Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
![](/static/devrant/img/pipeless-devrant-banner-white.png)
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "dont kill me"
-
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..
She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.
The one that I did 3 weeks ago that same fucking morning.
AND SHE WAS STILL NOT DONE...
A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me
Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"
She then goes to my fucking boss to tell him I am bothering her.
And omg... Please dear god please kill me now...
Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.
He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.
Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!
Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.
all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.
the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:
Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.
Me: I am only using this laptop for work so thats not possible.
Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?
Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends
Boss: Ahh okeee I see.. Well dont let it happen again.
After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.8 -
Woohoo! 32k achieved!!! Finally I can post some new rant without risking some sudden overshoot 😁
So putting celebrations aside for a minute, a while ago I've noticed a tingle when I stroke my finger across metal areas of my tablet, or the sides of my phone (which probably has metal near it too) while it's charging. And it's been bugging me ever since.
Now, some things to note are that it only happens when my feet are touching the ground though slippers, and that the frequency is so low that I can actually feel the tingle when I slide my finger across the material. This to me at least seems like electricity flows through me into ground, and touching the ground directly provides a path so easy for the electrons to run away that I don't feel it at all. But if I lift my feet off the ground entirely, I just get charged up and after that, nothing else happens.
So those are my ideas. The answers on the subject on the other hand.. absolute cancer. Unsurprisingly, most of them came from Apple users. Here's some of them.
https://discussions.apple.com/threa...
- I've not noticed it, but if you're concerned bring the phone to Apple for evaluation.
- Me too facing same problem.. did u visit apple care?
And one good answer at least...
- google emf sensitivity, its real. You are right, there is a small current flowing through your body, try to limit your usage. The problem with this issue is those who aren't affected (lucky ones for now) will tell you these products are 100% safe. To a degree they are, i used my ipod touch for about 2 years straight vwith virtually no symptoms. then the tingling started and it gets worse.You will get more sensitive to progressively less powerful things. I dont want to scare you but just limit your usage like i didnt do 🙂
Overall that discussion was pretty good actually, aside from "bring it to the Genius Bar, they'll know for sure and not just sell you another unit". But then there's Reddit.
https://reddit.com/r/iphone/...
- Ok, real reason is probably that the extension cord and/or outlet is probably not grounded correctly. Either that or you are using a cheap knockoff charger.
Either use a surge protector and/or use the authentic Apple Charger.
- It's not the volts that hurt you, it's the amps
- I think you are in deep love with your phone. That tingling sensation is usually referred to as "love" in human language.
- Do less acid, I would advise.
Okay, so that's the real cancer. Grounding issue sounds reasonable despite it being wrong. Grounding is actually not needed when your charging appliance doesn't have any exposed metal parts. And isolation from high voltage to low voltage side actually happens through things like routering holes into the PCB, creating spark gaps, and using galvanic isolation through things like optocouplers. As for a surge protector? I'm using them to protect my PC and my servers, but the only purpose they serve is to protect from.. you guessed it.. voltage surges, like lightning bolts hitting the grid. They don't do shit for grounding or reducing this tingle! What a fucking tool.
It's not the volts that kill, it's the amps.. yeah I'm sure that the debunking of that is easy to find. Not gonna explain that here. And the rest of it.. yeah it's just fucking cancer.
Now what's the real issue with this tingle? It's actually a Class-Y rated (i.e. kV rated) capacitor that's on the transformer of any switch-mode power supply, including phone chargers. If memory serves me right, it helps with decoupling the switching noise and so on. But as it's connected to the primary side of the transformer, if the cap is sufficiently large and you are sufficiently sensitive, it can actually cause that tingle by passing a fraction of the mains electricity into your body. It's totally safe though, as the power that these caps pass is very small. But to some, it's noticeable.
Hope you found this interesting! And thanks a lot for bringing me to 2^15. I really appreciate it ♥️15 -
ARE YOU KIDDING ME.
I've got a client that is complaining a long sentence is on multiple lines on a mobile device.
You literally cannot make this stuff up. They are literally saying, "move this specific word up to the line above."8 -
So I ve been clinically depressed for about 10 years now. Been really great at hiding it. My illness and loneliness was so severe that i made up imaginary friends and that got so severe i couldn't tell what s real and what s not. Then about 5 years ago, i met a girl. As the cliche goes, everything felt better. Sunshine and stuff. I opened up to her. Shared stuff. I started becoming normal. The pain became bearable and manageable. Turned to entrepreneurship. Had goals and stuff. Had 7 failed startups but kept on going. Raised investment for an 8th. It went better than anyother. Was going to become the next big thing bla bla. She became the reason i turned from being a loner weirdo to someone awesome. Anyway, as nothing tends to last, my best friend who had been through thick and thin in my work, quit last year in October. He messed up some work from big client nd we had a fight. He left. In the meantime i scored a big multinational company. I was gonna propose to my girlfriend in March this year. But instead she decided to leave for someone better who left her in 3 weeks lol. Anyways, we broke up. During that time, my second friend decided to fuck up my work with the big company so hard that they were about to blacklist my company. And then he left too. I had a small team. 4 5 people doing their best. By that time, i was the only one left. On 28th feb i had my breakup, on 1st march i was sitting 700 km away from home in an office trying to talk the company out of blacklisting us. It took me around 20 days to make that happen. All the while dealing with the obvious, my depression getting stronger than ever. My imaginations taking shape and fucking up my reality. The voices in my head getting stronget and stronger. 4 months now since she left. I dont think i miss her anymore. She tried coming back once but i didn't let her. In the 4 months, i m at my worst. I am getting government contracts now. But i have no desire to do anything. The pain is unbearable. So much that on its good days it sucks the life right out of me. So much that when it gets severe the urge to harm myself in any way goes of the charts. My best friend and i, we became friends again after my ex left. He s been helping me as much as he can. I have all the good oppurtunities and chances that any entrepreneur who has been busting his ass for 5 years straight would kill to have. But i cant do anything. I m the only one left on my team. I have to handle the business, dev, marketing etc etc ends on my own. I tried hiring and scaling up but i messed that up because of obvious reasons. And now my company has 2 months of runway left. And i know if i bust my ass i can make it to 8 months more and even raise a round a. But its really hard to do when either you re sleeping 20 hrs a day or you re sleeping 3 4 hrs because you re afraid of the nightmares. Or when even you ve had a good day, the pain becomes so much that you lay on the floor having a breakdown. Yeah, i m trying professional help. I m hoping it helps me. Because right now, i dont care about being happy. I just want my sanity. Something i m clinging to with every fiber of my being. Something that s burning out like a candle burning from both ends. I cant give up my work. I dont want to. That s all i have. That s all what i love doing and now i cant even do that. I just want this to end somehow. Either i get better and the pain and the void and silence and everything else goes away, or i do. I dont know what will happen first. And i dont care. I just want to be normal. But i guess that s too much to ask.8
-
Life as a homeless developer.
I'm a lil brainsick but homelessness makes you that way.
I started writing software as a hedge against an old injury i had from my teen years. I have a unique condition leaving me with limited use of my hand as such any jobs like cashier call center and they like are of limits to me, i can't hold change because my hands don't bend flat, and to much typing is excruciating. Therefore being adev should get the most bang for the buck that I have left. Ive been doing this for 12 years. Well it's all bullshit and unicorns. I can't get a job to save my life. All i get is calls from recruiters wanting a full stack retard. I'm an erlang developer for about 5 years, c# php no i can't do Photoshop or frontend gay as colors because it's a different skillet. Oh but trumpy says we're at the lowest unemployment ever, ya because we're all homeless and companies are still looking for unicorns, they don't exist just like the fake jobs which is the real fake news. In reality if a company wants you its because their dev left and you are to fix their broken shit, which never worked in the first place thus cannot be fixed besides I'm not a plumber. In my opinion many companies nowadays are run by liberal sjw children who don't value your time but want the product now, spoilt. Recruiters are the worst, gimme money because i touched your resume. I'd rather just kill myself than try to appease some fucking retarded children. Its so awesome to live in a tunnel while my skills entropy while i have 160 self published github repos, know many programming languages and be told your have no value. its those same children that dont understand the flow of money or value loyalty, claim we have all these jobs but no skillid employees, so they can bring in more visa overstayers, underpay them and claim record profits, the more you pay forieners my countries money the less there is to go around in the society leading to disenfranchised people like me, and you wonder why there's so many shootings in il. How long can i endure homelessness before i start becoming a criminal? Soon i will have no other option. You employers had a choice but I'm going out with a bang.25 -
When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁
"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|
"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|
"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|
"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams6 -
Damnit...
I'm kind of a perfectionist, which is one of the reasons why I don't post here very often.
I think that my posts have to be the most hilarious or creative ones to even be bothered to be read by anyone.
Now.. I'm kind of not sober, so I'll just write some idéas, jokes and rants in notes on my iPad.. Sleep, and get drunk again tomorrow and maybe post them...
Or maybe just delete this post and be ashamed tomorrow?
I at least posted this under the "Joke/Meme" tag so that people won't be offended, hopefully, by this "none-rant".5 -
make code change
stop server
try to re run server
dependency problems
java, tomcat, gradle , eclipse, just kill me, dont torture me like this1 -
i hate linux like a lot , how do you guys use it
like you guys dont want an advertising ID, how the fuck will advertisers know who you are and what you like?
open source , give me a break, you mean your os devs are soo untrustworthy that you just have to see what they wrote in the code, who does that?
free come on, how poor are you linux people, i mean, quality stuff gets paid for, free stuff just means it's trash
and the linux devs , the aint like real coders they are just hobbysts, making your os in their free time
and who wants to install their own software anyway, on other platforms the company curates restricted software that you can use, and i know you'll say its oppressive but its just customer protection.
and i do want my platform to track everything i do, it only helps them build better stuff for me.
and whenever they decide to outdate my hardware and kill support for it, it only means they care and want me to get the latest tech, how considerate.
wait , i hear you say, there are no bugs in linux, my vendor makes sure my os comes with the latest antivirus software, nothing can break my system.
and just because linux runs on servers and most super computers only shows that common users like you and me are ignored, at least my vendor is not a sellout, and still makes stuff for the masses.
you say freedom i say safety i can sleep safe and sound for am protected nutured under one echosystem of software that i can not leave.20 -
i have been working on a web-based game and this is my daily routine (also i listen to rock and metal)
college to home to coding
thinking
coding...
looks like theres a small bug
shouldnt take much time
maybe this can work
*screaming*
i am not the first with this bug *here i come stack*
dont do this to me stack... theres suppose to be a fix for it
*extreme head banging*
F*** it
*changing songs*
nope this not helping
F***
F*** THIS SHIT
*rhythmic head banging*
oh god kill me
F***
am i really that bad
*autistic screaming*
humming song instead of thinking of bug
(8 - 8:30) me: mom i am hungry
this shit is taking toooo much time
*high intensity screaming*
F*** you bug
coding, its not form me
*surfing devrant*
*felling i am normal*
(10 - 10:30) mom: when are you eating
*high pitch screaming*
i am leaving coding for sure now
its too late time to sleep
fml its late again, i am gonna miss the first lecture again
back to coding
A thousand year later...
Bug status: Still not fixed4 -
Today I was debugging some shitty code left by unknown developer whos linkedin account is dead and phone number left in contact card calls local pizza house.
I knew it qould be hard so i've made myself comfortable, gathered 5 redbulls and other items that diabetes people would kill for eating again.
After around 10 minutes i was already frustrated but i kept the pace. "Who is the best, little devie, you!" - I fooled my ego to keep up and shut up.
After around 10 next minutes my attention span has ended. Limbic system started injecting some hormones into my brain, but I remained silent.
First two energy shots were applied. I felt like hero again. Two minutes after I was debugging through some library that was written fo java and found out that it ahots some natives to a c lang lib called "mypreciouslib".
Oh flock, how can i debug it if ita compiled , I cannot do such things, Me be only junior dev. I started swearing, but silently.
Started ollydbg to see what is inside livrary, i searched through but i couldnt match anything it was like mess stirred with fecals of an elephant.
So I opened aida pro " with vitamins" cause obviously, our pm says "but you write in java right " so we dont need those tools right ? Fuck no.
Aida was better at least i could find some funcions calls, but hey, the progress. I was swearing out loud, with earplugs in. And by the time I've sweared all the things in company i got a reminder.
"Hey -insane- stop swearing, the children are here."-sayys pm, it is some kind of " family and work " shitfuck day.
So i asked them: " why wouldnt you buy this fucking tools for programmming for us , you wouldnt have to hear me fucking swearing" . then i realized that , colleagues in room heard all of it, and one of them, total fuckface buttlicker(dev without bit of knowledge) started something like "you are wrong, see how good our software is sellling". Pm was like smiling like he thanked him for buttlicking again. Not to mention he is officially retarded and i know his password to all our services cause he is so smart to put it into text file and then have sharing files in windows turned on.
The other one told aloud, that we would be much better with some debugging tools that are better than fucking eclipse if we have to work without code.
PM told us that he will arrange a meeting. At that point I didnt care any longer. I just fired myself, fuck them.
Please saint Stallman give me hope and joy of programming from my teenage years. Uhhh..2 -
Check in, check out, punch in punch, out, wax on (my balls), wax off. Do your duty. Be a good citizen. Work overtime. Conserve the environment: buy a tesla that runs on afghan lithium conflict minerals. Post your life to facebook. Get married. Have exactly 2.5 kids.
Use jquery. Use knockout. Use react. Use vue. Use svlete. Use heroin. Used needles. Used people. Used toilet paper. Toilet paper apocalypse. Social trends. Be a good citizen.
Watch tv. Watch nightly news. CNN says. Fox news says. Hey, did you read this article by important funny guy on tv? American taliban. Scary. Be afraid. Hey did you read this article on cute puppies? Funny! Did you see this meme? What a funny meme! HAHAHA. Do we need prisons for dissidents? Do we need to release all the prisoners in federal prison? Should we round up people who dont follow health authorities? Science says. Science is wrong. Science is right. Man in robe agrees with me. Man in robe disagrees with me. You're evil. These people are bad. Is doing bad always wrong? Should we tolerate intolerance? Its time to stop tolerating intolerance. Be an individual, like everyone else. Be you. Be the best you that you can be. Individualism. But we're all in this together. We're all different and unique. But we're all the same. Love each other. Love humanity. But not these guys over here. Punch a nazi. Punch a commie. Isn't it time we punched a nazi? Isn't it time we had socialism? Isn't it time the old get out of the way for the young? Why are the old hateful? Why do they horde all the money? Do we need rent controls? We need rent controls. Its time for rent controls. I think I believe what others believe. Believe different. Think different. Apple. An apple a day keeps the windows away. Open windows, a breathe of fresh air. Is climate change real? We need to have a national conversation about climate change! The world is freezing. The world is flooding. We're all gonna drown. The world is overpopulated. We need to talk about overpopulation. People who have too many kids are polluting the world. America doesnt have enough kids! Is it time to bring in more immigrants to have more kids? Who will work the fields? Thats racist. Is racism an epidemic? Is white flight an epidemic? Lets talk about epidemics. Lets have a conversation about mandatory vaccination. Lets have a national conversation about mandatory pandemics. I mean, vaccinations. Lets change the world. Trust the science. Don't trust the science. Bu-bu-bu-bu-bu I'm loving it. Love who you are. Live love laugh. If you don't love me at my best, then you can't handle me at my worst. People who disagree with [current year] are the worst. Is it time to regulate speech? Its time to regulate speech. Should there be laws against hatespeech. I think there should be laws against hatespeech. People who upset me should go to jail. Its current year. Think big. Think outside the bun. Have it your way. All the time, always. All for freedom, freedom for all. Because this is america, and current year. I like to work hard. But you have to remember to play hard too. Work hard. Play hard. With a childlike sense of wonder. Be you. Belong anywhere. Just do it. Challenge Everything. Because you're worth it. Save money...live better...have an abortion. You're in good hands. Democracy dies in darkness. Is it time to regulate hatespeech. Politician in current year is hurting our democracy. War is a racket. We need to liberate afghanistan. Why are we bombing afghanistan? Its there culture. They're oppressing people! Don't criticize anyones culture. Be kind. Rewind. Go further. Lets go places. Because Impossible is Nothing.
Lets change the world. I'm a smart passionate funny guy with a childlike sense of wonder and play. You ever want to travel? I want to travel. See the world. Eat new food. Eat. Love. Pray. Eat love. kill. Is meat murder? I think meat is murder. Go vegan. Go home. Order out. Support your local economy. Think global, act local. I'm a good corporate citizen. Be the change you want to see. Did you hear about this local brewery? Do you like craft beer? Hey try this new IPA. I shared it on twitter. Twitter is a very important part of my life. I think what other people say matters, and them reading what I think matters. What I ate for lunch matters. Hey what did you eat for lunch? I LOVE FOOD. You want to order door dash. There new commercial is amazing. Commercials are SO FUNNY. Hey did you see this meme of this commercial? I shared it on tiktok. Heres a funny dance. Watch these nurses dance. I wish I could dance like that. They're so overworked. So brave. Our hospitals are overflowing. People are dying. Hey did you see this new dance trend on tiktok? I like tiktok. I think its a very important part of life to share your life with others. Nurses are dying. Look at this image of hospitals. Scared. Very scary. Very bad. Bad and scary. Big thoughts! Thoughts and prayers!
Because Yes we can!
Beep boop.7 -
Because I am very interested in cyber security and plan on doing my masters in it security I always try to stay up to date with the latest news and tools. However sometimes its a good idea to ask similar-minded people on how they approach these things, - and maybe I can learn a couple of things. So maybe people like @linuxxx have some advice :D Let's discuss :D
1) What's your goto OS? I currently use Antergos x64 and a Win10 Dualboot. Most likely you guys will recommend Linux, but if so what ditro, and why? I know that people like Snowden use QubesOS. What makes it much better then other distro? Would you use it for everyday tasks or is it overkill? What about Kali or Parrot-OS?
2) Your go-to privacy/security tools? Personally, I am always conencted to a VPN with openvpn (Killswitch on). In my browser (Firefox) I use UBlock and HttpsEverywhere. Used NoScript for a while but had more trouble then actual use with it (blocked too much). Search engine is DDG. All of my data is stored in VeraCrypt containers, so even if the system is compromised nobody is able to access any private data. Passwords are stored in KeePass. What other tools would you recommend?
3) What websites are you browsing for competent news reports in the it security scene? What websites can you recommend to find academic writeups/white papers about certain topics?
4) Google. Yeah a hate-love relationship, but its hard to completely avoid it. I do actually have a Google-Home device (dont kill me), which I use for calender entries, timers, alarms, reminders, and weather updates as well as IOT stuff such as turning my LED lights on and off. I wouldn"t mind switching to an open source solution which is equally good, however so far I couldnt find anything that would a good option. Suggestions?
5) What actions do you take to secure your phone and prevent things such as being tracked/spyed? Personally so far I havent really done much except for installing AdAway on my rooted device aswell as the same Firefox plugins I use on my desktop PC.
6) Are there ways to create mirror images of my entire linux system? Every now and then stuff breaks, that is tedious to fix and reinstalling the system takes a couple of hours. I remember from Windows that software such as Acronis or Paragon can create a full image of your system that you can backup and restore at any point to get a stable, healthy system back (without the need to install everything by hand).
7) Would you encrypt the boot partition of your system, even tho all data is already stored in encrypted containers?
8) Any other advice you can give :P ?12 -
Just want to put it out here... reading this will waste ur time. :(
Having a serious crush on co-worker. I tried not to have a crush on him initially because he’s a colleague and he seems to be much older(max 10 yrs I guess). Age isn’t an issue but ppl say it’s not good to like someone from work.
But then he kept on glancing at me and caught him turning back to look into my cubicle at several occasions. Saw him looking at my direction across the room, hall, turning back to look when he was waiting at lobby, and all the way from smoking corner as well. Could be possible that he just happened to be looking in my direction several times.
Now, haven’t seen him since early feb because of the quarantine. Luckily, I chanced upon his number when everyone in the dept was put into the same chat channel for the Covid19 news. I had this urge to ask what was it all about because we’ve been told to wfh till further notice. Who knows what could happen to us during these period.
So tried to be brave and asked abt why he was looking into my cubicles several times, without coming out weird (I hope). His reply was “dont know”. I don’t know what to make of it. Could have been anything else but how could someone just reply don’t know.
Then came yesterday, my friend was telling me about her experience on tinder. Apparently she’s been using it for fun and she got funny texts from the guys there. So I decided to give it a try. Man, it was so fun swiping left all the way (cuz they couldnt be compared with work crush) till I swiped right for this older guy. We matched!
He was the first one to match, probably abt 5-10mins after I’ve finished setting up profile and all that. It was totally a new experience for me. I forgot abt my work crush in that moment. He had this minimalistic vibe. Didn’t smile much in his photos, gave me calm feeling and looked so cool. He put “Everything is good in moderation” in the bio. He’s the only one comparable for that work crush. Not sure who’s supposed to start saying hi. My friends said wait for the guy, so I waited.
Got a few other matches after him but didn’t like them as much as him. I finally decided to say hi. No respond till today. Given that he put Doctor for his occupation, I assumed he’d be busy. So I waited. Then sent another in late afternoon asking if he plays LoL often (he’s wearing LoL land yard in one of the photos). No reply.
I started to feel weird because this is supposed to be light and fun because who takes things seriously on tinder, right. They’re there to flirt and kill the boredom especially because of the lockdown. And I started to have serious feelings for this one guy whom didn’t even bother to reply. So decided to delete tinder for good. Sent him one final msg that I really wanted to get to know him and I thought he’s a really cool handsome dude. But now that I’ve deleted my acc, he wouldn’t even see my msg anymore.
His profile name is Randolf. I want to get to know him in real life. But is it illegal? :(
Thank u for read this far. I just didn’t know where to put all those feelings. And sorry for wasting your time with nonsense.17 -
Yet another thing i think is fucking stupid.. GDPR btw.
So, a guy in Denmark owns a grocery store and has an issue with people stealing from him a lot the last couple of years. He catches them on tape and shares it on social media to try and prevent it.
Im not sure why it didn't work to go to the cops, but it didn't.
What the owner ended up doing, was hang a note on the front of the store so people could see it before they entered, see attached image.
However, now he has been notified what hes doing is illegal, because the "user" doesn't consent clearly enough.
I dont understand GDPR, but if you do, you're probably gonna find mistakes in what i wrote.
Source for story: https://bt.dk/erhverv/...
Its his fucking store, if people steal from him he should be allowed to post it on pornhub if that was his desire.
It's illegal to kill someone, but if you're threatened on your life, you may kill in selfdefense.
To me, those are the same, just one is on a much more serious level of course.
Fuck me.13 -
I'll post a rant (will be long) soon-ish on the root of the asinine problem...
TL;DR
Anyone got a better suggestion of killing a WLAN router signal than a Faraday Cage?
-----------------------
As to the point as I can manage atm...
My ISP forces a proprietary router/modem for them to script my static IPv4 block (/28, aka 13 usable). Modifying this equipment in any way or using the vast majority of tactics to modify its behaviour = Federal Felony... with my history, it couldn't be construed as mistake/ignorance of this fact, so I'd likely end up working for some branch of the gov to mitigate the costs of standard prison (on both ends... handicapped af = expensive af to comply with base human rights laws... plus I'd be a dangerous prisoner from what I've been told).
I NEED the ipv6 functionality TOTALLY off... I've written this into every kernel and every container config at kernel level.
The issue is, I don't trust their shit device (which "should" also be set to no ipv6 via gui... non-GUI = fed felony).
This horrid device, they apparently made them for home use initially (to be fair it has decent specs and tolerable RAM), so included WiFi... that comes on by itself.
Disable the WiFi!... except I cant (at least not without 'tampering').
Why? Well acc to the GUI it's not enabled in the first place. Acc to the 'tech support' it's apparently a paid feature (yes, nonsense) that I have not paid for (nor would I), meaning on their end's GUI and DBs I also don't have WiFi ability from that dev.
So... Not trusting the other settings and the dev, being something im not allowed to directly config outside of their GUI that doesn't realise it's putting out a usable signal despite registering DHCP on behalf of that non-existent signal. I NEED to kill those signals.
I realise it likely sounds extreme to make and use a Faraday Cage for a router/modem (secondary modem, it parses the initial modem's output, via script, to allow the static block to be accessed). I really dont know any other way that's legal to restrict it.
Oh, in case unclear, I have tried so many ways to get them to just allow me to use any device (pref. mine, but even their's) that i can simply script myself... it's a no-go.20 -
Recruiter answered me
Rejected
They decided to choose another candidate because... [the reason will be announced at the end of this rant]
...
I was working on my project
I am learning new tech
And shitting 10 times a day from these jobs and recruiters, the usual me
HE the recruiter contacted me a few days ago
HE offered me nodejs position
I AM the one who was HONEST and told him i dont work in nodejs i work in java
HE then continued the conversation
HE offered me a java spring boot backend position
I AM the one who read the requirements
🔥🔥🔥
REQUIREMENTS: 3+ years of experience
🔥🔥🔥
I AM the one who told him i have 5+ years of java spring boot and 8+ years of java experience.
HE said great I'll contact the clients and let them know
TWO WEEKS LATER OF SILENCE
"unfortunately they chose some other candidate because they need someone with 10+ years of experience for this role"
---
Are you fuc
Fucking
Ki
Wasting my Fucking time?
You decide to slam into my peace and offer me a job position with ALL THE REQUIREMENTS I FULFILL, JUST TO RANDOMLY REJECT ME FOR AN INVALID FUCKING REASON?
If i said i had 10 years of experience
They would reject me because i dont have 15+
If i had 15+ years of experience i would get rejected for not having 30+
If i had 30+ years of experience fucking your whole family and bombing them to dust like in palestine till their bones die and worms eat your fucking down syndrome brains, they would say i need 160+ year of experience
Fyck you
Truly.
From the bottom
Of my fucking balls and cum
From my fucking dick
From my fucking shit and asshole
From my vomit
I wish you death.
I wish karma to kill all of their family members (the clients who rejected me) slowly one by one. Final destination accidents type of deaths. Truly i hope you and wish you the worst.
[Here the intro continues]
I will repeat again:
- REQUIREMENTS: 3+ years
I have:
- 8+ years
They rejected me because:
- I don't have 10+ years
I told all of this to recruiter now. Politely but because im losing my patience i was very very passive aggressive with my response. In the context of
1. I TRULY dont give a fuck for your rejection (which is the truth)
2. Your clients are low IQ dumb as fucking retards because they choose people based on the YEARS OF EXPERIENCE
3. Explained him: IF YOU ARE SO FUCKING STUPID TO UNDERSTAND THIS COMMON SENSE, I'LL EXPLAIN IT TO YOU: CHOOSING DEVS SOLELY BASED ON THE YEARS OF EXPERIENCE MEANS YOU ARE FUCKING STUPUD. There are devs with 2 years of experience who are WAY smarter better efficient and more knowledgeable than some devs with 5-7 OR MORE years of experience. Thats because some people progress better faster or more efficiently in 2 years while others need 5 years. Etc. You're fucking stupid as shit for this sole decision
4. Indirectly let him know that i am not pissed off for rejection. I am pissed off for my time being FUCKING WASTED.
5. Also pointed him out: your job description says its looking for a dev with 3+ years of experience i told you i have 8+ and you reject me because I don't have 10+. Are you Fucking stupid? Fuck you. Truly fuck off. Get the fuck off my dick and eat the shits i shit straight out of my asshole. I'll shit in your fucking mouth you fucking bitch. Your wife also probably fucks some other guys while you're at work and she doesnt respect you or love you. In the matter of fact give me your fucking wife/gf and I'll Fucking fuck her to death
To the clients once again: Truly i hope Hamas fires a missile at israel but misses and hits your fucking home and your whole fucking family blows up to atoms and particles. Completely erased from existence.14 -
i dont know sql, gotta look shit up and dont much of it really internalized
i may be now being assigned somebody else's task to do some sql shit
fucking kill me3 -
I'm literally in pain right now and not a thing I can do.
If I eat whatever the fuck is wrong with my jaw (cracked tooth or cavity) starts throbbing from the chewing action, in addition to coming on for no reason at all. vision-blurred-waves-of-nausea levels of pain. Enough that I'm alternating between laughter and almost tears.
I've downed four aspirin and it's still just barely enough WITH the numbing gel.
Got lock jaw something aweful.
Barely convinced a dentists office, which is supposed to be closed (and cancelled all it's appointments due to corona), to come in during quarantine. But thats monday. Dont kno how I'll make it. They do payment plans but I'm flat broke because I decided to pursue programming right when all this fucking bullshit went down.
And all I can think of while im typing this is the pain.
And fuck me I cant do weed because my backup plan if I fail at coding is the military.
And this stray dog that the neighbors 'adopted' but leave outside WONT STOP FUCKING BARKING.
Fuck me. Just kill me now. Do it.
Gonna go watch comedy because I read a research paper that says genuine laughter raises pain threshold by up to 10%.12 -
Between android studio and Unity, which one si better to make a adventure text game? Why? (i'm learning, dont kill me please)8
-
So i wasted last 24 hours trying to satisfy my ego over a shitty interview and revisiting my old job's codebase and realising that i still don't like that shit. just i am 25 and have no clue where am i heading at. i am just restless, my most of the decisions in 2023 have given very bad outcomes and i am just trying doing things to feel hopeful.
context for the interview story-----
my previous job was at a b2b marketing company whose sdk was used by various startups to send notifications to their users, track analytics etc. i understood most of it and don't find it to be any major engineering marvel, but that interviewer was very interested in asking me to design a system around it.
in my 1.2 years of job there, i found the codebase to be extremely and unnecessarily verbose ( java 7) with questionable fallbacks and resistance towards change from the managers. they were always like "we can't change it otherwise a lot of our client won't use our sdk". i still wrote a lot of testcases and tried to understand the working of major features.
BTW, before you guys go on a declare me an embarrassment of an engineer who doesn't know the product's code base, let me tell you that we are talking SDKs (plural) and a service based company here. their was just one SDK with interesting, heavy lifting stuff and 9 more SDKs which were mostly wrappers and less advanced libraries. i got tasks in all of them, and 70% of my time went into maintaining those and debugging client side bugs instead of exploring the "already-stable-dont-change" code base.
so based on my vague understanding and my even more vague memory from 1 year ago, i tried to explain an overall architecture to that interviewer guy. His face was screaming the word "pathetic" from his expressions, so i thought that today i will try to decode the codebase in 12-15 hours, publish a cool article and be proud of how much i know a so called martech system design. their codebase is open sourced, so it wasn't difficult to check it out once more.
but boy oh boy i got so bored. unnecessary clases , unnecessary callbacks static calls , oof. i tried to refactor a few classes, but even after removing 70% of codebase, i was still left with 100+ classes , most of them being 3000-4000 files long. and this is your plain old java library adding just 800kb to your project.
boring , boring stuff. i would probably need 2-3 more days to get an understanding of complete project, although by then i would be again questioning my life choices , that was this a good use of my 36 hours?
what IS a correct usage of my time? i am currently super dissatisfied with my job, so want to switch. i have been here for 6 months, so probably i wouldn't be going unless i get insane money or an irresistible company offer. For this i had devised a 2 part plan to either become good at modern hot buzz stuff in my domain( the one being currently popularized by dev influenzas) or become good at dsa/leetcode/cp. i suck bad at ds/algo stuff, nor am i much motivated. so went with that hot buzz stuff.
but then this interview expected me to be a mature dev with system design knowledge... agh fuck. its festive season going on and am unable to buy any cool shirts since i am so much limited with my money from my mediocre salary and loans. and mom wants to buy a home too... yeah kill me3 -
!dev
Ok, this happend to me today, i met a girl about 2 months now was the time to met in pearson i mean real life. a "Friend" was
Insisting to me for give to he the phone of the girl.
about 4 hours later i receive a message from she saying that i was a fucking depraved and stuff like that, i ask her why she was saying that and she write "Because your friend tell me that you only want to fuck with me", i ask to my friend what he did and he say "Nothing" i take his phone and view that he said that "Oh come on he is just a fucking stupid who is on the pc all the day masturbating and with windows with letters, really do you want someone who do that.". now i dont know what to do.
In my medical history I have had depression 3 times in my life with suicide attempts.
sorry for my bad english im from chile (spanish)
now i just want to fuck of all and kill myself. i need help.12 -
Working on an Angular project for the change of things. God, please kill me already.
Its fucking slow - hot reload? I am gonna make myself a coffee in the meanwhile
Its fucking stupid - Why make it easy when you can make black boxed. Make the magic happen!
And please dont get me started on Ressources, documentation, error messages and all the other stuff thats annoying here. Never going back to Angular, if it wasnt paid that well…3 -
This is probably the worst place to start my Rant saga but this is recent (this is one of the last few episodes of a 3 series cluster fuck of a job so you're missing out on all the straws that go into breaking the camels back and making him unaccommodating)
TL;DR I do good work, management dont like me and go out their way to try and fuck up my days
So, lets start, I'm a contractor, got funeral Tuesday, book leave, book WFH for day after.
I leave in 3 weeks, woman who is the CIO's right hand bitch takes me into a room the next day or so in the morning to discuss my WFH day. Leave on tuesday is cool but this WFH day...there's only so long until I'm gone so they want me to stay in for more face-to-face time blah blah blah (considering this woman isn't even part of the project I'm working on anymore because she decided to deflect it onto a underqualified junior with no PM experience)
So I sit there, thinking of all the blood and sweat that I have shed, the mountains I've moved just to be told to move the mountain somewhere else and whether coming in would kill me (in other words im fucking burnt out!!! I have built their GDPR database and app backend single-handedly with no requirements, project managers who can't plan and being chastised for asking for documentation/plan/anything written down and having the CIO who is also the fucking DPO ignore any emails/slack I send him relating to the project and having to keep up with a team of devs....).
So because there was a momentary silence, she decided to fill the gap
"Oh, you've done some good work so far and I wouldn't want you to ruin it all in these last 3 weeks. So just come in on the Wednesday so that we can have you here."
Hmm....yeah...i didn't notice what she had ACTUALLY said there, still thinking about can i be fucked? So she decides to add
"...there's only 3 weeks left, wouldn't want you to burn any bridges. Remember, we still have to give you a reference"
....Okay....shots fired. So i respond
"You saying, if I take a WFH day, you'll give me a bad reference?"
"Noooo no no no, not saying that, just that you've done good work and we wouldn't want you to ruin it"
"With one wfh day?"
"We just want you to come in because the developers might be coming here that week"
"Oh... I hear that...what day?"
"I dunno, it's not been booked yet"
".............................I'll think about it"
"There's nothing to consider"
*Start leaving room* "I'll think about it...."
So cool, obviously, had a think, decide to shoot over an email (or more accurately, a collection of bullets). Which basically said, in devRant translation, "Fuck y'all, I'm WFH on that day, I wish a motherfucker would fuck up my reference, we can go that way if you want it. *snaps fingers* I. WISH. YOU. WOULD! "
Woman says "I wasn't threatening you, was just saying...dont ruin your last 3 weeks, wouldn't want you to burn any bridges and that we still have to give you a reference"
What kind of Godfather comment is that?
Come in today, the CIO, who is a prick who don't like me for whatever reason, sends me long email trying to disrespect me and in the midst says "I’m sorry that you have chosen to react like this, I’m sure that [my bitch] was conveying a position that your last three weeks of contract are crucial for a smooth handover. I have made the decision to not require you to work from home on Wednesday. I understand you are on leave on Tuesday and therefore this is now extended to include Wednesday. I look forward to seeing you back in the office on Thursday. I hope this will make the situation better for all parties."
.................................thought you lot needed me in the office to ensure a smooth handover................logic..........people.............where the fuck do you get yours from!?!?!?!? All this just so they can say "We made the decision at the end :cool:" -
SO's accepted answers being "no dont do what you want to do, use this corporate™-certified library instead, we ALLLLL use it too"
Like bitch if I wanna kill myself with a knife, tell me which vein to cut, dont recommend me a gun, I dont want it. ffs.9 -
!dev
Why must I always be the guy that has to connect with people?
So I'm applying to a retail job, and the section manager, lets call him Tim, is kinda low energy.
Come in four days later after the first meeting, to just let him know I put in the application. We're talking, talking some more, and he basically wants to hire me but says it usually takes 1-2 weeks for the background. Well that's nonsense for a retail position doing stocking, but alright.
And I'm heading out the door, say to him "dont kill yourself on shift", he doesnt even laugh, just flat affect, monotone, "I know I still got an hour and a half on shift."
And as I'm driving away I'm thinking, that's how the entire conversation was like.
It wasn't just misery or tiredness. The dude, Tim, I'd seen that face and heard that tone before.
Its the behavior of someone who actively doesnt want to be alive.
And as I'm driving away, I'm just thinking, how do I go back? How do I go to this total stranger, who I'm also applying for a job with, who I just met, and say *look, I dont mean to get personal and this is probably uninvited but I know something's up with you. You were like this last time I met you, and you're like it even more now. I know bro. I know. You think no one sees you're going through something, but I do.*
I see shit like this and it's so obvious and by the time I realize I should say something, the opportunity has passed, the moment has passed. And it's like, is it even my place?
But to see someone like that, to be familiar with that look on their face, and to let them walk away...
I just dont know.4 -
People ask me who do i support israel or palestine, to which i have no clue, i know nothing about both, i dont care about both and i have nothing against both, but whenever i have to choose a side and dont know which one i just look at what america chose and immediately i know they chose the bad guys because america is the biggest terrorist organization to ever exist on this planet. This means israel is also a terrorist country because it inherited their superior terrorist master country
However after seeing what these palestine barbarians do to israelis on https://watchpeopledie.tv/ and seeing them how happy they are whenever they kill someone, they're so joyful and blissful as if they won a billion dollar lottery, i will choose not to in fact stand with palestine, as they are no better than the terroristic israel country, so fuck palestine too
I view both of them as terrorist vs terrorist fight. A cartel vs cartel. I dont have to choose any side to support in this case
There you go. That's how a logical, objective, rational mind creates conclusions and decisions based on facts36 -
Been seeing some ridiculous dumbshit comments regarding war which piss me the fuck off so I'll address them here
---
"xyz country did not abide by the rules of war"
What RULES in WAR? WAR is WAR, there are no fucking rules! Anyone can kill anyone however he wants to!
"Using xyz is illegal in war"
What can be ILLEGAL in WAR? WAR ITSELF is fucking illegal you dipshits. You just made a crime legal, normalized it and called it WAR
"Doing xyz is a war crime"
WAR-CRIME? WAR ITSELF is a fucking crime you cuntfuck! You cant do further crime than participating in war! While you're legally doing that crime you might as well do anything else illegal because now everything is legal in war, there is no such thing as a fucking war crime
"Do not kill women children and the elderly in war"
Why the fuck do they get a free pass? How about the 18 year old, 25 year old? Its fine to kill them? Who the FUCK are you to say who can be slaughtered and who cannot? Get the FUCK off my dick you fucking dickriders. If some groups of people can be slaughtered THEN SO CAN WOMEN CHILDREN OLD FUCKS AND BABIES BE SLAUGHTERED! DONT GIVE A FUFK. Either stop the fucking war or dont complain who got slaughtered.
NO RULES IN WAR.
NO MERCY IN WAR.
Same way how recruiters show no mercy or compassion in hiring. They dont give a FUCK. They fuck with everyone and waste everyone's time. Same way in war. Fuck anyone. Slaughter anyone. OR. Dont begin the fucking war in the first place7 -
Thinking to start smoking 🚬
Never tried it once in 26 years not even a sip even refused temptations from school friends
Now by starting a job, i have no security, ironically. I feel like i stepped at the leap of a bottomless pit and tomorrow i jump into it and fall... and fall....and fall..... No end.
I have no idea how to use ansible and rexify.org and thats what I'll need to use. I have no idea how to do devops with Azure, and thats what ill do. I only build devops with terraform on Aws.
The unknown of 9-5 is frightening me more than starting a business. Paradoxically, i think it would come as a relief to get fired within the first week from failing to complete literally everything
On top of that my blonde gf disappeared yesterday for 3-4 hours. No texts no phone calls. Called for 2 times no answer. Called 3rd time and got a voice message the phone was shut down. 3-4 hours later she said she was with mom at shopping and didnt have internet
I also caught her texting some random guy on instagram. They both have vanish mode enabled (texts delete themselves as soon as you leave the conversation). Confronted her today. She wont tell me the truth. Likes his pics on ig. Keeps lying. On a question "why do you have vanish mode enabled with him?" her answer is "well i guess married men always use vanish mode"
Im tired
Too much shit unraveling. The opening of 2024 already doesnt look good
Why do good people die in accidents or diseases but i dont and i live? Shits unfair. Why doesnt nature/God fucking kill me? I beg to die. I hope to die. I pray for something to kill me. It would come as such a relief.
This life is meaningless and empty to me. typeof(life) yields a void. I dont value it. Its shit. Whether succeed or fail its meaningless. Nihilism was right
I am literally a walking dead. Physically moving but spiritually dead. Mentally lost. I am the captain of a ship in the middle of the ocean who no longer knows where the ship is going
Why cant i just get cancer or something. Can cigarettes help me get it? Cause I'll start consuming that shit right away to speedrun that process
End it17