First off I dont mind what OS you are using. This rant isnt about the OS but about hypocrisy for some of the users. Secondly Im sorry for typos, I typed it on my phone while waking up.

People are calling Windows spyware, so they are using Linux or MacOS. Even though I disagree with the term spyware I would be fine with that if you weren't a hypocrite.

How many of the people who use Linux and call windows spyware uses Google, Apple, Facebook or Twitter once in a while? I highly doubt you if you say you don't.

A few years back Ive tried to live without anything of google, this also meant blocking YouTube, their trackers an javascript libraries.
Not much of the internet still works if you block google servers.
Google is everywhere and always collects data.

Facebook and twitter also collects data about you. Everyone who has your number in their phone will share it with Whatsapp and google so they can build up a profile. Even if you dont block it.

What I am telling you is that its impossible to avoid being tracked by these companies (including MS).

Every company I mentioned here has a profile on you, if you want it or not.

So let's check which of these companies tries to follow European laws.
Google gets fine after fine but doesnt really try to avoid it.
It looks like Apple, MS, Facebook and Twitter are doing it better on this.

But if you check the European law every European citizen is allowed to request their complete profile collected by a company. And that means complete and not the public part you volunteered to give away.

So I tried it out.
Google didnt want to give it, apple didnt want to give it, Facebook didnt want to give it and Twitter doesnt want to give it.

The hypocrisy is becoming clesr with the following. I did get my complete profile from MS. It was a messy PDF file which crashed most PDF readers.
It contained a list of people I know and how I know them. It contained MS accounts I had in the past and my hobbies. (and quite a lot more)

So from these big companies MS is the only one following the European Law.

So yes they do collect data, but they are open in what they collect.

And Im not saying here that Microsoft is great just because they follow the law.

You can have your own opinion about this and do with it what you want. I just wanted to share some, maybe alternative, facts.

And again this isn't an OS rant or whatever. I dont mind what you do, but I do mind hypocrisy.

Back in the days...

Parents: get off that computer it will get you nowhere in life!

Me:But im programming not playing games..I want to become a programmer...

Parents:programming or games it's all the same! Take an example of your sister who actually achieved something with her studies (she's a doctor)

Me today asa computer engineer...receiving paycheck higher than my sister who is a doctor and not to mention I got a car of the company and living very comfortably.

Parents can't believe it.

#rekt

Moral of the story: never let anyone tell you what to do. Keep doing what you truly love and get real good at it!😉

So my Girlfriend bought a new iPhone at Verizon today. Cool story, I know, but here's where it's gone from there.

Firstly her debit wouldn't run as credit, so we used mine but that's the least of it (but began it).

So she has 16,000 photos... Alot, sure, but not the issue. Obviously with that amount of data she wasn't about to reasonably use iCloud to back it up (understandable only by me) so she was confronted both by me and the Verizon employee about this issue to where we both (the Verizon employee and I) agreed that an iTunes backup/restore was the only way to preserve her data. She was confused. No worry, told her I had it handled and the Verizon employee agreed. Great. Yet we get home and begin the process. My girlfriend was not on the latest iOS (understandable given the battery scenario and she was on an iPhone 6) and this was ridiculous to her because she had to update in order to do the iTunes back up. Whatever, I brushed it off. Her phone was updated, and backed up... Which took a while but we are talking 30gb (of which she had no understanding of how much that was). After the back up we discovered her new phone wasn't working due to a bad sim, great, no problem we have the old one... But oh no. "I don't want that shitty old sim" she said. Uhmm what... I say, and say let me get an earring (to switch the Sims) and she gave one to me and as soon as I went to pop the tray, she had a fucking heart attack as if I was demolishing her phone. I talk her down, get it switched, get the phone to restore (slow process as she's complaining... 30gb mind you) and it works. She goes to bed. Comes back, texts aren't working. I say imessages or texts (now she has no idea) I troubleshoot, seems nothing's working, and that's okay Verizon must of reinstated the new sim and deactivated the old (fine). I switch them and it works. She proceeds to berate me about the SIM cards because she didn't want the 'old shitty one' (the one that got us to the place of a functioning phone).

Now everything works and she claims a Genius bar employee would of done this in minutes.

I (obviously) lose my shit, now I'm sleeping on the couch.

Im an IT professional / programmer..... this shit really ticked me off.

Do not continue reading if you value your life.

Visual fucking studio 2015 installation. MOTHERFUCKER !!!

OK new project will only work on VS2015. Need to download it. OK, go to MS website. Project works with community edition. Fucking great. Download the installer. Run the installer. MOTHERFUCKER DON'T OPEN THE FUCKING BROWSER TO THANK ME, YOU FUCKING FUCK. Ok...Wait to download the packages. One fucking eternity later download completes. FUCKING GREAT. Proceed to package installation. After two fucking hours installation progress bar stays the same. Google "vs 2015 installation stuck windows 7". MOTHERFUCKING BACKGROUND PROCESS IS FUCKING STUCK AND INSTALLATION DOES NOT CONTINUE. FUCK YOU. I'VE LOST TWO HOURS. OK, stop the process. Installation gets cancelled. Run the installer again. STOP THANKING ME YOU PIECE OF SHIT :@ OK, check again all downloaded packages. All good. Continue with installation. Installation completes. MOTHERFUCKER WHY YOU WANT TO RESTART THE WHOLE SYSTEM ? FUCK YOUR WINDOWS UPDATES. Ok, restart and be done with it. SSD to the rescue. Try to set up the project.

MOTHERFUCKER I DIDN'T INSTALL THE C++ PACKAGES. WTF WERE YOU DOING ALL THAT TIME? OK, run installer again and install C++ packages. I SWEAR TO GOD MICROSOFT, IF YOU THANK ME ONE MORE GODDAMN TIME, YOU'RE GETTING HATE MAIL.

Ok, installation completes. It's coding time. NO BITCH. VS2015 silently crashes after splash screen. :@@@ Google wtf is wrong again, turns out the C++ packages fuck shit up. Ok, pass some arguments to devenv.exe to reset. Restart VS. Ok, seems to be working now. Make a test project. Fucking awesome. Close VS and get the project files from perforce.

OK, files downloaded. Open VS again....

VS: "You're my bitch, you won't code today. Run from console and pass some shitty reset parameters"

YOU FUCKING FUCK. GO FUCK YOURSELF UP YOUR FUCKING ARSE. Ok, pass the parameters from console. Run again. Same "you're my bitch message" :@ OK, run with administrator rights, opens like charm. Run without admin rights again, "you're my bitch message". :@@@@@

Restart system, VS2015 finally opens project normally. Build project, 6934 errors.... :@ I'M DONE ! IM GOING BACK TO LINUX PROJECT. FUCK YOU ALL.

Back in 2011 when I was 14, I created a cmd shortcut on all pc in my school's computer lab. Replaced the icon and renamed it to Internet Explorer. Deleted the original IE shortcut and a week later the lab got closed because they all the computers got infected with a "virus"

i know im lame kill me

I came from a village, we have animals (like a farm), pigs, chicken, sometimes duck and goose. One day I had to work from home, bc had to come back to parents house. Our daily skype meeting was like this:

* discussing very important IT stuff *
* grandma rushes into my room *
me: sorry, but i have a meeting
grandma: i just wan...
me: but i cannot right no...
grandma: just wanted to know if...
me: grandma, I cannot right now, we have a skyp... im talking with colleagues, on the computer
grandma: * quiet voice * okay, i dont want to interrupt, I just want to know - Did you ordered the ducks?
* what I hear in headphones: collegues and boss LOLd sooo hard *
me: ffs, what ducks?
grandma: did your father not give you the guys number?
me: * starting to sweat * what guy? no he didnt, i have no idea what youre talking about
grandma: * disappointed * then who gonna order them...?
me: ...
grandma: * standing next to me, she hears the laughter * whats that?

since then, if im working from home every skype meeting starts with "Tommy, is your grandma there? HAHA!"

How I went from loving my job to wishing i dont wake up tomorrow just to avoid it.

Ive been a backend dev in the company im at for 2 years now.

First year was a blast, i loved my work so much, I used to get so many random features to do, bug fixes, campaigns, analytics, etc..

Second year i started getting familiar with the part of the code that has to do with Search in our music streaming app. Nobody wanted to work on it, so i wanted to take initiative and start doing a few tasks.

A few tasks turned into sprints, and sprints turned into months worth of sprints. And because the code was the definition of tech debt, and because it was so messed up that changing one thing can blow up everything else, working on Search was not too fun.

However, people seemed to be happy search tasks are no longer piling up and someone is handling them so that used to make me feel good about it. They also gave me so much freedom and i felt like my own manager because no one told me what to do (not even my actual manager) they just let me be and were happy i was handling the part they want nothing to do with. I was also given an intern to mentor and have her work on Search tasks with me which turned out amazing.

During the last few months, I completely rewrote search, made it 10 times more performant in such a neat way, made an inhouse dashboard to automate certain tasks so we wont need to waste developers on them (all of which were extra effort on my own time without being asked), all meanwhile still tending to the fixes of the old implementation.

I felt so accomplished, and in a way, i felt like a lead (even tho im not managing any employees, i had so much freedom and I was literally responsible for everything about Search and if i decide to play with the sprint task order i can even do that).

Then 6 or so weeks ago my manager left the company, and while i thought id be a standalone team / person (single person teams are not uncommon in the company) i was instead put under someone else. Someone who likes to micro manage the fuck out of me. I have been happy working on shit code because it was my baby, my project, no one interferes and no one tells me what to do and everyone would call me the search lead (unofficially). now if i dont report to that guy every two hours he calls to see if im working. preplans sprints i no longer have a say in, and im the only dev who knows the code so all tasks go to me. I feel i got demoted so fucking much. I felt like a lead on a project and now im back to being a normal code minion. From deciding everything about a project to blindly following a some irrelevant manager's opinion. (who btw is making Search worse) And after all the extra effort i put in, after actually caring, after actually embracing Search as my responsibility i get rewarded with losing everything i liked about my job...My Independence. From feeling like a lead to feeling demoted. I am so demotivated.

I love the company, but this is hell for me and this made me hate a job i always loved. I am thinking of talking to the CTO asking to work on other stuff because i no longer want this. If i am to be a code minion at least let it be on code i like, let me go back to dealing with PMs, fuck my new manager I dont wanna work with that guy he can take the project along with all its poopoo.

TLDR; funny revenge prank from my manager

So yesterday (April 2) I decided to prank my manager about me resigning (I've been working with them for 4 years) I wrote a legit looking resignation letter. (No signature) and at the back page it has a small font "April fools".

I asked my junior to help putting it on my managers desk since I was working from home. When my manager saw it he immediately had a meeting with my technical lead. he didnt notice the april fools at the back so I sent him a short email to look at the back and he laughed.

Come today, I recieved an email from our it team with the subject "POST RESIGNATION PROCEDURES FOR JUNNERS". It has some legit looking contents as well as a hyperlInk for a resignation checklist.

It felt like im having a mini heart attack since I thought it was legit. When I opened the hyperlink I was shocked.

I love my job 😂

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Man, we have a snake in our company.

This snake is responsible for terrible code. They oversee a offshore team, but hold them to no coding practices. They don't do code reviews or checks. They let them be lazy and get away with sloppy work every time.

And if you critize their team - they will defend them and get angry at you. You can't adress the problem because said snake is always around. He's in a senior position for giving our company cheap workers, doing years of damage to our product while the non-code savvy managers remain blissfully unaware of their product being ruined in the background.

This snake is the senior product office. He has a share in the company now. He is from the overshore team's country. That team now has their claws so dug into our companies roots and are just pumping lsd's into it constantly. Feels good untill you die from an overdose.

Here I am, the new junior software developer, trying to tear out the claws that have sunk into these roots. Im up against the snake. The snake hates me. I hate the snake. I am trying to open the eyes of the managers. They hate that. They want to silence me so I don't expose the awful, unprofessional level of work they do.

Well, that's too bad. I won't back down from this, snake.

As a full time remote employee it gets lonely. Im getting ready to turn my home into a co-working space :

* Plenty of space with tables and couches

* Gigabit Internet backed by enterprise networking gear

* Lots of fresh ground coffee

* Local Kubernetes server !

* dog friendly chill space

* kid friendly play areas during the summer

* Mountain home with backyard hiking trails , wildlife lookout (wild deer live in my back yard), and fireplaces

What else would you want in your co-work space-at-my-place (TM)?

Fuck YOU Xcode!

20 crashes since I started working this morning.

Restarted the iMac, same shit.

Cleared NVRAM/PRAM whatever its called, same shit.

Closed EVERYTHING, restarted iMac again, unplugged from the wall, left it few mins, replugged back, turned it on, continued working, AND IT STILL KEEPS FUCKING ME OUT OF NOWHERE.

FUCK THIS, FUCK XCODE, FUCK APPLE, AND FUCK WHOEVER DARES TO THINK THAT ITS A GREAT PIECE OF SOFTWARE, im done.

P.S. this rage got me to a point where i had to make this paper

We recently got a new trainee (Not sure if its correct germans correct me i mean "Praktikant"). This guy studied computer Engineering and canceld his studies to work as a developer. So this guy is working on a typo 3 Page for a Client and asks me for help because He got a follding error. Im in the last year of My studies btw. He sends me very Bad formatted HTML template file. I quickly correct the formatting and fix the 3 open Tags That He forogt to Close. send it back to him and walk to his workplace to See him integrate it to his own code again. He Double clicks the HTML file an Google Chrome opens. He then looks at me and says and Where is the code. I say to him That he just opened the HTML file with his Browser. And He responds with yes but i wanted to See the code Not this.

Im done for today 😑😑

When pandemic hit in 2020 I found myself out of work. Until then I used to have a java based pirate gameserver of a MMORPG as a hobby.

When pandemic hit I noticed that online players count increased from like 70 to 200 without much advertising because purely of people being stuck in home. So i decided to scale and spent 2 years with that. What a wild ride it was.

So i invested a bit in ads, managed to reach around 500 online players, opened my own company and launched a couple other successful spinoffs of that gameserver.

First year it was a goldmine but I was doing 10-14 hour days because I had to take care of everything (web, advertising, payment integrations, player support and also developing the server itself, ddos protections and etc.). I made quite a bit of money, saved for a downpayment for mortgage and got an apartment.

Second year I noticed that there was a lot of competition and online players count dropped, but I double downed on this and invested a lot into the product itself and spent most of the time developing a perfect gameserver that would be the big bang while also maintaining existing ones. Clasic overengineering mistake. As you can guess, I crashed and burned on all levels, never even managed to launch my final project because simply the scope was too big and I had trouble finding decent devs to outsource it to, since it was a very niche gameserver.

In the end I learned a lot especially about my own limits and ownership, now Im back to being a dev but working as a contractor.

I believe having actual business owner experience allows me to have different perspective and I can bring more to the table rather than focusing on crunching tasks.

This is my most ridiculous meeting in my long career. The crazy thing is I have witnessed this scenario play out many times during my career. Sometimes it sits in waiting for a few years but then BOOM there it is again and again. In each case the person that fell into the insidious trap was smart and savvy but somehow it just happened. The outcomes were really embarrassing and in some cases career damaging. Other times, it was sort of humorous. I could see this happening to me and I never want it to happen to you.

Once upon a time in a land not so far away there was a Kickoff Meeting for an offsite work area recovery exercise being planned for our Oklahoma locations. Eleven Oklahoma high ranking senior executives were on this webinar plus three Enterprise IT Directors (Ellen, Jim and Bob) who would support the business from the systems side throughout the exercise.

The plan was for Sam Otto, our Midwest Director of Business Continuity to host this webinar. Sam had hands-on experience recovering to our third party recovery site vendor and he always did a great job. He motivated people to attend the exercise with the coolest breakfasts and lunches you could imagine. Donuts, bagels, pizza, wings, scrumptious salads, sandwiches, beverages and desserts. He was great with people and made it a lot of fun.

At the last minute Charles 'Don't Call Me Charlie' Ego-Smith, the Global Business Continuity Senior Vice President, decided to grand-stand Sam. He demanded the reins to the webinar. Pulled a last-minute power-play and made himself the host and presenter. You have probably seen the move at some point in your career. I guess the old saying, 'be careful what you wish for' has some truth to it - read on and let me know if you devRanters agree...

So, Charlie, I mean Charles, begins hosting the session and greets all of the attendees. Hey, good so far! He starts showing some slides in the PowerPoint presentation and he fields a few questions, comments and requests from the Oklahoma executives. The usual easy to handle requests such as, 'what if we are too busy to do recover all systems', 'what if we recover all of our processes from home', 'what if we have high profile visitors that month?' Hey you can't blame them for trying. You are probably thinking to yourself, 'been there - heard that!' But luckily our experienced team had anticipated the push-back. Fortunately, Senior Management 'had our backs' and committed that all processes and systems must participate and test - so these were just softball requests, 'easy-peasy' to handle. But wait, we are just getting started!

Now the fireworks begin. Bob, one if the Enterprise IT directors started asking a bunch of questions. Well, Charles had somewhat of a history with Bob from previous exercises and did not take kindly to Bob's string of questions. Charles started getting defensive and while Bob was speaking Charles started IM'ing. He's firing off one filthy message after another to me and our teammate Sam.

'This idiot Bob is the biggest pain in the ass that I ever worked with'; 'he doesn't know shit', 'he never shuts the f up', 'I wanna go over to his office and kick his f'in ass...!'

Unfortunately...the idiot Charles had control of the webinar and was sharing his screen so every message he sent was seen by all of the attendees! Yeah, everyone including Bob and the Senior Oklahoma executives! We could not instant message him to stop as everyone would have seen our warnings, so we tried to call Charles' cell phone and text him but he did not pick up. He just kept firing ridiculously embarrassing dirty IM messages and I guess we were all so stunned we just sat there bewildered. We finally bit the bullet and IM'ed him to STOP ALREADY!!! Whoa, talk about an embarrassing silence!

I really felt sorry for Bob. He is a good guy. Deservedly, Charlie 'Yes I am going to call you CHARLIE' got in big time hot water after the webinar with upper management. For one reason or another he only lasted another year or so at our company. Maybe this event played a part in his demise.

So, the morale is, if you use IM - turn it off during a webinar if you are the host. If you must use it, be really careful what you say, who you say it to and pray nothing embarrassing or personal is sent to you for everyone to see.

Quick Update - During the past couple of months I participated on many webinars with enterprise software vendors trying to sell me expensive solutions. Most of the vendors had their IM going while doing webinars and training. Some very embarrassing things came flying across our screens. You learn a lot reading those messages when they pop-up on the presenters' screen, both personal and business related. Some even complaints from customers!

My advice to employees and vendors is to sign-out of IM before hosting a webinar. Otherwise, it just might destroy your credibility and possibly your career.

Girl: hello this is amazon support center, hope you're feeling great today, how are you?

Me: im good...

Girl: glad to hear that, how may i help you?

Me: a few moments ago i was on... sigh, actually im not good im extremely sad right now because i was scammed on my amazon account for $250, im calling to ask if that product can be charged back.

*literally 30-60 seconds of silence*

Me: .....hello??

Girl: ok sir ill give u another line to call please dont hang up ok? stay with me

Me: maam im not doing suici

Girl: +1-532...

Me: ...

For years I've had this friend, since high school, and now we are 21. Our paths had always been different, i decided to go to a technical high school that provides more specialized education (around IT in this case) and he went to a normal high school that provides a more wide range of knowledge and barely anything related to what we both wanted to study. Different tastes for different people huh? Well sure but during that time he was being snobbish towards me because normal high schools are considered more prestigious, or rather, technical high schools are infamous for attracting lazy students or students that don't wanna move up to a university.

We fought a few times over this, sometimes even stopped talking for long periods of time but we always got back together. A few years later, after our university entry exams I joined what roughly translates to technical university, its just more focused on practical IT stuff with a lot of lab courses every semester. He joined a more academically inclined one that is half economics and half IT (applied informatics). And now he has another thing to be snobbish about since the relation between the 2 unis is similar to that between the high schools but I don't care anymore, I don't feel like im missing out on anything with my choices.

3 days ago he called me on discord to check his python script and why it wasn't working. Good Odin that piece of code was worse that anything I've seen. Littered with global variables, inconsistent function and variable names, duplicate code, unused variables. I was honestly shocked and disappointed cos he always mentions different projects he is working on, an aspiring web developer.

I took those 300 hundred lines of atrocity and turned them into 80. But more importantly it was something that worked and did the damn job well. A thing of beauty.

I don't know if he was more surprised that i got it working or that it was so different from his initial "solution".

All of a sudden he is not so dismissive of me...

Fuck you for underestimating me and every choice I made to get here.

P.S. I kept his original code, always gives me a shit eating grin.

Real tech.And im back

FKING. LANDLORD. FKING LANDLORD THINKS MY LAN CABLE SLOWS THE FKING INTERNET BACK TO THE 1990s.

- Prologue
I'm renting at a place that looks good af. But the fking wifi is so slow, 80% of the time you can't even send an empty http request.

- Chapter 1
Okay, maybe it's my laptop. *plugs in cable*. Now the requests fail 10% of the time. Better than nothing. 2 hours later, gets a text saying other housemates are having slow internet because of me. FUCK. Unplugs, LAN cable, uses mobile data and cries to sleep.

- Chapter 2
Tries again after a few days. Barely uses the internet (I'm only using it to play games, not even download it and I used more than this with a 2mbps internet). No videos, no music, just small data exchange with a low ping. GETS A FKING TEXT AGAIN

- CHAPTER 3
My sis comes over and complains that the net is slow af. Plugs in LAN cable while no one is around, everything is fine. Sis leaves, I roll up my end of the LAN cable in my room but leave the cable plugged in on the outside of the room. Next morning, it's unplugged. Plugged it back in before I go to work and when I come back, guess what? ITS FKING UNPLUGGED. AGAIN. AND IM NOT EVEN USING IT.

SOMEONE PLEASE STOP ME FROM GOING ON A RAMPAGE SHOVING THE FKING CABLE AND THE ROUTER UP PEOPLE'S ASSES. LAN FUCKING CABLES DONT SLOW THE INTERNET BACK TO THE PREVIOUS CENTURY. ESPECIALLY WHEN THEY'RE NOT EVEN PLUGGED IN ON THE OTHER SIDE. FUCK.

if you are tired, so fucking tired you are not fast enough to double tap a rant.
tap.... *rant opens* fuck! back..
tap... tap *rant opens* *rant opens* what the... back back
tap..tap oh cmon! Not again! back back
tap..tap *++ turns red*
Whohooo im a fucking genius!

Once it really hit me hard. The father of my brothers wife once told me that I'm not fit for IT in general. He thinks that I have pseudo knowledge of IT and Programming.

He just works parttime at home as "computer scientist" and sells routers, pc and such stuff to some private customers. Before he used Filemaker and sayd that he already coded his own CRM with it.

When he said that it really made me sad. But after we talked I looked back what I already achieved:

1. I build for me and friends custom PC's with Case mods and Hard Tube watercooling
2. I can programm in HTML5, CSS3 and PHP
3. I raised a Community with over 60 people in it. We got 2 dedicated Linux Roots (I7-6700K, 64GB RAM, SSD)
4. I manage the Linux Servers on my own with VoIP, Mail-, Web-, MySQL- and Gameservers
5. I built up a complete Community Solution with Game Groups, Forum, Tournament System and a lot of custom scripts.
6. Now Im almost finished learning the C++ Basics to code and manage to learn the beginning of GUI/UX programming.
7. Next thing Im gonna learn is Javascript (Browser) and Java, so I can complete my Web Skills and also can code Java Desktop Apps and Java game plugins (don't rant, Javascript is not the same as Java, I know 😉)

So I thought to myself "maybe in the eyes of others Im not a computer scientist, but then Im on the way to be one at least"

But please dont be a douche (the father) and prejudice me, before you don't know what I already can and achieved.

Just because you're are selling computer parts and installing them doesn't mean, that you are a computer scientist and telling me that I'm not 😉

In IT you're the smith of your own merit!

Coming back to the office after being down with sickness for 3 days. Apparently the two other People on the project doesn't talk together, only when im the middle man making sure they talk, and we got a big test on Monday.....

A few months ago I was working on a (totally underpaid project) where my friend and I had to basically rewrite the entire program our client was using.

So we started planning and wrote all sorts of documentation to show the client our ideas for the new flow of the program, the new structure of the GUI and a few more details of what would the inner workings of the new app. He seemed to like all those ideas and gave us the green light to go through with the project and start coding.

We spent a couple of months coding, redoing the front end from scratch (with a different framework even, so I couldn't reuse any code from the old version) and completely redesigning the back end so it would be better, faster, more scalable etc etc etc. During this process, we obviously showed the progress of the app to our client, explaining everything we had been doing, and he seemed to like every new version we showed him.

When we were in one of the last stages in development (basically sending versions of the app to the client for evaluation), the guy suddenly changed his mind. After agreeing on everything we had been showing him over the last months, he sent an email saying:

"...the new system makes the app too complicated. I want this program to be as simple to use as possible; so we should revert the "Policy" system to essentially what it was in the last major version. The only change I want to make is [...] and everything else is essentially the same as the last Policy system."

So basically he wanted us to FUCKING UNDO EVERYTHING WE HAD DONE AND REVERT THE FUCKING PROGRAM TO THE FUCKING VERSION HE HAD BEFORE HIRING US!!!! WHAT THE FUCK????

YOU WANTED US TO CHANGE YOUR APP AND THEN YOU SUDDENLY CHANGE YOUR MIND AFTER 3 FUCKING MONTHS WHEN THE PROCESS IS DONE???

GO FIND A SWORDFISH TO FUCK YOU IN THE ASS, IM NOT WORKING FOR YOU ANYMORE

God, it feels good to let that out.

My friend who is new to Android App Dev was trying to make a simple app that programmatically takes a pic then sends it as an MMS. He opened Stack Overflow, copied code and i heard him murmur "hmm this is simple". Knowing the future, and the wrath of Android Studio, i leaned into my seat and waited. 2 hours later i knew Andy Studio had pissed all over him and it was written all over his face. I walked past him as if to go to the toilet then back again, his screen was blood red with errors and my heart danced and sang.

3 hours later i was out of the room and he sent me a text saying "I give up". I replied, "well tbh, im suprised it took you that long"

Thank you Android Studio for showing all those who think all we do is copy and paste code that they are freakin retards.

Could you put a backdoor on the software so i can see what my employees are doing ? Don't worry I'll pay you more.

Yeahhhh buddy I'm out, give me my card back.

What the fuck im going back to my open source safespace.

Me trying to use Linux for first time:
Sudo node index.js
access denied
Sudo shutdown
access denied (noob)
Me: im going back to Windows now....

You know what i hate? Applying to jobs and never getting feedback--if a polite "we didn't hire you because x and y" is too damn hard, i would still rather a royal refusal over not hearing anything back at all. It's happened to me 3-4 times in a row now, probably going to be 5 - 6 soon enough. Seriously though, what is this shortage of devs everyone talks about? Because here i am with both hands and a leg in the air high as i could manage and you're not even acknowledging me? I even made a small React SPA once to satisfy a company's questions and show a bit of my competence--you think i ever got a reply from them? Shit, i didnt even get an auto reply. And from what ive read here on others' rants, im far from being alone. At least i could understand why they dont look at me (Bahamian, no degree, never had a dev job, etc.), but for proven programmers to go unnoticed the way they do is ridiculous.

After completing my sprint and some lingering stuff in the backlog

Me: Hey, there's this tiny feature people have really requested, I'll go build it since I got nothing else to do at the moment. It'll only take like 1h

PO: Hmm ok. Don't work on that yet, we need to check with business people and agree on the user stories and bla bla bla

Me: Ok, well there's these bugs I can take care of then, I'll get them fixed, won't be long.

PO: Hmmm, we need to measure the impact first. Let me get back to you on that a bit later

Me: Meh, oh. I'll refactor this bad component meanwhile then.

PO: Have you created a story for that in JIRA? Create the story first and then we'll groom it and take it in when we've time

Me in my head: Dafuq! Im trying to work on your fucking project but you keep throwing all that business bueraucracy shit at me. What am I supposed to do then? Sip coffee in the kitchen and talk about the other fucking billion failed "new business opportunities" with my peers? Fuck this circle jerk of a billion management people all trying to make themselves important. Nothing. Ever. Gets. Fucking. Done!!!

Me: Ah right, I'll do that *proceeds to the water cooler*

Okay so this is just a rant about my personal life because if I post it any where else no one will really care.

So I graduated from a vocational high school where I learned about basic IT and networking skills but I mostly focused on my programming. and I LOVED that school honestly the environment was so amazing and everyone and everything about it was amazing. then I started college recently hoping for the same thing and its just depressing me, and my depression is coming back and I cant stop it because I cant distract myself from it. My friends are always off playing Monster Hunter Ultimate and Im just wishing theyd hop back on Warframe so we can play again.. They say they will but they really wont so im usually just playing alone or going online which is sometimes fun if you have people that talk back.

so i took myself to the official warframe discord to find people that would help but everytime I ask I just get ignored. So Im stuck playing alone.

while thats happening Im not really getting any messages from anyone besides my girlfriend which is nice but she isnt able to really keep up a conversation and shes often busy with school as well. when I try to talk to any of my friends they arent really interested to talk or just send short replies that obviously tell me to go away. one friend in particular she and I used to talk everyday not even in a romantic way just straight up besties for life, but after one of my relationships ended she basically took her side and never talks to me now. Ive just been really lonely and wanting to just have my friends talk to me again or just have some programming friends I can chill in a discord server while we code but I cant bring myself to ask anyone on the specific server im in for programming..

Honestly idk if anyone on devrant really looks at my posts and thinks "oh look Bubbles posted again". I feel like im not good enough to be here because Im not nearly as good as all of you, Im mostly just here asking questions or posting extremely fucking long posts no one wants to read. and yet this is still where most of my interactions are and I love that this devRant community makes me laugh or feel better about myself sometimes. and I thank all of you for that and I remember your @ 's all the time.

honestly the only real highlight of my week was when my teacher of my vocational class asked me to come back as an unpaid intern to help teach his new programming class and It made me happy but other than that I havent been too happy.

if anyone actually got through this holy shit youre awesome and thank you a lot its appreciated.

We have 2 layers of testing environments and production.

I tested the changes on the 1st layer, bud since it was 5min to lunch i did not test on 2nd layer which is connected to the production DB. I pushed to production and caused 5+ websites to go full retard and went to lunch.

Came back to 19emails and 3+ skype msgs about "why the fck would you do that..."

Estimated damages nearly 20k EUR and i lost some permissions for two weeks, but my great boss helped me out and cheered me up by telling stories how he took down multiple servers too

plot twist: im the team leader of our office now :)

I was given a 1700 nzd budget to make my own computer.

The mouse i threw in with my own money. I went 150nzd above budget and the rest is coming during the week.

Its going to be my first custom computer. And im fucking excited like its christmas back when i was 7 years old!!!

I think I want to quit my first applicantion developer job 6 months in because of just how bad the code and deployment and.. Just everything, is.

I'm a C#/.net developer. Currently I'm working on some asp.net and sql stuff for this company.

We have no code standards. Our project manager is somewhere between useless and determinental. Our clients are unreasonable (its the government, so im a bit stifled on what I can say.) and expect absurd things from us. We have 0 automated tests and before I arrived all our infrastructure wasn't correct to our documentation... And we barely had any documentation to begin with.

The code is another horror story. It's out sourced C# asp.net, js and SQL code.. And to very bad programmers in India, no offense to the good ones, I know you exist. Its all spagheti. And half of it isn't spelled correctly.

We have a single, massive constant class that probably has over 2000 constants, I don't care to count. Our SQL projects are a mess with tons of quick fix scripts to run pre and post publishing. Our folder structure makes no sense (We have root/js and root/js1 to make you cringe.) our javascript is majoritly on the asp.net pages themselves inline, so we don't even have minification most of the time.

It's... God awful. The result of a billion and one quick fixes that nobody documented. The configuration alone has to have the same value put multiple times. And now our senior developer is getting the outsourced department to work on moving every SINGLE NORMAL STRING INTO THE DATABASE. That's right. Rather then putting them into some local resource file or anything sane, our website will now be drawing every single standard string from the database. Our SENIOR DEVELOPER thinks this is a good idea. I don't need to go into detail about how slow this is. Want to do it on boot? Fine. But they do it every time the page loads. It's absurd.

Our sql database design is an absolute atrocity. You have to join several tables together just to get anything done. Half of our SP's are failing all the time because nobody really understands the design. Its gloriously awful its like.. The epitome of failed database designs.

But rather then taking a step back and dealing with all the issues, we keep adding new features and other ones get left in the dust. Hell, we don't even have complete browser support yet. There were things on the website that were still running SILVERLIGHT. In 2019. I don't even know how to feel about it.

I brought up our insane technical debt to our PM who told me that we don't have time to worry about things like technical debt. They also wouldn't spend the time to teach me anything, saying they would rather outsource everything then take the time to teach me. So i did. I learned a huge chunk of it myself.

But calling this a developer job was a sick, twisted joke. All our lives revolve around bugnet. Our work is our BN's. So every issue the client emails about becomes BN's. I haven't developed anything. All I've done is clean up others mess.

Except for the one time they did have me develop something. And I did it right and took my time. And then they told me it took too long, forced me to release before it was ready, even though I had never worked on what I was doing before. And it worked. I did it.

They then told me it likely wouldn't even be used anyway. I wasn't very happy at all.

I then discovered quickly the horrors of wanting to make changes on production. In order to make changes to it, we have to... Get this

Write a huge document explaining why. Not to our management. To the customer. The customer wants us to 'request' to fix our application.

I feel like I am literally against a wall. A huge massive wall. I can't get constent from my PM to fix the shitty code they have as a result of outsourcing. I can't make changes without the customer asking why I would work on something that doesn't add something new for them. And I can't ask for any sort of help, and half of the people I have to ask help from don't even speak english very well so it makes it double hard to understand anything.

But what can I do? If I leave my job it leaves a lasting stain on my record that I am unsure if I can shake off.

... Well, thats my tl;dr rant. Im a junior, so maybe idk what the hell im talking about.

Its been a few hours, and i was busy with meetings but

THANK Y'ALL FOR 10K ++

I remember wk20something, when i joined devrant. I was just starting a job as a data analyst, and the wk at that time spoke to me on a personal level, so i wrote a quick rant and didnt give it much thought. The next day i opened devrant and had like 100++s and a bunch of comments. Since then ive met a lot of awesome people here and im happy i clicked the install button back then. Thanks cfox and brogus for the opportunity, love ya.

Already got a longboard as a 10k-day gift :^)

> starts coding at a young age
> makes it my whole personality
> goes through a rough year of quarantine, graduates high school, changes changes changes

* no. coding for a super extended period of time*

now I'm slowly trying to get back into it consistently. miss you besties lol hope yall are doing ok I'm back and I'm better and also older. I think the last time I was consistently on here I was 17 lmao

I work at another bank now. I finished my first year of engineering at my uni. Ontario is slowly opening up. I'm doing better :)

This rant is inspired by another rant about automated HR emails like "we appreciate your interest [bla bla] you got rejected [bla bla]". (Please bare with me).
I live in an underdeveloped country, I graduated in September, did Machine Learning for my thesis and I will soon publish a paper about it, loved it wanted to work as ML/data science engineer. On all the job postings I found there was only one job related, I sent resume, they didn't answer, couple months later that company posted that they want a full stack web dev with knowledge of mobile dev and ML, basically an all in one person, for the salary of a junior dev.
- another company posted about python/web scraping developer, I had the experience and I got in touch, they sent me a test, took me 3 days, one of the questions took me 2 days, I found an unanswered SO question with the exact wording dating to 6 months ago, I solved it, sent answers, never heard back from them again.
- one company weren't really hiring, I got in touch asking if the have a position, they sent a test, I did it, they liked it, scheduled an interview, the interviewer was arrogant, not giving any attention to what I am saying, kept asking in depth questions that even an expert might struggle answering. In the end they said they're not really hiring but they interview and see what they can find. Basically looking for experts, I mentioned that im freshly graduated from the very beginning.
- over 1000 applications on different positions on LinkedIn across the whole world, same automated rejection email, but at least they didn't keep me waiting.
- I lost hope. Found a job posting near me, python/django dev, in the interview they asked about frontend (react/vueJS) and Flutter, said I don't have experience and not interested in that, they asked about databases, C and java and other stuff that I have experience in, they hired me with an insulting salary (really insulting) cuz they knew im hopeless, filling 2 positions, python dev and tech support for an app built in the 90s with C/java and sorcery... A week into the job while I'm still learning about the app I'm supposed to support, the guy called me into the office: "here's the thing" he said, "someone else is already working on python, i want you to learn either react or vueJS or flutter" I was in shock, I didn't know what to say, I said I'll think about it, next week I said I'll learn react, so I spent the week acting like im learning react while I scroll on FB and LinkedIn (I'm bad, I know).
- in the weekend a foreign company that I applied to few weeks ago got in touch, we had some interviews and I got hired as DevOps/MLOps. It's been a month and I'm loving it, the salary is decent and I love what I do.
Conclusion: don't lose hope.

Remind myself that im doing this so my cat can have a good life and go back to work.

So today I realized that Im not happy.

When I was a kid I wanted to do many things because I had time and energy but I had no money. Now that Im an adult and I have the money, I have no energy and no will power to try and have personal life in these few hours left of my day. I spend 9 hours at work everyday and totally 1hr 30min is wasted on commuting.

I spent 4 years in uni between lectures and working on my side projects, and I really believed that after uni I will get a job and my life work balance will improve.

After uni I spent 2 years working abroad in 3 jobs at 3 countries. I work as android dev and now Im making a really decent salary.

However Im not happy at all. I realized that life is not about the money. Im changing countries like socks and dont even feel the need to socialize or enjoy my life anymore. Im european and these other eu countries are not that different at all. It came to a point where relationships are meaningless to me. I became an office drone who cares only about work and outside of work I care only about my projects and more work.

At this point im only 25 years old with around 2 years of experience and money is really good, but fuck it Im so tired of being an emigrant and having no stability in life. Im so drained. I spent past 6 years (4 in uni combined with side projects and 2 years working in 3 jobs in different countriee) working my ass off and lying to myself that after the next big thing Im gonna take a break and enjoy life. But its never enough. I dont want to hit 30s or 40s and realize that I wasted my life on pursuing money and didnt get to enjoy life..

Im really considering taking a 6-12 months vacation. I need to find myself. Probably going back to my own country. Just learn how to enjoy life, attend workshops, get to know new city area, meet new people, do some interesting hobbies. Maybe do a little freelance (max 10hrs a week).

Im tired of feeling like I need to make as much money as I can and learn as much about my work as I can. Its not rewarding because its never enough.

Whats the point in that money if I cant enjoy it?

Me doing front-end work and get a stupid feature request from a customer...."I'll have to talk to our back-end developer and DBA to see if those changes are possible".

Guess what...Im the back-end developer and DBA and the answer is "hell no".

Sometimes I wished there was no internet, computers etcetera and that the world would go back to the basics. When people from a village knew each other and married a girl from your village and lived in a wooden hut in the mud.

This all can be so much better than how life is at the moment. People ignoring eachother, fighting wars by killing thousands without actually fighting.

And yes I know some of us wouldnt survive it, Im not sure I would with my chronic kneepain. I cannot hunt because of it. I could be a builder or farmer maybe?

Context: been coding for a year and been on react for 6months.

So im excited to talk about my achievements. Of which making buttons and menus which i share with my beloved partner.

Few months later I'm confident about my skills (that is not being a simple mortal anymore)，so i come back home and my wife kindly asks me:

“how are you today darling? Have you been succesful with your buttons today?”

.... I had to say yes....

doNotMessWithITTeamInAFuckingProject();

Last night me with my team have a discussion with my project team. Currently we have a project for our insurance client building a Learning Management System. The project condition already messed up since the first day i join a meeting. Because since its a consortium project with multiple company involved, one of company had a bad experience with another company. It happened few years back when both of company were somehow break up badly because miss communication (i heard this from one of my team).

Skip..skip... And then day to day like another stereotype IT projects when client and business analyst doing requirements gathering, the specs seems unclear and keep changing day by day even when I type this rant I'm sure it will change again.

Then something happened last night when my team leader force our business analyst to re index the use case number (imho) this is no need to be done, and i know the field conditions its so tough for all team members.

So many problems occured, actually this is a boring problem like lack of dev resource, lack of project management and all other stereotype IT projects had. Its sucks why this things is happening again.

Finally my fellow business analyst type a quite long message in our group and said that he maybe quit because its too tired and he felt that the leader only know about push push pushhhhhy fcking pussy, he never go to the client site and look what we've done and what we struggle so far.

I just don't know why, i know this guy earlier was an IT geek also, but when he leading a team he act like he never done IT project before, just know about pushing people without knowing what the context and sound to me like just rage push!

Damnit, i maybe quit also, you know we IT guy never affraid to quit anytime from the messed up condition like this. Even though we were at the bottom level in a project, but we hold the most main key for development.

Hope he (my leader) read this rant. And can realize what happened and fix this broken situation. I don't know what to say again, im in steady mode to quit anytime if something chaos happen nearly in the future.

doNotMessWithITTeamInAFuckingProject();

Best girl i've met.

I attended a CMS Conference last month(I don't use a CMS, i'm just interested with the topics about DevOps and UI/UX). I met this pretty lady ( I find her cute and awesome.) who's one of the speaker, she talked about design principles and applying it to BEM with SASS. After the talk, i asked her some questions about her dev't workflow like what tools she used and some best practices. Our conversation went well and exchange some of our knowledge and ideas also i introduced her to devrant (She's a wordpress user, i showed to her how the community hates WP, idk if she registered). After her talked we separated ways and ended seeing again after the conference as she's looking for a cab going to a mall (Same directions where i'm heading to), We talked again and decided to have dinner together. I felt like she's the best girl i met as she's into TV shows i like (Silicon Valley and Mr Robot). We added ourselves in FB and saying goodbye to each other. After a week or two, i just found out that she already into a relationship and it broke my heart.

I guess im back to the start, but i'm happy that i made a new friend.

I'm thirteen, and we have an excel unit in our computer class. When she's want to teach us something, she'd deploy her screen on ours and we couldn't do anything. It took me until the third time (yes, that long) to remember the connection was wired via Ethernet. I took the cord out and my computer was free! During the boring "lesson," I opened Code::Blocks to work on a fun side project. When she notice she wasn't connecting to my computer, she walked over to my chair and saw Code::Blocks on my screen. Then, I noticed her behind me. I quickly pressed ALT+TAB. She walked back to her chair. To this day I swear she thinks Im a hacker.

so I had a very important video conference for some rather large cloud infrastructure that Im engineering. I decide to look "smart" so i decided to wear a jersey during the video call. I aced the meeting, happy people all round. I walk to my room and my wife says "you do know your jersey is inside out...and back to front..and the label is sticking out from under your chin....How did the meeting go?" me:"..fine until you pointed out a look like a 2 year old dressed me !" ... well thats one way to kill the happy feels!

Due to working from home I decided a few months back to invest the money I save instead of keeping it all in my bank account.

About 10-20% of it goes to a long term investing account and the rest into the one I manage actively.

The nice thing about homeoffice is that I can have a lunch break an hour later when the market opens and review my shit, then again checking up on it in the late evening before the market closed here.

Have been playing around with trading for years but never did it with patience and discipline.

After 3 months I managed to reach over 16% profit.
My account is small so it’s not a lot of money but I’m focusing on the % rather than the $ at the moment. It’s a start..

Anyway, thought I’ll share my progress with you guys as some of you probably invest as well..

Im exclusively swing trading, so holding my positions between 1-14 days with no leverage.

😬

Decided to delete devRant and reddit for a few months. Now I'm back, and the first thing that greets me on both is Light Mode 🤢

Thank God that I haven't cancelled my devRant subscription. Once you go black you never go back! 😏

Was cleaning up some of the old files on my system and found the first ever raycast program I had written.. in c++

This was during a time im pretty sure all of you guys just like me learnt the things that you could possibly do using code.

The experience of the first time I ran this and saw the sprites appear was the awe all of us have experienced in our own ways.

The reason I found this picture interesting is many of us end up losing the wonder and sense of excitement that got us into development in first place.

Go back , clean up your drives .. find your old code. I'm sure there is no better feeling than looking at the past you , writing bad code , with a probably bad language on a bad editor with sleepless nights to get nothing more than the output we wanted.

It's amazing when you realise everything is better when it's simple.

And I thought dealing with recruiters couldn't get worse..

Applied for a job, get a call back a short while later. Recruiter guy has zero details about the job, but needs some background info. Then says he needs a few more things, it'll come in an email. Calls me 5 minutes later asking why I haven't replied yet, told him im not home.

Get home, check my mail.. please send full address, social security number and a copy of both sides of my photo ID.

Nooooooooooooope. Email back, say no can do.. no replies, job listing deleted a few hours later.

After 6 months of work in this startup I gave in my notice yesterday.

- Me: I decided to leave this position as well as this country because: 1. My side business is expanding and Im making the same salary like here, 2. My army drafting got postponed for this year and next year they cannot draft me anymore(because of the age gap), so basically I'm a free man and can go back to my own country, 3. I have some freelance gigs on the side as well, so having them plus fulltime job plus my own side businesses it's not sustainable.

- My project lead: What if we would increase your salary ?

-Me : No, as I said this is purely due to personal reasons

My project lead: What If we would hire another dev so that you wouldn't have to work alone on frontend?

-Me: ......

Seriously do they ever listen??? I'm telling you that I'm making nearly twice the salary that you are paying me, do you really think an extra couple hundred of EUR a month will make a difference?

IM BACK.

My boss and one of my coworkers “touch me”...

I’m usually one of the first ones in the office. When my coworker comes in and walks by, he touches my shoulder from the back in a “hello friend” kinda way.

Especially when I’m trying to ignore him he pokes my shoulder. He could you’d waved his hand in front of my head.

My boss is trying to be the “buddy” I guess. When having lunch and someone says something funny, he literally rests his hand on my shoulder or kinda rams my shoulder with his shoulder..

They think that’s nice and “bonding” but I hate it and it makes me very very uncomfortable. The ONLY ones who are allowed to touch me are my GF (I don’t have one) and other girls i know in a night out after a few drinks.

Not even my best friends touch me cause they know I don’t like that.

Im giving obvious signs that they should stop but they don’t get it..

On the other hand I probably have some serious problems that It makes me that uncomfortable in the first place, but not sure how to fix that.. i don’t even go to the barber shop because they have to touch me to cut my hair. So I cut them myself or my dad does it once in a year.

Sooooooo since a few days im feeling more and more depressed.

There are some things that might cause it :
- school
-My last frienhship broke (not like i care about sociality. lol)
-my parents being so strict.

What can i do except for going through this, eyes shut?
I alceady had a depression i dont wanna get back there :/

I think there is such a thing as "getting too comfortable with the people you work with".

My boss came over and wanted to show me how to do a new process. We start going through the steps and a question arises. I then IM my team lead, because he's the one who would know the answer, and all I get back from him is sarcastic comments and profanity (he doesn't know my boss is sitting at my comp with me). So I keep trying to get him to be serious, and he just keeps his mouth (well, fingers) going. (He is remote - not in our bldg). I want so badly to shut him up because what if he says something about my boss while she is sitting there? Not that he does that, but at the pace he's going, it no longer would surprise me.

There should be some sort of code to hint to your team to STFU and give a fucking answer when one is needed. Sort of like what kids do to hint that a parent is in the room, but for work?

Fuck this day!
Like really fuck it!
I have one of the most terrible crunch-time i ever experienced.
I’v been working 12+ hours every day with an ever-changing project timeline.
It started simple, we made a timeline, it was risky even then but it was realistic, we started working immideatly, everything looked good then a few days in BOOM! Actually our project management completely forgot client B’s projects soo we need to do that too with the same fucking deadline!!! (About 10x more work in waay less time)
Then this morning i got an email from the graphics team that we need to document our design process RIGHT FUCKING NOW! Because management wants documentations, in the middle of a fucking crunch-time.
Today it almost got physical with my project manager, i told him that he is not a programmer, i dont fucking care about his shit, just fuck off and let me work because we won’t be ready based on his unrealistic bs.
I feel like completely fucked over, like we were told 2 days before deadline that the whole company and people’s jobs depends on us now because if we wont finish this clients won’t pay.
WE ARE TWO PROGRAMMERS for studio of 10-12 people!!!
Soo i’w been thinking about getting the fuck out of here ASAP, i got an offer from a pretty big international gamedev company just what i needed, i already did their test before all of this, i passed A+.
We scheduled a skype interview for today. I had completely no time to prepare or chill off, just got out of the office, got into a starbucks and i’m interviewing. No time to even check my mic or internet, the call was so shit i could not hear anything, they neither because the plaza was loud af. Meanwhile im nervous about work, about the interview, about can they hear me at all because of the noise. I fucked it up. BIG time! I was so done i could not reverse a fucking string in c++ or explain what is a signed int!!!
Needless to say they said no.
Need time to think about it or realize what happened? Nice dreams. Back to the office and continue working.
I can’t do this anymore. My girlfriend came for me and took me home at 10pm but all i could do was stare at the floor on the subway. I don’t want people to lose their jobs but i just phisically can’t do this anymore.
Meanwhile any time i talk to my project manager about being tired he says like “hshshsbsb i have 60 hours in the last 4 days i got the worst part, i would be grateful in your place..” like fuck off dude, i dont give fuck about how you feel about this. This is not okay for me, you did this to the project, your fucking job is to manage it! I have one day off before going back to this, i have completely no idea what to do now...

[ps: this is not Nemesys. They did not let me work on my own stuff because i would be a competitor, so i left.]

I joined (still under probation period) in a startup founded by an 18 year old.

I work after my full time job for them and thought itd be fun but the kid made a slack channel and asks for progress updates everyday and feels a bit in a haste to get the product up and running. He seems to think I will be working every weekday from the second i come back home till i sleep. I have a party today that im going to and im sure he will ask for progress updates and when I tell him im out and wont work today he’ll probably say something like “the faster we do the project the better”.

Im not sure if i should leave now while its easy or i should stay for the money ($900 a month). Like i really dont feel like tolerating a demanding kid who cant wait for his app plus id much rather be working on other things just for fun like making rust crates. but at the same time the extra money is nice.

Thoughts?

Senior management just had a covid opening up party, streamed it on YouTube in the middle of the office with not a single person wearing a mask or social distancing. Encouraging employees to come back to working in the offices.

I AM FUCKING DONE. IM DONE.

It hasn't been a week since one of our employees died and these were the same people who emailed the team asking to donate towards the bereaved family.

This isn't even a rant. It baffles me that narcissistic bullshit like this is legal. How can anyone be that fucking stupid? Just how. Explain this shit to me. Because these aren't total assholes. They're generally nice people outside of work. Why is it that anything touched by corporate greed gets corrupted to the point of inhumanity.

Nope.

Inspiration to code kicks in!

Kids asleep, everybody’s asleep, house is quiet. The kind of peace ive always wanted and wished! (Parents here will understand.)

Get to my laptop, opened up code editor, start fresh and clean! Created new file, about to type my first code and.........blood dripping from my nose. It doesn’t stop there, its like flowing for a while!

I noticed it keeps flowing while im projecting the inner excitement to code. When my mind drifted a bit, the nose bleeding stops. Wth? Its like my body is ejaculating when im excited to code, yeah.. it ls blood shot out of my nose, wtf!

...and i have to stop what im doing. Then the ideas just spoofly gone. Suddenly i dont know why im staring at an empty code editor.. (what was im about to code again?) i totally cant recall, it simply gone. Damn it. That could be a million dollar apps! Wish i can go back to an hour ago and record myself when i received that historic inspirational moment. 😔

I have a new Job as a full stack developer, so Im here to tell my story, you see,I told my boss today that im quitting,
Which he replies by telling me to wait, to see if he can get the CTO to pay me more,
now the CTO sais, "HE IS ONLY A BACK END DEVELOPER, HE'S NOT THAT IMPORTANT, I THING WE ARE PAYING HIM MORE THAN ENOUGH" So I said fuck him and left :D

So I had this internship in highschool for some marketing company creating simple databases for them to help out with their business.

When I came back from college for I think winter break they had asked if I would come in to help with a task that was going to take all day so they wanted me to come early. I agree and show up the next morning.

They had an Excel spreadsheet with about 5000 records in it and one of the fields was the name of the customer. They told me that the records came in as lastName, firstName or as lastName,firstName.
They wanted the field to look like firstName lastName. For a minute or two they had someone show me how they have been doing this which was just by hand. I don't really work with Excel so im not too keen with the macros. But it took me about 1 Google and 30 seconds to find someone with a similar macro to achieve this, I altered it a bit and let it go through all the records.

It was an awesome feeling when I went to the boss to let them know I was done (it had only been 10 mins), they almost didnt believe me.

Funny how one line of code can turn a day's work into a matter of minutes.

Teammember left. I did his three tickets yesterday. Before that I created and applied new rescue procedure for broken deploys on production and deployed the app manually. Took me about 6 hours to do this right, find the cause, and solve it, and document what I did. After that my teamleader bought me a launch :)
It wasn't his, my former teammate responsibility to bring back prd to life, it was me being good and engaged employee. His tickets, on the other hand, were his duties. Took me one hour to code them. He was working on them for two weeks. I can't wait for the performance review, im definitely going to ask for a nice rise :)

After an hour long discussion via call with someone and after over a year of working in web3. I can safely say the entire web3 is actually a sham. Im too tired and exhausted from scams and frauds to explain why. It is just a bunch of overhyped artificially inflated bullshit to lure you into the ponzi scheme. I am almost 100% sure with proof how this is all a lie. Web3 is equivalent to government and political corruption - just a bunch of EXTREMELY WEALTHY people ripping poor and middle class off by defrauding them through crypto and nfts to make the rich richer. Its truly disgusting. There is no way in HELL that you can work in this space and expect to succeed if you are not already wealthy. People apparently spend between $10,000 up to $500,000 on a single project for marketing. They spend it so easily as if they earn that sum of money back by tomorrow. This is truly sickening. The reason why marketing costs so much is because it manipulates naive and newbies, lures them into the web3 world by creating an illusion of get rich quick schemes "hey buy this jpg for $2000 and you'll be able to sell it for $20,000 in a week!" Truly truly sickening. Web3 isnt even a wild west. Web3 is a fucking dystopian void where these fucktards are like animals fighting each other who's gonna defraud a bigger chunk of thousands and millions of dollars from each other. Literal fucking shithole. I am so disappointed. I thought web3 technology was useful. Perhaps it is but people's greed has molded this technology into crime and frauds. Which is what it has become

*flashback to days of windows xp*
Just finished formatting and installing xp on friend's trash pc cuz the os was compromised due to a shitload of viruses. Notice that other partitions might still be infected and i don't have an antivirus on me.
"Big boi Ill be back in an hour, just whatever you do, don't open ANY drives no matter how urgent it is. Just Don't do it or i won't be able to help you"

Come back and VIOLA this worthless trash avocado opened a drive to play a game and d pc was infected. Again. Back to square one. It almost broke my heart. Almost.

I remember that day well. I was 15yo and hopeful. That day marks d start of my hatred toward tech incompetent people.
SO FKIN
A N G E R Y

So today
College
My classmates stink of incompetence. I'm not that smart in fact i consider myself to be a noob among devs but seeing ppl that are several order of magnitudes trashier than me breaks my heart and makes me soo Fkin

A N G E R Y

Hey you cunt of a skunk, WHY can't you even compile a fkin cpp file without an IDE what the fuck is wrong with you? What do u mean ur program isn't compiling? Well it literally says there syntax error on line 15 congrats u moron u fkin spelled else as esle. Why shud I waste my time on stupid Shitty ppl like u huh?

And waddup mr shithead.No. Not gonna help you partition ur drives and install a fkin linux just cuz ur too lazy to google it urself.
And if i refuse to help cuz im working on my shit then I AM D BAD GUY? Stop bitching about me u lazy bastards get ur lazy arse off and read the fkin book. Watch a tutorial or sm shit why the fuck can't u understand YOU LITERALLY PAY TO COME HERE AND YOU AREN'T EVEN TRYING TO LEARN THE BASICS GOOD LUCK GETTING A JOB YOU WORTHLESS CUNTS.

Now now all the poison is out i can finally focus on improving myself and stop giving a fuck about them. Its hard to be calm and cool when ur surrounded by ppl like this all day. Even harder when there is almost noone that you can look upto. All this time, there's only one thing I've learnt- in a place like dis, being an asshole is better dan being polite.

Im getting tired of this fucking scrum team.

First of all let me introduce our backend team which takes 3 weeks to add one fucking column to database and in the end turns out they fucked up RabbitMQ RPC implementation so the column is not syncing with our app at all so now we have to wait 2 extra weeks until that will be working. Best part is that backend fucker who fucked up doesnt even feel like hes blocking a feature and would rather sit for extra few days and do nothing until he gets reassigned his pile of shit back to him than clean up his own shit.

Then we have business analytic who doesnt know how to define tasks properly so I have to record each grooming meeting so I would know what to fucking implement because he doesnt even bother to take proper notes. Which results in not fully defined tasks, which results in unexpected behaviours and MR's stuck in limbo for weeks.

Also lets not forget QA guy who doesnt even bother writing scenarios, I as an app dev have to write them myself just to be sure that fucker will test everything thoroughly.

Then we have fucking devs from consultancy agency who apparently have 6 years of experience (I have barely 2) and these fuckers are spamming me daily with the most basic questions. After each grooming they rush to assign themselves tasks which are not even defined properly yet and not even in this sprint, but fuckers are lazy so thy want to reserve easier tasks for themselves. Pathetic.

At least I have a decent senior on my team, but sometimes he patronizes me so much that I start asking me what I am doing in this team.

Fuck this shit, I asked for a 43% raise and if Im not getting it in 2-3 weeks im outta here. Fuckers.

My life is basically a loop of:
1) “I’m in a slump and terribly depressed because of my lack of productivity.”
2) “I know! I’ll try using the strategies that proved to make me very productive”.
3) “I’m very productive right now, that’s because I’m so smart and talented, it’s just part of me”
4) Back to step 1

Im an unaccomplished idiot with a big ego. Why do I have an ego if I don’t have any real accomplishments????
Dear god, I will become a fucking egotistical moron the day I actually do something worthwhile.

I’m a goddamn fucking piece of shit.

almost a year ago, i have no idea of what i was doing at work cause everything was new: coding languages, databases, clients, co-workers, etc. i had 0 experience and i am back here again on devRant after 3836382 years and i am proud to say i've learnt so much and have been promoted to Project Manager. im happy asf and i am now ready for another round of dev rants!

Attention: incomming resentful boiled up for months rant.

Hands down G2APAY is the worst because:

Merchant account aproval takes fcking months. It starts with unreasonable delays in documents approval. I mean insane nitpicking. They want to see merchants name surname and address on every god damn document that you submit even if for example bank statement doesnt include these details. I had to manually edit pdf’s just so that they would fck off and approve the merchant application. Insane requirements for document check also combined with their email only support answering only once a week you will have to wait one month just to get your account approved.

Then you get to the fun part, approval proccess for vendor gateway and webhook integration. They are nitpicking everything you can imagine: about website not having https, website forum missing some icons, merchants phone number being from another country then he is, and bunch of other hundreds of problems imagined only by them. Again combined with their one email reply per week policy you will waste atleast one month to finish up your integration.

Now finally you are their client and you think you can chill and go back to focusing on your business? Nope bro. Prepare for threatening emails. Last time I got a request to install https or my merchant application will be shut down. I was given 3 days notice on a fcking friday and had to do it.

Then g2a backend is crashing quite often. Combined with their one email per week policy you are fcked in the ass if your users were not able to pay through g2a and you will get no compensation.

Their backend documentation is shiet. Not clear how to integrate everything and after you integrate they make changes without publishing any changesets. Your integration is working? Good luck if it will still be working tomorrow.

And the very worst part is that they stopped proccessing credit cards like month ago with zero notice. Its been weeks and still zero news about bringing card proccessing back. They sad that they were acquired by some other company so shitty support got even shittier now while they are in a proccess of handover.

So yeah thats the worst vendor I have ever seen in my life. For example integrating paypal took me 30 minutes. Integrating stripe and getting all documents reviewed took me one business day. Same with paymentwall integration and document approval took 1 business day. Support is amazing and even have a phone number that I can reach if urgent problems arise. Thats how it should be. Thats why I can pay percentage of my transactions with a smile for them.

Sorry for the typos since im typing on my shiet phone while driving.

Eat a bag of dicks g2apay. I hope you go bankrupt and shutdown.

balancing school work between life and sport and programming is so hard. i mean, school is complete bs. what’s the point?

ffs it’s not *just* that im never gonna use the shit im taught, but that if it dont learn it, im punished. even in some classes (code.org), information that we’re taught is blatantly incorrect. either way, being able to find the foci or an ellipse and the latus rectum (hehe) of a hyperbola isnt going to make it easier when i get my job and just adjust css to my bosses’s specifications. i maintain a 4.0, and i fucking hate it. my friends are working hard, and getting into mit for racial diversity, while im doing just as much work, for what?

i want out. i really do. but this redundant thing called a degree is holding me back. i really want to have some way of proving my skills without a degree. i’m currently building a social media application i believe will take off, but frankly, i dont care.

take off or not, hopefully it will be enough to prove my skills. i’ve been working on this for two weeks now, and, well, that’s my story.

>Sitting at desk pondering over what is wrong with code.

:Top

BRAIN : "maybe we will think better with /another/ cup of cofee?"

Repeat until

BRAIN : "damn now im too jittery to think about code. Maybe if I relax woth some music/meme hunting ill be able to focus"

Repeat until

BRAIN : "Damnit i spent 2 hours on 9gag and not coding. Gotta get back to this bug squashing but im now so tired. Maybe some cofee will help me think"

Goto Top

Shit, again a long rant...

It all started 9 months ago.
We had a meeting with our group staff (5 people). Back the we discussed, if we should only work online or still send files around with mail.

Sure I suggested to run everything on a root server, would be the best performance/cost choice.

The president and the accounted refused, they said it's still working, why change. Payment will only be trough banktransfer and everybody keeps files local.

Back then I told them, that they will have sooner or later a problem. Files will be missing and bills not payd.

Last week we had a new meeting:
- Some of the group missed files.
- Some bills were unpaid

So now I have time until march to find and finish a groupware/collaboration tool.

I need to run member administration and payment online, this should be finished in October 2018. It should also do accounting.
Im really planing to use WooCommerce for this, I'm really crazy, I know! But I dont have time for that shit!

I work fulltime beside this and almost have no time to code something like that.

Well this week I demanded a memberlist, so I can plan a CRM database.

I received a word file as memberlist.
I asked them if this is a joke, right?!
They said no, thats the list. All the Data was mixed and some user details missing.

I HAD 3 HOURS TO GET IT DOWN IN EXCEL. WHY ARE YOU DOING THIS??? I REALLY WANNA PUNCH YOU ALL IN YOUR FACE!

When I sended it, I didn't receive a response or thanks.

The joke, I'm doing this stuff for free. I volontered, to make something big...

Im really going to shit Lego Bricks next...

I get so fucking awkward and autistic when i sit at work 8h a day and just work... I cant fucking communicate with people. I behave like the most extreme "nice guy" beta shithead and its hard to fight it.

Went to put coffee in the sink now and a girl was washing the dishes. In the same time another girl was coming into the kitchen. I stopped and wanted to wait for her to wash them. The girl walking in looked at me weird. I was turning around pretening like im searching something. She asked hey do u need something. I then turned a 360 in place (oh my fucking God) walked towards the sink 1 step and then 1 step back as if i forgot to walk. Then i replied i just wanted to wash the coffee. And then i awkwardly put the coffee in sink for the girl to clean my coffee too

So fucking embarrassing!

Only when i work from home at my pace within my environment ALONE (im the biggest introvert) is when i dont become autistic. I can communicate. Im an alpha chad

Quick rant, I dont have time.

I have no idea how the fuck but I managed my IDE to show me that it's confused if my class "PackModel" is "PackModel" or "PackModel" (I have only one definition if you are hands first to ask).

its few years and first time when I see shit like that.

Fun fact, it was working OK until I used getter that was returning another object and than IDE got absolutely lost.

I had to use workaround in middle of nowhere as shown on image and suddenly its back fine with it. Not like it's returned by function hard typed and PHPDoc typed to return instance of this very object and in other scopes it just works...

It's Jetbrains so Im confused, it's robust IDE ;-;...

Im seriously thinking about Watercooling my Raspberry Pi 3...
Why?
BRCAUSE THIS LIL SHIT RUNS SO FUCKING HOT THAT I CAN MAKE AN EGG ON IT! THATS WHY!

Its 80°C when under little load BUT GOES OVER FUCKING 90°C ON LOAD! AND THIS IS FUCKING DANGEROUS! FUCK!

so back to watercooling...
Its a Stupid idea, I know, but its literally THE ONLY FUCKING WAY TO COOL THIS BASTARD! And trust me I tried Novec (Yes the liquid that evaporates at 60°C...) and SHITS EXPENSIVE!

1. When i was 11 years old i came across a trojan horse program and i sent it to all my school friends to get their messenger password.
(I had a list of passwords of all the people in my class... dont worry, i didnt even used the passwords, i just stored them in my list lol)

2. Took data structures 10 years later, hated it and switched to electrical eng

3. I was working on a manufacturing plant as the lead engineer and one of my prototypes was misbehaving and i was blaming software and software was blaming me...typical stuff... So i said "im going to get a masters is software so i can know wtf you are talking about, and tell you that you are wrong😠!!"

Got in school, started in the masters and quit that place i was working for 🤣.. (they were shitty people and unethical business... fyi)

Now im back to where i was was when i was 11... (minus the hacking email accounts of my classmates)

The company who said i passed the interview and got the job is not sending me email from hiring department to schedule interview. They said they gonna do it. But the recruiter told me they have a high demand of interviews so i guess they dont have time to reply to me back and hire me officially? Im still waiting its been a few days.

Or is this a slow sign of these shitfucks pulling back and will ghost me or reject me for no fucking reason even after telling me i passed and got the job but now they changed their minds for no reason?

So my brother went back to school today. Now, during the 5 years I was there they had the most shit security on their IT systems, but aparently now they have fucked up their ssl. If you try to load the https page it comes up with the warning saying its an invalid certificate, but once you click it, it doesn't even load the school website, it loads this random page. Clicking on the buttons then take you to a page under their domain provided by another school. Going to this schools website, the https seems to be broken in the exact same way. It wouldnt be so bad, but it can confuse the hell out of people who type https before a url, and thos who dont realise and end up on the insecure site will need to provide passwords over an insecure connection. I am so glad im out of that place, they had such crap IT and everything was so easy to break.

It's almost midnight here and I just realized something. I just realized that none of my college friends have contacted me in almost a year now... Like none of them. They hang out every weekend near the college I cannot coz im working and it has never occurred to them that "hey there's this guy that we we were together for four years with , I wonder what he's doing how's he holding up" and I wasn't even an asshole or a douchebag or something I guess I just vaporizer from their memories like a volatile liquid.

I also feel like my boss gives me nearly impossible tasks so that I fail like "design these two complete web applications in three months while you do your actual job of teaching people java for 8 hrs a day"
And now here I am at midnight sitting curled up in the corner of my bed like a paranoid chipmunk that drank a pot full of dark coffee, trying to talk to this random bunch of people from random places in the world who are doing random shit right now. And the worst part is I chose this ... I wanted this I wanted to make a difference. I didn't want to be just a cog in a machine.

If I die right now how many people would cry? I ask myself that a lot it's never more than ten. This is probably creeping u out right now so I'll probably end this.
Rest assured six hrs from now I will put my mask back on. a mask of a happy, mildly funny, averagely successfully geek, until my next date with sadness

-Im a frontend
-We don't have any back-end in our team
-Im now a front-end & backend
We need to migrate our server to AWS but we have nobody
-im now a front-end & back-end & DevOps
During de migration we need to use AWS database and create new view and manage access
-im now a front-end & back-end & DevOps & DB engineer
-We have new employee (Yess)
-im now a front-end & back-end & DevOps & DB engineer & Trainer and repository manager (PR, Manager)

Public institution... No salairy growing... Fluck this shit

FUCK SPOTIFY
This bloated buggy piece of shit
This fucking piece of bull dick that runs efficiently as much as a legless cockroach this motherfucker thinks its offline even though its in the motherfucking browse screen and I have a 4.5g connection (this retarded cunt) fills space faster than a hot gas released in a vacuum chamber just to fix its goddamn internet bug I have to reboot my damn phone. I see so many damn bugs in this shitty app that I think they rolled back to the alpha versions sometimes if I had any other god damn alternatives (google music is not available where Im from fuck you too google) the only thing I would give them would be my middle fingers. It just fucking froze on me while I'm just trying to listen to my Retrowave playlist while I fucking get ready for bed FUCK YOU FUCK YOU FUCK YOU YOU RETARDED INFECTION FILLED CUNT I WOULD PUT A BIKE CHAIN ON MY DICK AND RAM YOU WHILE WE ARE TIED TO A CAR THAT DRIVES OFF OF A CLIFF IF YOU WEREN'T AN INCOMPETENTLY PUT TOGETHER 1S AND 0S

I am building a website inspired by devrant but have never built a server network before, and as im still a student I have no industry experience to base a design on, so was hoping for any advice on what is important/ what I have fucked up in my plan.

The attached image is my currently planned design. Blue is for the main site, and is a cluster of app servers to handle any incoming requests.

Green is a subdomain to handle images, as I figured it would help with performance to have image uploads/downloads separated from the main webpage content. It also means I can keep cache servers and app servers separated.

Pink is internal stuff for logging and backups and probably some monitoring stuff too.

Purple is databases. One is dedicated for images, that way I can easily back them up or load them to a cache server, and the other is for normal user data and posts etc.

The brown proxy in the middle is sorta an internal proxy which the servers need to authenticate with to connect to, that way I can just open the database to the internal proxy, and deny all other requests, and then I can have as many app servers as I want and as long as they authenticate with the proxy, they can access the database without me changing any firewall rules. The other 2 proxies just distribute requests between the available servers in the pool.

Any advice would be greatly appreciated! Thanks in advanced :D

ah this fucking sucks my boss, who is also the guy developing back end for our mobile app which im developing, isnt working on the back end makes me guess the fucking json strings that hes going to send and buils the front end, then later changes the fucking json structure completely and expects my app to work without any problems, how do you teach these fucking php developers the importance and significance of data types and data structures

Skype??? For main communication in soon 2024 in an IT company???? Get the fuck out are you fucking kidding me??? Starting a 9-5 job after so many years of being jobless feels like im degrading myself back to caveman primal age. What who the FUCK uses skype ????? Please

!dev

Im working with morrons...

So someone had bright idea of having clone setup of our servers in other hosting company (in previous company we have rendundant setup). Whatever, maybe they want to be resistant to thermonuclear war or whatever, like the project wasn't underfunded already... Whatever, fuq it.

And with that, I have like really, really really fucking ABSOLUTELY BULLSHIT STUPID questions thrown at me.

So, this particular instance of bullshit started with trivial, literally "how much storage capacity we will need" I anwsered at least 4TB, preferably on redundant disk array, I've added small table what uses what and how much etc.

Than I got mail back...
"Thats not enough information:
1. What we need to say to company ABC
2. What we need to say to company XYZ
3. (this one actually had sense) Backups conception
4. **WILL WE PAY FOR SERVERS**
5. other important things (literally)"

So let's break it down.
Im backend guy. What the fuck do I know what you gonna say to XYZ or ABC. I dont give a shit, for me it's clicking setup new server and Im done for, you are overcomplicating as shit and require special care from hosting company that you will pay extra.
Next one, the killer one. What the fucking fuck. my anwser was literally "yes, we need to pay for servers, servers arent free."

Now tell me. How the fuck it is possible that someone can be such an idiot to ask questions like that. and I dont mean #3. maybe even #1 and 2 is like looking someone to throw responsibility on. But why the fuck I have to anwser mail that literally asked me if servers are free.

No, fuck off idiot, I have actual work. Take your bullshit and spread it somewhere else.

E:

and before anyone asks. No, Im not working in kindergarden but I often feel like I am indeed working within kindergarden full of 30+ mentally handicapped toddlers.

Some years ago but it's funny.
The company give to me a new laptop with windows Home Edition,
After few months I have installed Pro Version.
1 month later the laptop didn't work anymore, nothing on display, no beeps, zero.
Tried to replace ram and check but nothing works.
The CTO asked the supplier and they asked about SO, and they said it's not turning ON because i have installed Windows Pro.
Than the CTO had a brilliant idea: try put the hard disk in another laptop and install Windows Home, and put back in the defective one. I refused to to that, it's stupid and he insisted, then I put the laptop in his desk and I said: if you want do this you can do, im not stupid enough to do this.
He got really mad, 1 week later i got a brand new one 😅

I’m so fucking pissed off right now ... what the actual fuck!!! I worked so damn hard during this semester i got 70% for a presentation whilst some jack off who gets 100 fucking hundred percent doing it last minute by MY FUCKING HELP and also has the nerve to tell me to stay silent while he enjoys his Fucking undeserved HD (high distinction)

Well guess fucking what???? I’m not staying damn silent !!!! I’ll definitely be watching out for who I help in the near future, 😡 1AM i should be sound asleep but im legit so bloody pissed right now...I put my heart into my project stayed up late nights till 2 bloody fooking AM many times in a row, put my heart into my FREAKING presentation and i get stabbed in the back?!? Well thats how i feel right now.. i dont know how i will sleep tonight.. what PISSES ME OFF THE MOST IS HOW SOMEONE HAS THE NERVE TO TELL ME TO BE QUITE SO THEY ENJOY THEIR UNDERSERVED MARKS!!!

anyways guys and gals.. i had to get that off my chest. Thank you for taking the time to read my rant.. as always wishing you all the best.

Milo

Do you find it difficult to make new friends in your late 20s? Im talking about situation when you left your hometown, left your university city and started living in a fresh new city while working as a remote dev? Only way to make some would be to get into some hobbies, but for now I just try to kick my anxiety causing addictions (nicotine in particular). Once Im back to my calm state I will get out there, but for now Im just an anxious uninteresting wreck haha. At least Im living with my sister and managed to find a great girlfriend, but in terms of social life I dont have it as much as I wanted. Im in a strange situation where I hate people but at the same time want to connect more with them.

I didn't posted something in a long time so...

TL;DR: FUCK YOU ANDROID STUDIO YOU FUCKING SHIT PIECE OF SOFTWARE

Thank you for your time.

I am running my own meme social network. For quite some time I wished I knew a Android developer, which could help me.

Because I know java I tried it myself, and Android studio is one of the worst programms I've ever seen.

My app crashed the whole time, just because my studio version was 1 behind. Updated studio, everything worked.

My layout wasn't showing correctly, reopened Studio, all layouts deleted.

For no good reason video views aren't resizing, so I need to use exoplayer.

One video on my platform nearly crashes the app when creating a thumbnail.

And so one....

I fucking hate Android studio...

(PS: if your a German, Swiss, Austrian you could check out my network and may become a beta tester of the app)

I know its been quite a while since ive posted last but it is safe to say that i am back! And boy do i have some stuff to bitch about.

This semester, Im taking mobile app development as a class. I chose to take this class over the introductory c# class, so that i wouldn't need to work with Windows or really do anything else to touch Windows. Well the joke is on me. Here i was thinking that we would be using a bit of Java from time to time while only really learning best practices and concepts.
Never did i think that this class's curriculum would be entirely based off of Xamarin.
Seeing as I need either this class or the two c# classes to graduate, I had to bite the bullet and just accept that my semester would be full of irritation during this class.
Its been about seven weeks in, and i have turned in 8 assignments.
All 8 of those assignments have been Windows Form Applications doing simple shit like dividing two numbers.
We have not made anything for multiple devices. We have not made anything for even one mobile device. We have not even discussed how to do this in the class.
This wouldnt bother me so much since these are typically easy programs that take about 30 minutes to make and test and submit for grading. It does insanely bother me, however, that it takes Windows so FUCKING LONG to boot, or when it freezes every 2 minutes because i clicked into another program, or it just HANGS ON THE UPDATING SCREEN AT 36% FOR THREE DAYS, or when it took 4 different reinstallations of Visual Studio 2017 before i could actually open without an error code.

College, Ive learned, tests my patience way more than it has ever tested my knowledge.

When thinking back to my first pc im like how da fuck did i survive using dat crap I must've been a very patient guy 10gb hdd, 64mb ram, 700mhz cpu (if dats da correct way to write megahertz) and to top it off 56kb/s dialup internet

So I am only 15 and I am trying to find local businesses that will allow me to either build them a website or let me redo their current website.

Doesnt sound thay complicated right? I have gotten to do it once, for a laid back coffee shop owner whos business went out of business a day after i emailed him about it being done. I mean how the hell does that even happen!

I have tried different types of emails and shown all of my work, which it is all good sites that look professional. Issue is alot of people dont trust email offers or dont trust me cause im 15. I am not much of a person who can walk into a store and talk to the owner about it, i am not social in that aspect.

So anyone have any ideas?

Just slept in front of coding.
*Boss tap my back*
Me: Hi sir, Im just thinking of the solutions. 😏

How to deal with situations when in work people are overstepping personal boundaries too much?

My situation is that 2 months ago I started working in a very small startup and it currently consist of 3 ceos(main ceo, marketing ceo, product manager) and 3 employees (backend, android and ios).

What I currently dread is tea breaks. There is one at monday before work which lasts for 1 hour. And there is another one at Friday after lunch which lasts 1 hour again. I hate these Friday talks about "what are your plans for the weekend" which then triggers a circlejerk of ppl trying to impress each other about what they are going to do on their weekends. Same happens on mondays they circlejerk about how their weekend was amazing.

My situation is that I came to this country just to get skills and make shit ton of money when Im at it. Besides my fulltime work, I also am freelancing part time in my previous gig and also Im managing 2 other hobbie projects. I like to keep myself occupied during weekends so they usually consist of shopping/pc repairs/gym/working on my hobbie projects.

So basically when I tell them what I've done over the weekend the ceo's don't seem to be impressed so they start suggesting me to do something else. I completely loose any motivation of sharing my personal life when they start telling me what to do with my life.

I don't feel like exploring the city or meeting new people since maximum Im going to stay in this country is 6-9 more months. Then I'm probably going back to my own country.

Anyways even overall, I started dreading this companies culture. The politeness is so fake. For example there is an employee which has worked 3 years for them and the ceos haven't even increased his salary. I joined 2 months ago and I get paid more than him! They dont value loyalty at all since immigrants can be replaced easily. Another example: 2 weeks ago it was my birthday and no one from ceos even shook my hand, for them it was normal to just say happy bd during a standup.

So fking weird. I feel like I'm seeing redflags every day and not sure how long more I can stay here.

Backups is the most important thing, but there is something more important then that. Making sure your actually backing up the files your paying to back up. Now im stuck waiting on 4 2tb drives in raid 6 connected over sata 2 to be recovered because a raid card failed but the drives are still good. Estimated time over 3 days.

Yay, Dubba didnt die.
Okay, hello'ed back, lets fucking rant.

Im fucking SICK and TIRED and ANNOYED by all freaking cloud fanboys. Yeah, sure. You get scalability. You waste less resources. Sure. But it depends on use case. There is suprising ammount of services that can be run on VPS or dedicated servers that will be a lot cheaper if you just DONT run it on cloud. And dont you dare to missinterpret me. I fully recognize that there are valid uses for cloud services. But for fuck sakes, its not anwser for ALL of your needs, and it costs insane ammount of money if you use it where you should use dedicated.

WHY we, as humanity came to this place where self-claimed "proffesionals" will anwser you "cloud" before you even ask your question.

No, fuck off, take calculator and think for around 60 seconds. And than decide if you need cloud or not.

And no, this mail server will be fucking few times more expensive on cloud, and I know it becouse I have fucking calculator and I was running it past 1.5 year and actually run sometimes htop, so stop bullshitting me.

Sorry if some cloud die-hard felt offended but it is exacly how I see and feel it.
Peace.

Do not trust Unity Collab.

Been using unity collab as a VCS for months on a project, regularly saving the files, working well.
Today i decided to refactor some code but lost track of some things, so i reverted to a version i checked in 2h before.

Unity replaced my files with the stable build back then, except... half of the files were missing. of course no undo functionality.
months of work were simply not saved in collab. no version had these files, i did modify them regularly and they never caused collab issues.

how can a company not make the vcs they add for their main product work to its minimal requirements?!

Im not sure how i could motivate myself to fix this mess. fuck this trash company, cant have a single project without major issues.

Im petting my cat with my left hand and browsing Devrant with my right. Its super hard to get back from a rant. Pretty please devs of rant make swipe right and left on rants leave/enter?

I am now sitting in my apartment lobby after rushing home this morning because of a FedEx Delivery.

They said they can't get access to the building then how the fuck did this FedEx package get in between when I got back and when I came down?

Now they said there are different trucks... And my service could come later today.

It wasn't even supposed to come today but I guess maybe that's good since I took today off anyway...

Now I'm just stake out here all day and if it's not here..... Im going to aim to make FedEx the next Facebook or Panama Paper PR crisis

Can anyone tell me how to become less resentful and less bitter? I am becoming a miserable fuck. Its true that I burned out in this job after doing 100hrs overtime during previous month, its also true that I am pissed off about having to wait 8-9 weeks for my raise to happen. I cared so much that I burned out and now Im trying to set some boundaries but damage was done and Im struggling dealing with it.

I took 6 days off to disconnect from work (still was responding to some major blockers and monitoring stuff). Today I got back at work and interacting with two incompetent devs immediately sets me off. Imagine taking 2-3 days and extra meetings to do a simple fix which shouldnt take longer than 30min. My mind was blown and still gets constantly blown about how ineffective some members of team are.

I am becaming a ranting fuck. I even noticed one person escaping my rants once he sees that they are taking longer than 5min.

Right now I started setting boundaries - I clock my 8 hours, disable slack/email notifications and get the fuck out from the office. I dont care if I will have to sit in traffic extra 30min during summer heat, Im done with putting in overtime and caring so much about being efficient. I will just start working on my side project and put my love/learnings in that. Hoping that by the end of year I will have couple projects to show in my portfolio so I could find a better paying job...

In the past I was the sole dev responsible for apps and I was communicating with ceos/ctos/product owners/designers directly. This is my first position where I work in a dev team and boy oh boy out of 8 devs barely 3 are competent enough but their output is how to say... Not the biggest. Anyways...

Transition to boundaries and 'normal life' is so hard. Nobody told me that I will have to learn to work with and tolerate such retarded and incompetent people. Im talking about illiterate monkeys who cant even read or write. Im amazed how they manage to code.

I'm the lead dev on this team. The project is split into multiple separate modules to comply with separation of concerns, and so new devs don't need the whole fucking codebase (risking them running away with everything) to contribute to the project as a whole.

So we don't need a fucking config file to enable and disable features.

So we don't need to upload a 500mb monolith every time we want to test a change.

So we can test old fucking versions of modules without merging it back into the entire codebase.

What did this fucking dev do? He was having one small issue with Maven. One. It wasn't updating his local snapshots to the correct Artifactory version.

He decided, instead of trying to fucking fix it: HEY, LETS IGNORE THE LEAD DEV'S DEMAND TO KEEP THEM SEPARATE. IM GOING TO MERGE THEM INTO ONE MODULE FOR SOME FUCKING REASON.

I refuse to continue working with this dev if he's going to sidestep my demands and undermine my authority. He wants to go it alone? Be my fucking guest. I'm not touching his shitty single-codebase monolithic monstrosity.

If this is going to be a regular fucking occurrence, he can eat a dick and choke on it.

Writing my code, go to run it and boom its not working. I pull up stack over flow to get some insight. At this point i was working on my code for countless hours and became a bit annoyed so i decided to copy what someone wrote on stack over flow delete my code where i thought it was flawed. I run it and Blam bugged the hell outa my code. So i undo go back to my original. Turn to a friend and ask what do you thinks going wrong. He resets my browser and there it goes it works. I just kind of gave him a blank stare and thought to myself Im a dumbass!

iiiii fffffuckingg hate articles that just explain something

put a piece of code

that piece of code uses X amount of classes/models

they never mention what structure are those models/classes made of

what is inside them

i cant continue following the article because i dont know what is inside them

they just put it in ur face and say Fuck you

no

Fuck YOU

<font size="1000000px;">FUCK</font>

<font size="10000000000000000em;">YYYYYYYOOOKUUUUUUUUUUU</font>

U MOTHFFFFFUCKERRRRRRRRRRRRRRRRRRRR

USELESSS ARTICLE

zzzzz

frustratioms

my nerves are torn

broken

disabled

demented

day

in life

obsession

hell

unreal

what is life
q

what are doing

why are doing this

what is the point of living

how long does it take for a man to die

why are some people blessed with luck and some are not

zzzz

u know what is even more frustrating

girls

yes

ohdont get me started on this topic

well i warned u

the path towards abundance lies upon the few; thou who shalt not risk high; shalt always stay thus low

girls also frustrate me bc

i always do every thing nice and im always nice

so i realized

being nice is fake as fuck and doesnt fuckin work

being urself doesn't do a Fckimg tHING

hhh

frustrations

.

breathe

.

in this hardlife

only the strong survive in this world
- tupac shakur

zzzz

so yes bavk where i was saying girls frustrate me because i always do what im supposed to

so

i tried being thou who shalt i am not

guess what mothrfucker

it works when u be a gofdamn fkig low mothfckr a u know a goddmn fkig punk then they respect u and want u

back i fckked up

i turned back to my real me, the nice me

and then they left me

they think being nice = means being weak

FUCCKK YOUU

ssss

zzzf

kindness != weakness

U FCKING WHORES

UNDERSTAND THAT

zzzzz

breathe

i just wanted to have a walk outside and thenit started raining

so i had to stay inside bc of the rain

m

i am very lonely

u know i was very fine when i was lonely at a very young age but now i need a living entity beside me

with me

i fking need

wait i will cuddle my fluffy dog rn maybe i will feel better

br b wait for me ok

i feel better now

fck

i remembered that goddamn girl again

man i feel so heart broken

srsly

i have sunk into the deepest depths of endless depression I think

it doesnt feel nice

it feels very lonely and depressing down here

but i thimk tjat is be because i care too much

some people say i overthink

I dont overthink

i am like the stealth people
the shadow people

i stay quiet and observe

everything

i always know what is happening but i rarely speak about it

and people dont realize

so they think they can fool me

no

everything has its limits

so much lies that im sick of it

i always tell it how it is

i always reward those who help me

i always help those who help me

i never forget those people

zzzZZ

why is it that people who dont give a single fucking Fffffficxkkckck about me

are the ssame people i almost care the MOST?

i cross hundreds and thousands of miles to visit a person, invest hours of my time to do that

i do that....

and they wouldnt even step 1 foot in front to see me....

what kind of life is this

vv

feel like cryin rn

.

zzzzz

.

i dont understand what one must do

what is the point

all i want is to be happy

that is it

but being happy is.... i wanted to say the hardest part of life but now my voice told me being happy is a state of mind

myself answered me that being happy ? is a state of mind?

so that means if i want to be happy even if everything around me is falling apart

in my mind i can create a psychological world that would make me.... happy ....?

or what

i dont understand what did myself tell me

why do i care so much if im lonely

u know my friend from college we go to same computer science college

hes a very smart man but a fake FUCKING friend, plastic as fuck

he reads philosophy booms and told me

"when a man is lonely for long enough, he will slowly start to fall apart"

that is me...... that is ...truth......

he quoted a philosopher from some book

zzzz

he also said a quote he read about the meaning of life

"this life is endless pain and the only purpose of life is to reduce this pain as much as possible so we can be happy"

what the fck that is incredibly depressing

what the fuck im actually crying rn

i feel stabbed in the back and left behind and cheated on, all of those happened and some of them are happening right now

dont know what to think about the reasons

all of this causes me such huge anger and depression and that is whT keeps me going

going by working harder than i am supposed to

without all this hurt there would be no glory

all this effort..... it better pay off at the end...... please God..... i beg you....

i have completed 50% of my life purpose, let me do the rest so i can die in peace...

Not dev related but what is the fucking point of someone saying I'm going there to do that and when i ask them to show me THAT what they did they say "oh it was so bad I'm not gonna show you haha"

Like how do i explain it without being rude.....

........

Here's a savage example scenario

---

Your wife: "i just came back from a mountain in the middle of nowhere filming an ad and in gonna be in that ad"

You: "cool. Id love to see that ad, could you show it to me?"

Your wife: "noo i was so ugly and it was so bad im not gonna show u"

---

What are you gonna think? What was your wife filming secretly behind your back and she doesnt want to show you? Was she even filming in the first place? Or was she fucking a guy? What is one supposed to think of this conversation? Why fucking tell me ur gonna go there and do that and then not talk about it at all after doing it? What the FUCK who DOES THAT ???

First rant here..

So earlier this week, on a php Laravel project, I created a set of nice new features.

The code is tested, locally all fine, I push to Github, circleCi kicks in and double checks myself, still everything green. (Just for a not, its a private project so only I work on it.)

I go ahead and merge, deploy to staging and continue on my next ticket, which is a very small one.

I call it the day, next day I pick back up where I left, test locally, all green, push... then circleCi says no.

I spend 2 days debugging, trying to figure out what is wrong without advance. I just push develop branch again, guess what also failing.

I leave it for the day as I already spend enough time on it.

This morning, I simply do a composer update, push and everything miraculously starts working.. even if there were no changes in the working branches.

Im so mad right now, and this is going in my "try this before you debug a ci" book..

Dear web devs,

PLEASE learn how to (or teach/inform your clients) correctly target ads.

Thank You

Also, WTF??? and even WZF?!?! Who created this? Furthermore who the hell paid for this to be an ad, what are they trying to achieve and how tf do they think this will achieve that???

PS-
In case you're wondering what i was looking up on thesaurus.com, or would like to assume/blame this ad on my browsing history, cookies and/or something like google listening in the background through my mic... nope. Looked up "adage" and im waaay too adept at cybersecurity and easily annoyed by anything doing something i didnt explicitly tell it to.

if you're ignorant of the google listening thing:
yes this is totally a real thing that the vast majority of Smartphone users have no clue is happening despite it being in t&c. Try a few, somewhat relevant to this topic, google searches and youll find suggested searches like "can my phone read my mind?".
I tend to explicitly ban shit like that on everything (even devices of anyone on my property that never logged into my internet... im not paranoid, just not a fan of tech doing things i didnt tell it to)... but when i needed to enable/allow it on a dev for 30min, the next time i went to look for a book, one of the top suggestions (before typing anything) was "Burmese Pythons"... i looked back at my activity for that 30min days ago... I had been explaining some basic python code to a kid from myanmar... so it was pretty amusing.

I don't really know what I should be feeling right now.

So its been 2 years at my company and im still considered a junior dev. There's a pay freeze, meaning there's no chance for me to move up the ladder.

And yet, as of today, I am being asked to head up both the design AND development of a prototype file cloud sync engine that will replace our current sync application that's been worked on for 4+ years now (yeah, its legacy). And I'm 100% on my own, at least for a while, untill someone else comes around.

I still reside under the title 'junior dev' and am paid as such. I don't mind challenges, but this just feels like a bit much. Heck, I'm sure maybe I could even do it too, but I don't feel like im being compensated or given a higher title to reflect that sort of responsibility. I've tried to tell my manager I don't feel comfortable with this, but they've insisted I head this up.

I feel kind of locked up inside, I don't even really want to start working on it because I feel angry that I would be given such a huge project to do all on my own, while being called a junior, and without anyone to fall back on.

What should I do? Do I refuse the responsibility? Do I see it as a challenge that will help me grow? Or do I see it as an exploitation?

Why can’t IE just die?!

I was sent home for almost 3 months due to the pandemic, when I came back on monday there was a major issue with page load speed on IE and some potential customer, had a test account and told us that the platform is taking forever too load and then came the hunt to fix what is asap, it was a very important customer that still uses IE

This happens last week, the only developer on the job last week, was 3 days trying to figure this out, no dice! then I come back on monday, then Im being reboarded and keep up to date what has been going on while away, then I am given that damn task on Wednesday and I’ve been tearing out my hair trying to fix this all week.

But today!

I fixed it!

The solution: npm update <package-name>

Great way to start up at work again *clap*

Do your companies have dedicated software / web architects / designers, or are most places just a group of developers who are also expected to do design and architecture work?

Do you have dedicated front end teams and back end teams, or are most places just a mix of people who do everything?

I'm asking this because im a junior dev being given a large project, mostly to head up on my own (!), where I have to do design and architecture work which I feel is completely out of my comfort zone, and I want to know if this kind of thing happens often? Are developers supposed to design specs, pick the tech to use.. etc.?

In a time where a web dev is expected to know, well.. everything... Backend -JAVA, python, nodejs and C++ would be great.
Front- angular, react, other 10 libs
DBs -sql, mongo, redis, elastic, kafka, rebbitmq
Also be devops on the side with AWS and docker kubernetis and more stuff

How the f is that possible?

In my real job for the last couple of years and different companies, I usually use 1 language/framework & 1 main DB.. and although it's possible in some companies, but in mine, ppl dont get access to AWS etc..

So let's say there's me.. a server side dev for years.
So I decide to be better and learn Golang.. cool lang, never needed in my job, after few days of not using it I forgot all I learned and that was it.

Then I realized I gotta know some frontend cause everyone want a fullstack ninja nowadays.. so I tried Vuejs.. it was amazing .. never got to use it at work, cause i was a backend, and we didnt use frameworks on our products back then..
Also forgotten.

Then I decided to learned nodejs, because this is the coolest thing ever.. hated it, but whatever... Never got to use it at work, cause everything was written in other lang which the whole team knew... Forgot the little i knew.

Then I decided, its time to see what Angular is, cause everyone started using it... similar idea to vuejs which i barely remembered, but wow it's a lot of code to remember, or I'll have to google everything.. so I went over it, but can't say i even learned it.

Now Im trying to move on to python, which, I really am learning in depth.. however, since I dont have real experience with it, no one gives me a shot at being a python dev, so again i feel like I'm trying to memorize syntax and wasting my time..

Tired of seeing React in all job ads, i decided to have a look what's that all about.. and whadoyaknow... It's fucking the same idea as vue/angular with again different syntax..

THIS IS CRAZY!

in how many syntaxes do i need to know how to make a fucking crud api, and a page with same fucking post form, TO BE A GOOD PROGRAMMER?!?

Wordpress.....

God, why..

Okay, so my company has deep roots with wordpress websites, which is, well fine, and at some point they needed portal that would do something but I was bussy doing other project for our child company, so our frontend slapped together "portal" in wordpress. So I dont even know if I understand that properly whats going on, but today buddy came with help request to wordpress.

I had to look through wordpress database and was like.... FML hard.

Okay, fuck it, let's try to make it work. So, I needed to get random category (using get_terms), check it's ->count and if its greater than X show it on page. I came to done halfway, the random part wasn't working.

Okay, made it work after initial struggle with "WHAT THE FUCK IS THAT?! AND THAT?? AND THAT?!?!??! ;-;" and now comes the kicker. It has ACF installed and it has additional category in ACF. And it should check count of posts within the category that have certain ACF value.

After awhile I just said "this shouldn't be done on wordpress, no idea how to make it work".

What I seen is like... it hurts me on so many levels... My head wants to explode...

Can I get back to writing normal code now? ;-; Im fed up patching logic in frontend (I dont even know if that's `the wordpress way` but that's what they did)

My phone just died. Got a new phone on recommendation of friends and flash Jolla on it. The OS is super nice but the "Android support" doesnt work. No lastpass, no netflix, no prime, signal works half, no banking app.

I really need my windows phone back. It just worked without issues. After two android phones and now a Jolla in about two years im kinda done with all this shit.

This technical interview went horribly awful... I cant believe what they asked me.... And it was all on english. Interviewed by german and indian guy. I got SO stressed the fuck out just from this 35 min technical interview. I drowned in stress. If this is the reality of engineering world im not sure if i can handle all this stress....

If i work a job i would literally just go to office and come back home like a literal zombie. Emotionless soulless purposeless zombie. Emptiness. Void. Numb. As i work in the office i would put a fake smile face as if im so happy working while from inside drowning in stress and decomposing out of depression... The amount of money i earn wouldnt even be spent because id have no energy or will to go out and spend it. It's meaningless....

So im pretty sure I made the biggest/dumbest fuckup for the year already...
Deleting the majority of our RHEL server's root partition.

Blonde mistake for sure.

Technically i didn't actually delete it... just fucked up the block device so it's no longer recognised as existing.

I could go fishing for data and put it back together... but since i have the boot par and all the uset account configs... plus i actually documented all remarkable server updates cuz im trying to get better at the whole 'having a team' thing... im just gonna play it safe and go through it all like old school video games when you die right before the checkpoint so you need to go through the same paths again and again... but not too fast or youll fuck up somewhere easy and itll drive u nuts when u gotta reiterate again.

@jestdotty here you go. Always saying I just mention positives about myself... cant get much worse than this.

This is gonna get someone illogically upset, but idc about that.

I know it's ignorance of semantics but I'm tired of propagated ignorance changing the meaning of things.

Non-binary is NOT a legitimate term for whatever 'gender' you are!

I get what *whoever-started-it* was going for, but it's NOT valid. If you want to say that youre not male or female, fine... just don't abuse binary systems to do it. Just say youre non-bool/anti-boolean or identify with one of the, apparently 50, shades of gray.

I keep getting into logical loops to nowhere about this nonsense. No one is even defining what's supposed to be the 1 vs the 0. Which then makes me think '1 must be male... genitalia=1 in many ways...' which then sources back to the historic validity of males vs undervalued/less than human interpretations of females...

Then <brake>.
Ofc these people aren't going into the historical significance... they don't even realise how binary works! Ofc they'd have no clue that all 0s= no data... and 0s only have significance when viewed in placement to the 1s.

Let's all start using proper terminologies, like non-boolean. Maybe i can start a trend by paying people pennies to learn/teach wtf a boolean value is, and that binary can represent anything. With proper encoding the array is limitless... so being binary is actually a giant spectrum... therefore makes no sense to be "non-binary".

Ok... im done. It had to be said.

Who wants to start identifying as non, or educating wtf is, boolean with me???

Right now what i want to do is just quit everything, move somewhere else, get a job and never fucking look back. Im sick of all these projects college dumps on me, the idiots im surronded with, my job, people who think im interested in their fucking research. I just want a 8 to 5 job and after 5 im fucking done and nobody calls me about how long will the next release take for projects i dont give a shit about.

In other news i just started my thesis yay.

Okay. So I'm in class right now. And we'll do a rather big IT project (in groups of 2) later this year. And one of my classmates (I hate him AF but he doesn't know because he doesn't get shit) just asked me if I can make him a social media platform. HOLY FUCKING MOTHER SHITTING FUCK. CAN YOU PLEASR JUST STOP TALKING TO ME YOU PIECE OF SHIT. YOU DONT DESERVE TO LIVE. GO FUCK A TABLE!! IM NOT GOING TO CREATE ANYTHING FOR ANYBODY. AND YOOOUUU LITTLE FUCKER ARE ASKING ME TO DO SOMETHING FOR YOU?? EVERYONE FROM MY CLASS IS AT LEAST SOME KIND OF NICE BUT YOU PIECE OF CUNTSHIT NEVER EVEN DID A SINGLE THING FOR ANYONE. AND YOU ARE ASKING ME TO DO SOMETHING FOR ME. LIKE WHAT HODDAMN HOPE DO YOU COME FROM. COULD YOU PLEASE JUST GO BACK INTO THAT HOLE??!!!

When ryzen released I bought a 1700x a little while after with 3600 cl15 memory.

Back then it only ran at 3.6ghz cpu and 2800 mhz cl16 memory.

Now im on 3.75 ghz and 3333mhz cl14.

I honestly didnt expect this to happen

Anyone ever just get seriously discouraged about peoples view on how easy/difficult it is to code?

A client has requested that they want a system built so they can create surveys and send them to people via email all in one tool. Im not a good front end designer but I know how to develop it. So they hired a designer to send me screen mockups and I will develop them. Easy enough.

This is where the bullshit starts... The designer was supposed to send me the V1 designs last Friday so I could begin building. I told them that I could have a rough version of some pages (with placeholder text and whatnot) ready for the following Friday (tomorrow). However the designer didn't send me the designs until 5 minutes before we were all meeting yesterday. We were all going over the designs in the meeting and this is how the conversation went (roughly):

Client: Wow these designs are amazing, I cant wait to see what it looks like when it functions. Are we still going to have a demo version by Friday?

Me: Well seeing as I just got the designs today, Ill have to look them over and get back to you on a new timeline.

Designer: Yah sorry about the delay, designing can be tricky sometimes.

Client: No worries, I understand. However I want to stick to the same timeline and have the demo by Friday.

Me: Well as I said, Im only getting the designs now, this is the first time I'm seeing them so I'll have to look them over and re-evaluate.

Client: Yeah but the designs are done so it will be easy for you to code it by then. It's all right there in front of you. I need to run, excited for Friday! Bye!

Designer: Bye!

Me: ...........

-- I know its partially my fault for saying I could have a demo done by Friday assuming the designer would have it done on time but COME ON. I hate when people say something is easy when they have no idea what it entails or how to even do it.

Yet another day at my company, Im rewriting some old code for client (rewriting old, php 4 system for vindications managment) and you know the moment when you are focused and someone comes to you to absolutely ruin your focus. Fine, whatever. Oh, for fuck sake. Again dev is doing as support becouse one moron with second can't login into zimbra admin panel and add fucking mailbox. I show them exacly how they login, remind them they are admins too, slowly show them, so you click "manage" than you click that gear icon and than you click "new", fill in email address and password. As simple as 1-2-3. Okay, fuck it, time to go for a cig. I just finish up few lines and stand, grab my vape and start walking towards door. In door I find my buddy with 2 random people. He told me that they are interns and that I should show them some basics and stuff around that. Oh god, fuck my life. If anything, Im definitely very bad teacher, mainly becouse I often have problems with saying what I mean in the way that somebody actually understans and knows what I am trying to say. Whatever. Fuck it all. I grab two of our old laptops that nobody used in like a year or so, and first thing I quickly figure out, is that one day for some what the fuck reason I dont even dont bothered to remember I installed Arch on both while I dont usually use Arch. I just needed it for some specific reason. Whatever. So I guess I will need to upgrade fucking system. Our network isn't really great so that was like... hour or so. In the meantime I figured what they know about coding in general etc, and holly shit. One of them (there was boy and girl), girl, apparently never ever in her life even touched code. Well... fuck. Why am I wasting my time? Becouse there was some programme or some shit like that... Someone could tell me before so I could mentally prepare.. fuck it. whatever. So while laptops are doing their pacman thing, I sit with them and slowly start to explain based on my machine some really basic concepts. Second guy actually had some expirience, he knew how to make some really really basic logic and stuff, so he had another world of problems, becouse it was PHP and, as we all know, everyone hates PHP, and... yeah.. You can probably imagine his approach. Yes, you get user input in super global array. I really wanted to say "Now shut the fuck up and write that fucking $_POST".

hour or so passed, I was close to giving up to not let my anger rise (im not really good teacher... I mentioned it. I suck at teaching others) but luckly machines upgraded. He wanted to use visual studio code, she didnt care too much, so I installed phpstorm in trial mode. whatever. Since that's linux and they were not comfortable with that, I walked them through installing LAMP stack, and when finally it started to look like LAMP stack, I requested them to google how to install xdebug, becouse xdebug is very usefull and googling skill is your best weapon on that field. I go for cig, come back and what I see boiled me a little bit. The girl was stuck looking at github page randomly looking through xdebug source code and idk... hoping for miracle (she admited she thought there will be instructions somewhere) and the guy was in good place, xdebug has a place to paste your phpinfo() for custom instructions. But it didn't work for him, he claims that wizzard told him it cant help him.. hmm intresting, you are sure you pasted in phpinfo? yes, he is sure. Okay, show me.

Again mindblown how someone can have problems with reading.

so his phpinfo() looked like that:
```<?php
phpinfo();```

I highlighted on the page the words "output of phpinfo". He somehow didn't see it or something. He didnt know, he thought that he needs to put in phpinfo so he did. OMG.

Finally, I figured out I can workaround my intern problem, and I just briefly shown them php.net, how documentation looks, said to allways google in english, if he uses tutorial to read whole fucking thing, not just some parts of it, and left them with simple task, that took them whole day and at which they ultimately failed.

To make 3 buttons labeled "1" "2" "3" and if someone presses one of them, remember in session that they pressed it and disallow pressing other ones.

Never fucking again interns. Especially those who randomly without apparent reason almost literally just spawn in front of you and here, its your fucking problem now.

Fuck it, I have some time to get back to my stuff. Time is running so lets not waste it.

After around 15 minutes my one of my superiors comes in and asks me if I can go on meeting with him and other superior. My buddy goes with us, and next 3 hours I was basically explaining that you cannot do some things (ie. know XYZ happened without any source of information) in code, and I can't listen for callbacks from ABC becouse it wont send anyc cuz in their fucking brilliant idea ABC can't even know that this script would even exist, not to mention it wants callbacks.

Sometimes I hate my job.

> Ask scrum master question on teams

No response for 45 mins

> Ask colleague on teams

No response for 45 mins

....

Fuck it. Im going to the shitter to take a big fat shit!

*12 shits later*

Come back and see a missed call and 4 new messages from them both

.....

Cant even take a fucking shit properly! Fuck off

Im a complete back end guy, decided to learn a js framework......

var whatToLearn = rand("angular", "react", " vue");

Suggestions..... :/

!rant

Guys, Im curious, what you would say about situation if you are in need of some quite simple tool and you write it but becouse you need it today, not tommorow, you just dont give a heck about all the fancy stuff and (lets say for php) you start to write all in 2-3 files like you was back beginner?

Or you just nope out of situation?
Do you refactor that when you bored just becouse this cant be on my disk, noone can see this abomination?
Or you delete after usage (only to relaize 5 minutes latter you need it back :P )

Im curious your opinion.

PS.
nope, if you came to bitch about any of opinions even opinion "well, i wouldnt give a fuck and just not do it", go away and get lost.

E: typo

Yesterday was the last day at my job.
We had a nice review party (the team pushing back to Scrum)
After it they have said some heartworming words, I cleaned my PC and left .

I was amazed to hear all the good words, as I felt the team think the opposite of me.

For example, I felt the team thinks I'm pushy, they said im modest.

My last post was a year ago. What brought me back here is the ability of AI to agree and apologize to anything and everything, while producing the worst hopeful code.

4 days I wasted, trying to make an android audio visualizer, but AI... sigh.
It gave me the wrong structure of FFT bytes emitted. I corrected it
It gave me the wrong logarithm calc, I corrected it
It gave me the wrong sampling rate, I corrected it.
It gave me the wrong texture order, I corrected it.
It gave me the wrong glsl sample2d, I corrected it.
It gave me the wrong textureID generation, I corrected it.
It gave me a render which was about 10 fps, I found out that instead of using native onDraw, I had a fcking delta time in my shader. I almost corrected it, I gave up

Lets go to code generators with Annotations.
Like always, starts very positive, until I start to correct it.
It gave me the wrong file locations, I corrected it.
It gave me the wrong order of find copy modify and write to .build, I didnt correct it.
It gave me regexes to find annotations. Im like So whats the use of an "ANNOTATION PROCESSOR"
It apologizes and used a fucking regex in the processor,..... I didnt correct it, in the end, I was left with a separate module, targetting iOS Android and JVM, with an annotation processor implemented in jvmMain, which tries to modify commonMain src by finding annotations with regexes, which wont run on app build or app sync project, but only on java -jre command pointing to that fucking .java class in that module, which takes at least 2 mins to run, and Finally generate 0 files.

I needed to rant, I understand LLMs are just models of words built and stolen from the most intelligent and dumbest people out there. But Im an idiot for getting my hopes high. I cant build anything new and unheard of. I used to do that. I once made a textView + image print util for a bluetooth printer just to say FU to libraries and heavy sdks. like literally rasterizing shit to bluetooth packets. I needed to let off some steam. I havent been here in a year so I dont know what reactions I can get from this rant. I bet someone will just say yeah we tired of 'Fuck AI' rants. but shit, it hurts. When I gave up on that visualizer, I downloaded an app, I think its called project M, like in reference to MilkDrop.. like the Winamp Milkdrop. I opened it, played something on spotify, and let my eyes go blind

Started work at 05:00 to catch a flight, just finished work now (20:00)

Tomorrow morning i have to be up at 03:30 to catch a flight back, my boss has also booked me in with a all day meeting with our largest client tomorrow so won't be leaving the office until 18:00.

Atleast im going to the midnight viewing of Capt. America tomorrow (if I'm awake)

That time when I requested someone from a different department to include the ID row in their database excerpt. Me, having the lowest possible status in the company, did not know the who I wrote to was the boss over at the other department. So I ask straight forward: "Could you please include the ID row?"

Then a damn long email comes back stating that there was absolutely no time for stupid shit as mine. There existed no ID row and I would only waste his time. All further requests should be route via my boss.

So, fuck, he's pissed. So what he deserve? A shit load of honey right into his mouth, like he wants to.
That company had a huge ass hierarchy in job positions and I was at the bottom. So I write my oh-im-so-sorry-mail.

~I never knew what position he had and that I would of course fuck off with my stupid request.~

What was his response?

Oh, yeah, thanks. Have a look into the attachment, is that the ID row you requested?

Yeah, as one can guess, it was.
Stupid honeyfucker. Of course an ID row exists, duh.

Ever since i learned terraform i cannot go back. I cant fucking use the ui anymore. This shit is too good. 1 command to create all bullshit and 1 command to destroy all bullshit. Fantastic. Misconfigured shit? Just fix it in a file and 1 command to update it. Perfect. Need to add more shit? Add more lines and 1 command to update. Shitastic. Instead of misconfiguring bullshit or forgetting to delete some shit manually i can simply just do it all 1 command no errors

HOWEVER i noticed sometimes even terraform gets fucked up with bullshit. When im destroying my infra it infinitely says destroying. As if its stuck in that loop. No idea why. So i have to manually destroy the bullshit and then run destroy a fww more times till it works

We use at our company one of the largest Python ORM and dont code ourselfs on it, event tough I can code. Its some special contract which our General Manager made, before we as Devs where in the Project and everything is provided from the external Company as Service. The Servers are in our own Datacenter, but we dont have access.

We have our Consultants (Project Manager) as payd hires and they got their own Devs.

Im in lead of Code Reviews and Interfaces. Also Im in the "Run" Team, which observes, debuggs and keeps the System alive as 3rd-Level (Application Managers).

What Im trying to achieve is going away from legacy .csv/sftp connections to RestAPI and on large Datasets GraphQL. Before I was on the Project, they build really crappy Interfaces.

Before I joined the Project in my Company, I was a Dev for a couple of Finance Applications and Webservices, where I also did coding on Business critical Applications with high demand Scaling.

So forth, I was moved by my Boss over to the Project because it wasn't doing so well and they needed our own Devs on it.

Alot of Issues/Mistakes I identified in the Software:
- Lots of Code Bugs
- Missing Process Logic
- No Lifecycle
- Very fast growing Database
- A lot of Bad Practices

Since my switch I fixed alot of bugs, was the man of the hour for fixing major Incidents and so on so forth. A lot of improvements have been made. Also the Team Spirit of 15+ People inside the Project became better, because they could consult me for solutions/problems.

But damn I hate our Consultants. We pay them and I need to sketch the concepts, they are to dumb for it. They dont understand Rest or APIs in general, I need to teach them alot about Best Practices and how to Code an API. Then they question everything and bring out a crooked flawed prototype back to me.

WE F* PAY THEM FOR BULLCRAP! THEY DONT EVEN WRITE DOCUMENTATION, THEY ARE SO LAZY!

I even had a Meeting with the main Consultant about Performance Problems and how we should approach it from a technical side and Process side. The Software is Core Business relevant and its running over 3 Years. He just argumented around the Problem and didnt provide solutions.

I confronted our General Manager a couple of times with this, but since 3 Years its going on and on.

Im happy with my Team and Boss, they have my back and I love my Job, but dealing with these Nutjobs of Consultants is draining my nerves/energy.

Im really am at my wits end how to deal with this anymore? Been pulling trough since 1 year. I wanna stay at my company because everything else besides the Nutjob Consultants is great.

I told my Boss about it a couple of times and she agrees with me, but the General Manager doesnt let go of these Consultants.

Even when they fuck up hard and crash production, they fucking Bill us... It's their fault :(

this really happened:
Interface Team Lead: "hey I want any time deployments and better QA"

Me: "ok sure. I have CI/CD, but yiu need to work in feature branches / tags, and make sure your code passes automated builds and unit tests"

Team Lead: "I dont have time to test it makes me unproductive! and creating a branch is an extra step which is going to set me back. Im telling the boss you are impacting performance!"

Me: "you want better deployments and QA, but you can even create a branch or tes your work?"

Team Lead: "We have deadlines!"

soo after finishing 1 year of my 2 yr CS program, i moved back to my hometown so my partner wouldn't have to keep commuting for her career. couldnt get a cs job here with no experience and only 1 yr of school and like basically no portfolio to show for myself, i took a customer service job in a tech company with a lot of support for career pathing.

end goals are to end up working for their software dev team, mid goal is to switch into their web dev team from customer service since the career pathing is WAY easier from customer service to web dev, then web dev to sw dev rather than customer service straight to sw dev

so in the meantime i need to be practicing and building my portfolio but FUCK i have NO motivation and with coronavirus fucking up my life and everybody elses all i wanna do at the end of the workday and on weekends is melt into my bed in a semi-comatose state

i woke up early today to get some work done on my portfolio but all im doing is watching grey's anatomy and playing mobile games

i used to feel so motivated and excited to code but the excitement is gone and now even doing stuff for myself is a lot more like work than play

just need to rant it out rn

Fk you Google!

My Samsung note 10 screen went dead near a week ago... it's a secondary line so waiting for parts wasn't the end of the world.

Ofc the screen (curved and incl a fingerprint reader thatd be a major pain to not replace) was integrated to the whole front half... back panel glued, battery, glued immensely and with all other parts out, about 6mm space only at the bottom to get a tool in to pry it out.

New screen (off brand) ~200... all genuine parts amazon refurb ~230... figured id have some extra hardware for idk what... i like hardware and can write drivers so why not.

Figured id save a bit of time and avoid other potentially damaged (water) components to just swap out the mobo unit that had my storage.

Put it back together, first checked that my sim was recognised since this carrier required extraneous info when registering the dev... worked fine... fingerprint worked fine, brave browser too...

Then i open chrome. It tells me im offline... weird cuz i was literally in a discord call. My wifi says connected to the internet (not that i wouldn't have known the second there was a network issue... i have all our servers here and a /28 block... ofc i have everything scripted and connected to alert any dev i have, anywhere i am, the moment something strange happens).

Apparently google doesnt like the new daughter board(i dislike the naming scheme... its weird to me)... so anything that is controlled by google aside from the google account that is linked to non-google reliant apps like this... just hangs as if loading and/or says im offline.

I know... itll only take me about the 5-10m it took to type this rant but ffs google... why dont you even have an error message as to what your issue is... or the simple ability to let me log in and be like 'yup it's me, here's your dumb 2fa and a 3rd via text cuz you're extra paranoid yet dont actually lock the account or dev in any way!'

I think it's a toss up if google actually knows that it's doing this or they just have some giant glitch that showed up a couple times in testing and was resolved via the methods of my great grama- "just smack it or kick it a few times while swearing at it in polish. Like reaaaally yelling. Always worked for me! If not, find a fall guy."

Havent been home for 24h. Now im coming back home and i can't explain how much shit im holding in. Im gonna explode and drop that fresh smelly shit and nuke the whole house

wwoooo..
back from the dead with linux :)
like i said my internet wasn't working last time. trying to fix it i uninstalled something essential and obviously at this point im banging my head lol managed to get files back and wiped for reinstall. the wireless is back though!!

!rant
But still kindof a Rant...

I Just got my Oculus Rift (Summer Edition bundle)
And I was Soo happy to try the Oculus Touch Controllers!
Except, the Setup was pretty hard because I dont have so much room to move in and the Setup always said: GO FURTHER BACK!
Until I realized that it was because of the Sensors which I put in an Angle not 90°...
Oh hell I was trying for Like an hour until it worked.
But then the Experience was one which I NEVER had! (I Tried VR Rollercoasters, waterslides in VR, PSVR, The HTC Vive, and the gear VR, Oculus DK 1 and DK 2)
It got me a little dizzy after an hour and a half of smaching Robots into pieces...
But still really AMAZING!
So my advice, get it when its on Sale with the Oculus Touch or Just right away.
TL;DR
I bought the Rift and im really happy about it.

I'm about to graduate and I'm fucking exhausted ALL THE TIME. When I'm not in class, I'm at work. When I'm not at work or class, I'm working on projects. Trying to cover all my bases has left me incredibly anxious and unable to rest, so I don't sleep well and I'm fucking tired constantly, making it more difficult to do *anything*.

And if I hear "it's almost over" ONE MORE TIME :| yes, I know it is, that's why I'm freaking the fuck out, because I have 3 major projects I'm trying to balance on top of my internship.

I'm also trying to lose weight so I have to curve the stress eating. I cut out nicotine but I'm slowly picking it back up because

If I'm constantly stressed
And I can't rest
And I can't enjoy food
And I can't enjoy hobbies

Im basically just sitting here for HOURS every day losing my fucking mind without any distraction. 3 weeks until I graduate and it feels like an eternity. Every day is pain.

End of my rant about 35 day recruitment process for anyone interested to hear the ending.

Just got rejected by a company (name Swenson He) for a remote Android Engineer SWE role after wasting 35 days for the recruitment process.

First intro interview went good, then I did an assignment that had 72 hours deadline (asked for couple days longer to do this task, did it in around 40 hours, it was purely an assignment not free work, I could have done it in a day but I choose to overeenginer it so I could use the project as a portfolio piece, no regrets there and I learned some new things). After that It took them 2 weeks just to organize the technical interview.

2 days after the technical interview I received an offer from a second company with 1 week to decide. I immediately informed the Swenson He about it and politely asked whether they could speed up their decision process.

Now I know that I could just sign with the second company and if the big Swenson He would decide to bless me with and offer I could jump ship. But out of principle I never did that for 7 years of my career. If Im in a situation with multiple offers I always inform all parties (it's kinda a test for them so I could see which one is more serious and wants me to work for them more). Swenson He didnt pass the test.

6 days of silence. I pinged the techlead I interviewed with on LinkedIn about my situation, he assured me that he'l ask his hiring team to get back to me with feedback that day.

2 days of silence. I had to decide to sign or not to sign with a second company. I pinged the techlead again regarding their decision and 10min after received a rejection letter. There was no feedback.

I guess they got pissed off or something. Idk what were they thinking, maybe something along the lines of "Candidate trying to force our 35day recruitment process to go faster? Pinging us so much? Has another offer? What an asshole! ".

Didnt even receive any feedback in the end. Pinged their techlead regarding that but no response. Anyways fuck them. I felt during entire process that they are disrespecting me, I just wanted do see how it ends. Techlead was cool and knowledgeable but recruitment team was incompetent and couldn't even stay in touch properly during entire process. Had I didn't force their hand I bet they would have just ghosted me like they did with others according to their Glassdoor reviews.

Glad I continued to interview for other places, tomorrow Im signing an offer. Fuck Swenson He.

P.S. From my experience as a remote B2B contractor if a company is serious the entire process shouldn't take longer than max 2 weeks. Anything outside of that is pure incompetence. Even more serious companies can organize the required 2-3 meetings in a week if they have to and if they are interested. Hiring process shouldnt take longer than MAX 3 weeks unless you are applying for some fancy slow picky corporate company or a FAANG, which is out of topic for this post.

It realy just warms my heart when the customer provides us with software that I need to go through manually and test every method individual before we can start implement it. Then I have to spend hours testing every fucking bit of it to make sure the modules we control with said sw doesnt meet their untimely doom cause the sw is too broken to actually run.
Any.net developers on this plattform? If you doesnt use these xml comments for commenting methods, you're on my hit list.
I realy hate these back-alley developers. Sorry of I sound salty and whiny but seriously. These past 3 weeks, most of my time Ive just worked around issues instead of solving them, cause their sw just keeps chaining good coding down to the ground. And theres no documentation cause "we have higher priorities ", testing is done by us at release cause "its faster and we dont make mistakes" and worst of all, our contact quote on quote "senior experienced developer lead design im far up my own ass and way more experienced than you" guy is a consultant who is only reachable about 2h on a daily basis.

Tldr: we live in a society.

What do you guys do to prevent or reduce back, neck and/or shoulder pain?
Im only 18, starting to have a pain in the back every second week or so :s

[Fairly existential career question] How fulfilling would you say your career in development has been?

[Long rant] for years I had been planning on becoming a rabbi, majored in religious studies etc, until I realized there would be no way out of my rapidly growing debt if I chose to continue on that path. i had to drop out 3 years into my undergrad due to financial issues, and as it is now working full time im barely holding my head above water. I spent a lot of time being sad about it until i decided to change things and started getting into accounting before I discovered coding. I am SO GLAD I discovered coding cause accounting was so boring...Now I'm excited to be going back to school for software development and I'm in a bit of a pink cloud having discovered something thats both exciting/fun/challenging AND lucrative... But i do worry about 5, 10 years in the future, will i still be as stoked about it? Religious leadership was and is something I know i would feel ~fulfilled~ over a lifetime, and while my newly discovered passion for coding literally keeps me up at night getting fired up on solving problems and writing my little newb programs, i think I'm afraid of burnout?

[Tl;dr] I'm making an education+career switch to software development and i wanna know how folks feel about their career years into it, do you still love it just as much? Feel jaded? Regretful? Happy?

The moment I realized im an actual dev:

I used to always copy/paste embed codes and not think of how they work. Embedded iframes, embedded video, embedded appointment forms.

One day, I'm given an embed link and I freakin knew what everything meant. I knew the HTML, I understood what the JS call was, and I saw how it communicated back to its site. It was super exciting to finally understand what I was copying/pasting... Like I finally opened my eyes and saw the real world.

manually writing multiselector widget with jquery and javascript, because you need to be able hackily pass in metadata for some stupid fucking edge case that the previous generation didn't want to deal with

please euthanize me, i fucking hate frontend and im sure it hates me back

We have a system at work with captcha....

I may have renamed a few thousand images and people have been getting pissed...

Of course I remember the shift in filename so I just correct them and they look at me like "how the fuck is that a 6" and im like "well I think it's a 6, the computer thinks it's a 6... Have you had your eyes tested recently"

Half the office are wearing new glasses, the other half have decided that Google has "gone too far" and that "I bet their algorithm has fucked this up"

I'll change it back in a few more days with a note in the changelog about how a "particularly aggressive AI got out of hand and was being too selective"

Our company got bought over from a global private entity 3 months back (advent international) and the reciew process started and it turns out, im part of the bunch that may be getting retrenched as per the meeting we just had, our positions being redundant and just last week had a over the top performance review.. Now i need to figure out what to tell the family when i get home. This Fucking sucks im not going to lie

I recently started a new job where I’m working with someone who is vegan. This is great and I have no problems with it at all. My diet also leans heavily towards vegan and I understand and sympathize with the reasons that can lead to this choice.

However, I seem to keep ending up in inadvertent conflict with my colleague in ways that surprise and baffle me. For example:

* After buying and showing him a vegan product I had just purchased (and commenting that I had done so in the hope of avoiding a more animal-product based health solution), I found myself harangued at length about how healthy non-vegan foods weren’t actually healthy, and “Would you eat a human? Have they done trials on the benefits of eating humans? No? Exactly!”

* I sent an all-office IM asking if anyone wanted a cheese sandwich I had accidentally bought (accidentally in that I thought I had bought a different filling). I received an email back from him demanding that I don’t include him on any further “offensive” emails. This was followed up by an office update telling all staff to use work communications appropriately.

I enjoy my job and I did enjoy working with this person, but now I feel quite thrown and unsure of how to react to him. I’m pretty annoyed at being accused of being offensive for my use of the words “cheese sandwich” and don’t want to bring it up as I can’t see a way of that conversation going well (I’m not planning to apologize; I don’t think I need to?!). I realize the obvious solution is just to never ever mention food (or nutrition or words that aren’t vegan) again, but I need help with how to get back to a place where I feel like I am comfortable in my work environment rather than slightly on edge in case he kicks off at me again for some insane reason.

TLDR, i am not performing as I used to in my job before i made my side hussle and idk if i should do anything about it.

every since covid started and companies started laying off people, I started realizing im in danger when no company was able to match my current salary, and the ones that do would, make me do a hunger games hackerrank competition with thousands of other people which I don't really wanna take part of..

My company even laid off a lot of people due to budget cuts a while back and i didn't feel secure at all, and knowing that i might end up with less salary should i get fired and settle for the next company that accepts me, kinda made me lose any trust i had for the whole being an employee thing... I have financial goals i want to meet and depending on this one company to not fire me is scary...

I registered a tech company and hoped I could take on some high budget projects, got nothing the first year but slowly i started getting some projects and now im hiring contractors to help with projects and its going great and im really happy and excited about it.

But i often need to manage said contractors, have calls with clients and even do some coding myself. Some of that i end up having to do in secret in my company time... we work in a big co-working space so i get to sneak into a meeting booth and do all that.

my manager lives in another country and basically im in a situation where i can get away with it without anyone noticing.

However, I used to be one of the top contributors in the company. I used to finish a butt load of tasks every day and i ended up being promoted to manager, but i still get some coding tasks. But generally, if it weren't for my side hussle i would still be a top contributor and shine like i used to, but now i mostly do what is expected on me, and im afraid someone would ask me at some point why im not as productive as I used to be.

nobody asked me anything but i just feel kinda guilty and miss having the one job to focus on and taking credit for a lot of things and helping everyone, but at the same time i dont trust that the company cares about me enough to give me any guarantees or stocks or bonuses so i feel i need to keep growing my side hussle to have a safety net..

thank you for reading my rant

[linux distro stuff]
Hey guys!
Im considerig switching to linux because:

My macbook does not support mojave and the new ones are expensive af.

Windows 10 is bloated and not a great user experience(removing stuff from the control panel and adding it to the very stripped down settings app, privacy etc..).

I love open source software

However i did not used linux for a long time, back then i used ubuntu and SUSE.

My considerations:
Debian - because .deb on them haters
OpenSUSE - because i used it in the past and it seemed very stable and fast
Arch - i heard from a lot of sources that it’s “da best”

My use case is game development and 3D modeling. I use gimp, blender vscode and unity (the game engine) at work i sometimes use autodesk stuff (motionbuilder, 3ds max) because of fbx.
For audio stuff i use audacity

So overall i’m looking for a distro that is fast, lightweight, i can develop on it (mostly 3D stuff) and occasionally play some games

Anyone has experience with the mentioned distros? What distro would you use for this?

I have a job(not really paid enough), and tomorrow I have a job interview for a front end developer at a company thats around 1 hour drive where I live, so the company is in the different city. Main reason I want a job(a good paying one) is because I want start living there.. start my own life. Everything would be fine but Im 22 years old and 3rd year in college. College is in my hometown where I live now. So every week I would have to catch a bus to my hometown to go to college, and then back.. My parents don't really aprove of this, and I will get no help from them if I move away.. Yeah, waited for this interview tomorrow for a month, and had many arguments and fights, and even one "panic attack". Pretty stressfull time for me now.. Can't wait to just see what will come out of this..

If I get the job, it will be a huge step for me, and probably lose some people who black mail me to not move away.. either I succeed or I fail..

Dear Quora

I logged out of your site because somehow you had me logged in and I don't like being tracked.

In the future, don't be petty by reloading all my OTHER tabs the moment you detect im logged out, intentionally breaking/disabling the backbutton, and then demanding I log back in.

kthnxbai.

Sincerely

- unsubscribed from your useless god damn spam emails.

If I can't even fucking read your site after logging out, like I USED to be able to, and you go so far as to detect my log out on OTHER tabs, disable/break the backbutton on all the OTHER tabs, and reload the page, then your site is useless as dogshit to me.

If I were the CEO of the executive who made this dumbfuck marketing decision I would fire him.

And then spitefuck his wife to drive home the message of how god damned fired he is.

I work as part of a small international team in a big corp , we work product quality of sorts but work closer to dev than qa , last week we found several giant issues and reported them in . Dev and Qa teams of said project are Indians . Meeting starts , two of my colleagues are indian as well , so dev , qa and all the other involved parties from india decided they should join in from the same conference room . My manager(he's a brit) presents the issues . Dev manager starts talking , qa manager talks over him , they start to formally yell at one another . One of them (couldn't figure out which one) started asking my two colleagues which one of them found these issues . At this point I had already passed a headphone to my ex-colleague who still sits next to me , he looks at me when he hears the question . I panic . Colleagues say they don't know (*phu* I didn't CC them in emails and my manager didn't tell them ) . My manager tells them to calm down , take responsibility and find solutions else he'll veto the product back into fullblown development . Other managers start growling and fighting again (more than 10 people were in the same room arguing) me and my ex-colleague decide to go take a coffee since I didn't have a saying in the meeting . We get back 10 minutes later , indians are still arguing over my manager trying to explain the issues a 4th time . I IM my manager and ask to drop the meeting , he gave me the ok and I dropped out, my head was hurting after an hour long meeting of angry indians arguing in a conference room and it kept hurting the whole day...yeah...meetings...fun time...

Have a question about raises.

Working in europe as a junior dev (had 2.5 year experience prior) but lowballed myself (because I had a 1.5 year gap from development) and started working here for 2.5k euro/month salary.

After my 3 months probation I noticed that Im doing better than 60% of my team and as soon as my probation ended I messaged my manager and asked for a raise to bump me up to 3.5k/month.

I am waiting for a raise for the past 7 weeks already. My manager keeps telling me that decision is greenlighted because I got very strong and positive feedback. However CTO is on vacation, once he comes back manager will be on vacation and so on. Basically a corporate clusterfuck.

So basically I will have my raise request approved what? 8 weeks after my original request? Also add a couple more weeks because I guess new contract will be signed from the beginning of next month, not retrospectively. So when I will actually get that increased salary? What the hell.

Since my original request havent even reached CTO yet Im thinking of amending my original request and asking for a bump up to 4k or quit the company and go contracting for the same 4k and pay 17 percent for taxes instead being employed fulltime while paying around 43% for taxes.

I am just pissed off that its taking 2 months to just get the 'okay' and I guess will take 3 more weeks to sign the new contract. It shouldnt be like that, I lost money while waiting so I think it would be fair enough to ask for a bigger bump.

I live in a college, sort of..
2 hours ago, the power was lost unexpectedly for less than a minute and then came back. Internet didnt tho.
They dont handle their own infrastructure in this college thingy, they hired a school to do it (it sounds fucked up, and it is a little fucked up).

Now little me is becoming impatient and offers my help. Gets rejected.

Additionally, i just started to have a fair sleeping schedule, and noe because the internet isnt working im about to fall alseep before lunch again.. i hate the people responsible for IT here..

i never knew id reach that point when i need to take a break from programming and everything that has been causing me so much stress for the past few days. and to be honest, it actually feels great to be focused on only one thing instead of stressing out on different projects and debugging them all at once.

in a few days, ill prolly go back to programming some side projects. its not like i can keep myself away from them...

programming is like a magnet for. that magnetic force is growing stronger day by day and im being pulled closer to it. im happy about it except for some occasions when i get too stressed.

Hi fellow ranters,
Its been awhile since I last was here posting stuff..

So, I've commited to my effords getting shit done in golang. And I met a lot of painpoints, and I mean...
A
Lot
Of
Them.

Anyway, most of them are solvable by changing mindset or having some macros set up for no-one-fucking-wanted bloody boilerplate code that is omnipresent fucking EVERYWHERE.. **cough**
Steering back on what I want to rant about.

We with our team have one major problem with golang. There is no standard for docs in code...
Like, Fing legit. Everyone uses notation for closest to theirs heart language, so you get inconsistent-as-fuck notations for parameters / function descriptions.

We have functions that look like
//doSth does something
and also
// doSth
// @Summary does sth
// @Description does something but in more words
// @Param
and so on and so on

And trust me Im getting mild example.

Why this language does not have A F...ING (well defined, using proper definitions) STANDARD YET?

EDIT:
bonus context: We decided that too much of our code is undocumented and we go through efford of documenting it, but everyone sees it differently, and we can't agree on one single standard... So we decided to not refuse PRs due standard, as well, nobody would ever had PR accepted