or die. I feel no joy when i succeed and i feel no sadness when i fail
The tiny little bit of joy or success cannot outweight the years of sadness depression emptiness and failure the life has dumped onto me in spite of my hard work and continuous learning
Hhhhhhhhhhhhhhhhhh20 -
implementing ticket from epic somebody else did breakdown on
someone from other team mentions that we should be getting approval from their team and preferably avoid doing stuff in this legacy repo
im just a code monkey, i didn't make the decision (or know the nuances around it), nor did i want to be in that old legacy repo
pain
i didnt know, i dont know what i dont know,
how do i do better next time...3 -
on a pleasant note,
Seriously, fuck myPhpAdmin. Fuck c9 and fuck MySql. My connection is solid i can do mini crap. my ajax call is good too. so idk why.
Ive spent over a week on a bug and now “occasionally working” is the best I can get and im not even sure why.
This assignment is due today.
I cant even try to do it locally cause for some reason myphpadmin and mysql dont wanna work on my laptop so yay fuck me.4 -
I have a problem. I can't do anything.
I can't really get started with the new path of software development. I have lots of stuff (like *tidying the room* or *exercise* or something good for my life) do but in the end all the things I have to do are tangled up. So learning usually gets in the pile of tangled up shit.
I try to use organisational tools. But my focus is zero.
Mental health issues don't help.
I think I would put at good use a few coding buddies, mentors, whatever... Self paced courses dont work for me. Bonus point of notgettingshitdone if online course.
I have low self esteem and I'm not trying to hide it.
I hate myself to the fucking core.7 -
Had a freelance client half a year ago, they called to do some edits and adding features yesterday. But i dont work im web development any more and no longer feel like doing it. What should I do. Can i just bail or do i give the their money back or whats the best course of action here?5
-
i dont know npm
today i learned `npm install` in root project directory doesn't do what running `npm install` in a subdirectory that actually has a package.json
in this case there was no package.json at the root project directory if it matters
shoutout to fucking eslint not telling me to try installing the fucking packages it can't fucking find, as im a monkey who doesnt know what their doing
well i suppose this is irrelevant since there's yarn, gulp, webpack or whatever is the new hot front end package manager thing1 -
soo, i am unknowledgeable of ALL best practice.
lets say i call a php file called loader.php with a $_GET['type'] parameter, then after i check if type is actually set i switch the parameter and my logic then does stuff appropriate for $type..
do i create a lot of sub files with the program logic in it or do i just create subfunction (which i have to pass variables if necessary)?
Switch( $_GET['type'] ) { case 'foo': include "logic/foo.php"; break; default: echo "error"; break; }
or is the whole concept totally alien and stupid? i most honestly say that i dont know exactly what i could google to find an answer3 -
is it better to work on a project every day even when i dont feel like it but then do like 80% of the work for the next milestone with a shitty code (done alot faster)
or
work on a project when i have the will to work on it but then do 30% of the work for the next milestone with a clean code? (done alot slower)3 -
Neever give up on a project if you think you cant do it try learning the skills needed to do it, watch tutorials look at other projects, well i say never give up but if u seriously cant do it due to other issues other then skills well the. dont do it BUT NEVER DELETE THE PROJECT THE CODE CAN BE VERY IMPORTANT OR GOOD FOR OTHER THINGS YOU MIGHT NEED SIMILAR CODE FOR
-
Devs : use azure devops becuse our product is on azure
Managers: but we only know how to use jira
Architect, okay then pay us for migration to bamboo and bitbucket so we dont have to use dual systems.
Management : whatever you want do it for free4 -
Im creating a "settings" functionality of sorts, unique per "account"
Ideally I'd create a new table, FK it with the Accs table with each Setting variable being a column
But im also inclined to just turn it into a JSON and not bother with N columns for it specially since arrays are involved in the settings
Could version it to ensure that if Settings change on code-level, old accs with old settings dont get fucked up
Now this is a pet project so im free to experiment, not bound by high level design documents
What do y'all prefer/recommend? JSON<->Settings Obj or plain old Table/column with FKs9 -
!dev
Why must I always be the guy that has to connect with people?
So I'm applying to a retail job, and the section manager, lets call him Tim, is kinda low energy.
Come in four days later after the first meeting, to just let him know I put in the application. We're talking, talking some more, and he basically wants to hire me but says it usually takes 1-2 weeks for the background. Well that's nonsense for a retail position doing stocking, but alright.
And I'm heading out the door, say to him "dont kill yourself on shift", he doesnt even laugh, just flat affect, monotone, "I know I still got an hour and a half on shift."
And as I'm driving away I'm thinking, that's how the entire conversation was like.
It wasn't just misery or tiredness. The dude, Tim, I'd seen that face and heard that tone before.
Its the behavior of someone who actively doesnt want to be alive.
And as I'm driving away, I'm just thinking, how do I go back? How do I go to this total stranger, who I'm also applying for a job with, who I just met, and say *look, I dont mean to get personal and this is probably uninvited but I know something's up with you. You were like this last time I met you, and you're like it even more now. I know bro. I know. You think no one sees you're going through something, but I do.*
I see shit like this and it's so obvious and by the time I realize I should say something, the opportunity has passed, the moment has passed. And it's like, is it even my place?
But to see someone like that, to be familiar with that look on their face, and to let them walk away...
I just dont know.4 -
Do you think is it worth buying macbook air or some other laptop for the same price? I know I can get better specs for that money but I dont game or do a lot of video editing so I Don't need a beast graphic card, I just need it for coding. What do you think?6
-
Make an Async task (Java) and...
DONT use a loop to iterate though a time series collection. Don't linear search that shit.
DO use a queue and pop() it like its hot. Check that shit to see when it needs to be used instead of searching.
DO assert that your time series data is in order (Predication mother fucker).
DO throw an exception that you data is all fucked when it's all fuck up.
Stay sexy and use a fucking queue man.5 -
Hey guys so I am currently working in a recruitment firm. (Don't ask why.. it's just for money to fund my abroad studies).
My passion is android development.
I dont get time for development as i spend all my time on job and end up being tired.
My question is would it be awkward if i brought my laptop at work and coded during my lunch and break hours. I could totally do that.
Would it seem awkward to fellow colleagues if I brought my laptop and coded.
Can someone plzzz advise me about this😓😓9 -
I dont get it, why do all those authentication providers want you to use a separate webpage to handle the login, why cant i just have the form and "login with ID provider" buttons on my page.
Why is the user forced to take another step in the flow...
this is UX 101, comon!5 -
I need a place where i can put fck in some moments. I dont really want to scream it out. What do you guys do in these situations?6
-
Alright so this is just me throwing my thoughts down from today cause I need some outlet.
Gonna start programming a lot more than I do now cause I want to improve and I enjoy it.
I started my JavaScript course and that's going well so far. I need to figure out a way to make the info stick. I'm gonna def use the projects from each day as resources though.
I need to practice python (which I'm good with) occasionally so I dont lose my magic touch. I was thinking of doing a project on a raspberry pi that uses a camera for object/facial recognition and picking projects like that and occasional small ones I do in js.
Although theres still a lot I have to learn on the DOM side of js. I dont want to be a front end dev cause I dont have that artistic eye so I'm mostly gonna use it for node and small front end stuff
But mostly I need to be able to grasp more from tutorials, examples, courses, etc. And understand how and when and why I should use whatever it is.
Also I wanna use someones code to learn but it's never documented well enough for me to know what's happening I'm mostly referring to when theres a library or api I'm unfamiliar with.
Also JS is getting a little boring so hopefully python will help dull that feel6 -
Looking at code from previous devs...which I now support...
Oh hey there is a function to retry connecting to the database if it fails to open...ok...
It doesn't return anything e.g. a boolean. Not a big deal I'll catch the exception...
It catches the exception and silently ignores it? WTF how do I know if it fails??
It keeps trying for 20 seconds...sounds reasonable...wonder how long it waits between failed attempts...0. No sleep, no back off, literally spams the open call as quick as it can throw the exception...
I'm glad I personally dont know them. They are fucking idiots. -
When u shit do u put toilet paper on the water in the middle? I do it my whole life. If i dont put it then the shit splashes and water comes straight into my asshole (inside literally) and makes my rectum wet. Thats why putting toilet paper slows down the inertia of shit fall according to the laws of physics i studied in college. Never thought learning something in school was gonna be useful but only for shitting big shits. No wonder why degree is worth less than a shit and no one cares about it9
-
So we have this year end goals thing at work and the managers pick the goals for us, we dont get to do it
My manager picks for me security topic, the items in that are as follows:- have training sessions, define web security standards, Ensure team follow standards, Identify issues with current implementations
I am damn developer, that's another fucking job!!!3 -
It is sooooo annoying when team memebers keep on finding mistakes in your work instead of actually contributing themselves. And when they do its way past deadlines and it completely ruins the project cuz they dont want your version and they dont want to do anything themselves. Aah too much blabbering lol!2
-
Okay, my first serious rant.
An acquaintance of mine when needed my help always explain his problem equivocally. Like, he would explain laboriously of the method to achieve what he needed when the thing he only needed is just a simple API call. Im not saying im an expert in this area but his explanation doesnt help me to understand his problem. If i do not understand his problem, how can i help him? At least if i know what his problem is and i cant help, i can seek help from others.
And hes not even working in the same company as me. And he wants it solved ASAP. I dont know your problem, yet you want me to solve it? I dont even know if im capable of solving it! And I have my own job to do..
He always try hard to explain it. He tried to sound professional. And he always ask for my help first because I knew he doesnt want others to know that he doesnt know how to code. Why do you apply for the position if you know you cant handle it?! Everytime. He's been fired before. And he did it again. I cant. We are fresh graduate. Apply for a fresh grad position. If you dont know anything, just said you dont know unless youre very quick to learn..
I remember once we need to submit a linux commands or something homework. We need to code it during the class and submit it by the end of the class. He asked me to code for him while mine is still half done. "Quicker please!" he remarked. There were still plenty of our classmates still doing it and some even havent done it yet. What the f are you rushing i felt like slapping him in the face with the keyboard at that time but because i am a matured adult i did not do it.
Hes not even a bully he just always get panic without reasons. He wants things done early and then he can post on social media. "Oh so tired this program is so complicated" or like "Oh damn, they want me to lead the group again (roll eyes emoticon)"...
Please somebody run over him.
Hes making me bald everyday and i think this is unhealthy. If he wants to get bald, get bald alone. I was just starting to work but my hair has been falling everyday.5 -
'cracking' in our language (Turkish) is using the same meaning with 'to break' verb
+i want a program for drawing something and i searched for it. i found a program name, photoshop. do you have it?
_i dont have its files but if you want i can find
+can i install it myself?
_it needs cracking. can you do it?
+why we broke program? i cant use broken program. i am not a nerd. give me health program. dont fool with me
_?!?!?!?1 -
!rant
Hello everyone
Do any of you python programmers have any tips for simple projects you can do to learn python?
I am mainly a backend/system engineer comig from C++, slowly picking up rust and have been using bash as my scripting language so far. bash is nice because it is so fundamental in the linux world but you just dont get very far with it and its usually not pleasant to write.
So I would like to learn python, though I have no idea what I can do to practice it, so that I can just quickly whip up a script the next time I need something done in the file system or want to write a simple parser for something.
Do you guys have an idea of something small (not necessarily useful) which makes use of pythons strengths? Just looking for ideas here, so stick it all out 👋💕12 -
How to deal with micromanagment?
I just lose it when the team leader checks on issues on a hourly base, And dont get me started on the scrum master who checks the sprint status twice a day.
I can't quit this work but I'm losing mind here.
H-O-W T-H-E F-U-C-K do i deal with this idiotism??5 -
Not completely a dev thing. But now days it seems like everyone is either an audiophile or a master at phone design. Like for REAL! What do you want???
This sounds like crap (has HD Sound)
This looks ugly (any and every phone)
It seems like there a lot of trolls that just go to events they really don't like... Why do Samsung Fans watch Apple events??
You dont see vegans going to every meet market they see.... Like for real..... -
A question for people who are active on the open source community or anyone who succeeds in crwating some small personal coding projects.
How do you do it?
Do you have any advice on how to be more efficient when working on personal projects?
Each time I get an idea i try to start it but just give up or get discouraged by some related setups.
Also how do you find interesting existing projects to contribute to?
Please help. I wanna do more but never do anything. Am I alone in this situation?? I dont wanna get stuck in this loop anymore.2 -
I dont understand why people seem to get offended when employers/recruiters ask 'do you know XYZ'?
If you know it, say Yes.
Whats the problem?1 -
emails....
how is it that every service can send out so many emails?
30,000 emails just this week, and those are just the ones i dont automatically delete.
how do people deal with it?2 -
External Storage recommendation questions.
Im in need of some sort of external storage, either a harddrive or a NAS server, but idk what to get.
Price should be reasonable for the security and storage space it gives, so heres what i figured so far for pros and cons:
NAS Server:
+ Bigger capacity
+ Raid option
+ Easily expandable
+ Always accessible via the network (local)
- Difficult to transport (not gonna do that, but still)
- Expensive
- Physically larger
- Consumes power 24/7 (i dont pay for power currently)
Harddrive:
+ Easy to pack away and transport
+ Cheaper
- If drive fails, youre fucked
- If you want larger capacity, you end up with two external backups
What do you guys do? Im not sure what i should do :i
Any advice is appreciated.
It will be used for external backup, as mentioned. For my server and my own pc.12 -
Anyone used appwrite? (opensource free backend server, gaining popularity in competition to firebase)
How does it work, if i wanted to deploy it to prodution real world aws for example do i have to pay? Or i dont need aws at all?2 -
When you dont want to code a 100+ field form but still doing bcz you made it to office and there is nothing else to do
-
So i was told to make a code to iliterate through some categories from web... And then boss added subcetagories... And sub subcategories... And after a while a sub sub sub sub categories... Code was piling up and boss says "dont worry, you can do it"... So i ended up with a loop within a loop within a loop within a loop... About half a milion combinations... HOW DID YOU BECAME A BOSS WITHOUT LEARNING TO DO MATH BITCH?!2
-
I have a big web development requirement from client using java. I have suggested them for using Php/mysql but they dont want it. i am not sure which framework to use in java, whether java can be deployed on AWS, whether java would be as fast as php.
Please share your java web development experience and how do i go ahead.8 -
Hello good people i need someones help... i want to build an online teaching website for practice ... like treehouse or pluralsight but a much more lightweight version.
I dont know how to start ;
Which skeletons to use.
Which cms do i choose if necessay.
Should i use node.
Should i use react.
Where do i host it.
Why do i need each point mentioned.
What else do i need.
I learn a lot my self but i really need direction on this one .. its my first big project.
I intend being a freelancer.
I could also do with mentorship from anyone willing here.....!!!!5 -
Does anyone here knows some efficiant way for stupid Broadcom wifi card to work efficiant on linux? Its Bcm43142. I recently transfered on Manjaro by suggestion of fellow ranters, but little that I knew or I wanted to forget from earlier experiences that Broadcom is bag of balls that noone wants and that it doesnt work correctly on any distro. I'm feeling like protagonist of that meme "C'mon, do something...". I really dont want to give up on linux once again cuz of dump wifi controller.7
-
So, next monday I will be starting a new project in my company, the very first I have to manage as a sort of project owner in addition to my usual develer rolem. I will be asked to manage the relationship with the customer and all' the details, issues et cetera. Well, I dont know if I am ready and I tought to ask here some advices. So, what do you experienced developers suggest to a fresh meat? (2 years experience pro it world)
-
SWIFT 3 sucks! SUCKS I TELL YOU! swift 3 changes the NSError class to its own Error class, now the categories (i.e the extensions) that I have added to the NSError class (like convenience inits and NSDictionary map to my own variables) are ALL LOST !!! MORE THAN 100 LINES OF CODE LOST!! because of this piece of shit mutation of the DATA TYPE ITSELF!!! when objective C code is used in Swift (using the mix-match technique) DONT UPGRADE TO swift 3.0 GUYS DONT DO IT!!! especially if you have legacy code in your project !!2
-
People ask me who do i support israel or palestine, to which i have no clue, i know nothing about both, i dont care about both and i have nothing against both, but whenever i have to choose a side and dont know which one i just look at what america chose and immediately i know they chose the bad guys because america is the biggest terrorist organization to ever exist on this planet. This means israel is also a terrorist country because it inherited their superior terrorist master country
However after seeing what these palestine barbarians do to israelis on https://watchpeopledie.tv/ and seeing them how happy they are whenever they kill someone, they're so joyful and blissful as if they won a billion dollar lottery, i will choose not to in fact stand with palestine, as they are no better than the terroristic israel country, so fuck palestine too
I view both of them as terrorist vs terrorist fight. A cartel vs cartel. I dont have to choose any side to support in this case
There you go. That's how a logical, objective, rational mind creates conclusions and decisions based on facts36 -
!rant
Hi i dont do open source projects often .
But i want to publish some as open source .
I dont know much about the licensing i only know about gpl3
I dont know if any license offers this thing i need or not .
I need one that allows others to compile and publish their own with ofcourse the given credits
But they cant sell the app . I want keep it free for ever
I saw some big projects that people compiled and sold and that really hurts and the project developer got unmotivated and discontinued the project :(6 -
What are the skills that are essential for developers and computer scientists in general but are disappearing/rare.
Ill start it off with sayin probably the relation of a developers code on a hardware level, i dont see many programmers knowing about what happens under the hood when he chooses an if over a switch.
What do you think?4 -
Nextjs
I just realized
unit tests and integration tests dont exist in nextjs
So now i wondered
What about integrating AWS cloud functions with nextjs?
What about docker with nextjs?
Kubernetes with nextjs??
How TF do u implement a CI/CD pipeline with nextjs if there is nothing to test?!?!??
Nextjs seems like itself is self sufficient. WTF? Everything has been packed and cluttered into 1 giant pile of horsedump and called Nextjs Framework where you dont need k8s to run it or anything. Might as well then rename this fucking "framework" to GOD of all frameworks since it appears it can fucking do anything and everything without requiring HEAVY DevOps bullshit.
ALL of it can be cluttered in 1 nextjs project and you have a fully functional production working website that can basically do ANYTHING and EVERYTHING.
How???
Am i fucking going insane? Am i missing something here??19 -
Guys I wanna do android dev. Don't wanna make it my mainstream but need it for some projects. So which is an easy way to develop mobile apps? I dont wanna do android studio. Maybe a JS framework.2
-
At my current internship it depends on how often the customers mind does change about the design of the moment. Ending up with an average time of "i dont know, lets just do what he asks"
-
Hello chat, its been a long week with no progress, i have four problems right now.
1 node js repl cant recognize <> in js, and i cant find a fix for that anywhere on the internet, is there a way to convert html tags in js to smooth brackets code?
2 node js repl dosnt recognize codes like import react from react, and i have to do an async function load, and i dont know y or how to fix it.
3 i dont know how to write import exg.csv into an async function load, its usually something like “import react from react” to “async function load(){let react=await import (‘react’);}”, and i dont know how to do this.
4 i tried to install materials.ui using npm into a folder called materialsui in modules in node, it deleted all the other modules in module folder, installed, and then left the materialsui folder empty. I complained and i dont know how to get it to not do that.
5 how do i fix out of memory errors?8 -
Do you guys have people in your office that just REFUSE to cooperate, or people who tell you they'll cooperate, but then they literally do anything except for cooperate?
I'm having trouble with the latter; I've been trying to get one of our less experienced members to work on our deployment. He's successfully configured at least 4 other deployments, and this one is the EXACT SAME as the other ones. The issue is that the person who is im control of this particular master console is someone higher up than me, but they don't know how to delegate. Thus everything that they touch becomes their own little pet project that no one else can dare touch, because they'll "mess it up" (not do it the right way according to his limited bible of best practices).
So now I'm stuck here, trying to convince HIS BOSS to get him access, but i even HE cant get him to do it! Now I'm sitting here waiting, getting more and more fed up with this guy, because like i said, it's his MO: im on two other projects with him, and they're all moving at a GLACIER'S pace.
Seriously, if you dont have the time for a project, but it on the backburner, dont start it and make your other projects suffer.6 -
Can somebody please explain to me what this company does?
https://www.signavio.com/
Its kinda technical mumbo jumbo for processes?
Appearantly its pretty much worth because they been bought up by sap.
Sorry if it does not belong here. But i really dont understand these management process optimization tools and why they should be so important? We do our stuff with confluence and jira and thats it. But we are also a software conpany nothing todo with hardware...6 -
Hey guys,
I have to Select my Bachelor thesis/topic in the next few days. I would like to do something with Crypto Currencies especially with the Blockchain System. There is a wide range of usage for that and i Think it could be very interesting.
The Problem is that am Not Really Sure what Topic or challenge my Project could contain. There is much to say about it but i dont Think it would be enough to just describe it.
There should be a Problem or anything like that I can solve..
Or Is it possible to just Analyse the blockchain and the affect it have These Days and the Future?
I would appreciate a few ideas or suggestions :)
Regards
Birdy513 -
What is the correct way of pulling the latest changes via docker?
Please write step by step commands.
This is how i do it:
1. docker build -t dashboard:latest -t dashboard:v2 dashboard/.
2. docker rm -f dashboard-latest
3. docker run --name dashboard-latest -d -p 8081:80 dashboard
So...
1. Build latest changes
2. Remove the old container
3. Pull those latest changes
---
Is there a better way? Less commands? Is this the right way to do it?
Sometimes the changes dont get updated so i waste hours of time trying to figure out if i fucked up the commands, or order of commands, or if its some caching problem etc.
Teach me the right way once and for all.9 -
Been seeing some ridiculous dumbshit comments regarding war which piss me the fuck off so I'll address them here
---
"xyz country did not abide by the rules of war"
What RULES in WAR? WAR is WAR, there are no fucking rules! Anyone can kill anyone however he wants to!
"Using xyz is illegal in war"
What can be ILLEGAL in WAR? WAR ITSELF is fucking illegal you dipshits. You just made a crime legal, normalized it and called it WAR
"Doing xyz is a war crime"
WAR-CRIME? WAR ITSELF is a fucking crime you cuntfuck! You cant do further crime than participating in war! While you're legally doing that crime you might as well do anything else illegal because now everything is legal in war, there is no such thing as a fucking war crime
"Do not kill women children and the elderly in war"
Why the fuck do they get a free pass? How about the 18 year old, 25 year old? Its fine to kill them? Who the FUCK are you to say who can be slaughtered and who cannot? Get the FUCK off my dick you fucking dickriders. If some groups of people can be slaughtered THEN SO CAN WOMEN CHILDREN OLD FUCKS AND BABIES BE SLAUGHTERED! DONT GIVE A FUFK. Either stop the fucking war or dont complain who got slaughtered.
NO RULES IN WAR.
NO MERCY IN WAR.
Same way how recruiters show no mercy or compassion in hiring. They dont give a FUCK. They fuck with everyone and waste everyone's time. Same way in war. Fuck anyone. Slaughter anyone. OR. Dont begin the fucking war in the first place7 -
In the first place I dont do it that often in private projects because the estimation is always wrong.
At work i just think about best and worst case scenario and the average time it could take. If the the worst case scenario is really time intensive and there are a lot of factors that could go wrong in contrast to the best case, I significantly increase the estimated time for the task. Otherwise its 1/6 best case; 1/6 worst case; 4/6 average time2 -
Hello people i have this problem and i think it is serious because it happens chronically. I am trying to get the word out about business services that i offer, but immediately they think its a scam. They dont know what company it is, or what it offers, or if it even exists yet, but “it sounds like a scam” … ? Is it a scam or not?
Do not do this. Always verify the source of your information to its legitimate source to know that its legitimate. Do not quickly assume that its a scam because because your pancreas gurgled. Your organs cant tell u whether something is a scam.
By just assuming, u display unprofessionalism by making an ass of yourself in front of a real agency. U also make yourself more prone to real scams who can act like what u think is legitimate. U also lose any opportunities u could have had, because u had to be an ass when it was being offered to u. Dont do that.6 -
Developed an app for an ionic developer with React Native becos his boss ask for it and 8hours before presentation he ask for code to make minor modifications I never ask him if he knew react native but gave him the link to the repo becos I was told he can adopt anything fast😲 fast? enough to learn react native in 8h understand the code and make modifications? 😂😂well that sound super genius. To cut it short he had to ask me to do the job😅😅. And I was like should have said you dont now react native it ain't IONIC!!
-
to method java doc or not to method java doc
i'll do whatever we're supposed to , but i dont see consistency in industry or my slave drivers
i remember when i first did i was told not to, but then a new senior hire comes in does it and nobody bats an eye1 -
Welp. I get into work to find there was a powercut at the weekend and 2 pc dead... I just moved the power plug on one and magically it starts. then when trying to boot the other one in safemode that suddenly starts working! There are times I just dont get computers or why they do the things they do....
-
So I finally had a good idea.
I have programmed a proof of concept and now dont now what next.
I would like to make it open source and let people benefit from it. But at the same time I would like to make everybody using it to generate money pay a part to charity and a part to me.
How could I do this? Do I need a patent or a licence or what?
Is this even ok? -
Front-End developers :
Guys, what should we do for dark mode ?
Hmmm..
Guys:
Background-color: black
Thats enough, DONE.
No,no dont forgot this :
colo:#ffffff ! important.
Thats it.2 -
self.content != rant
my proposed project was accounting system for small scale businesses. after painstakingly copy pasting codes xD from an existing project(which i have previously made during college days), although i have already anticipated this idea and wasnt really planning to create a five-star-in-usability kinda system for a small project, i realised that i cant make accounting a standalone system, it has to be a module. just a module. but i dont like that, it defeats the grand purpose of what i really want my system to be, it has to be a standalone system with fewer user inputs.
welp. gotta do what u gotta do now. create additional modules(inventory, invoicing, etc). also deadline's a couple of weeks from today.