Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Get a devDuck
Rubber duck debugging has never been so cute! Get your favorite coding language devDuck
Buy Now
-
I bought a System76 laptop. They're headquartered in the same city where I live. In the "special instructions" section of the checkout process, I put, "I'm buying this because Apple took away my escape key."
This note came today.
30 -
My friend: OMG OMG OMG My laptop is dead!
Me: What do you mean it's dead? It doesn't even turn on?
My friend: Nooo, it does nothing?
Me: Are you sure it's plugged in?
My friend: Yesss
Me: You sure?
My friend: Yess, it's actually plugged into a multiple socket thingy...
Me: And that thing is plugged in to the wall..?
My friend: Well duh!
Me: And did you turn the switch on?
My friend: Of course I....oh, wait!! Never mind!!!!!
Me: >:/6 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe15 -
My old laptop had an ear bud warmer right here. This new one is defective, those ear buds are still cold.
6 -
So, I just got up, opened my sister's laptop to work (she gave it to me while I was in this small trip) and I see this. She was like "if you break it, I'm gonna kill you" and I said "oh no! What am I gonna do? Hammer it or something?" Fuck my luck, seriously
19 -
Just took apart my laptop to dust it out from the inside. Had it back together, put the battery in. "Alright, time to make sure I didn't break something"
Beep....beep beep beep....beep beep beep....beep
"FUCK I FUCKING BROKE SOMETHING WHAT DID I BREAK?"
Google Lenovo post codes (Thinkpad laptop). DIMM issue.
"Oh fuck I forgot to put the RAM back in.."
Perfect now8 -
Am I the only one who prefers laptop with numpad?
I feel like keyboards without a numpad are incomplete.12 -
Power efficiency beyond this world.
I think I got Chuck Norris's laptop.
My MacBook WILL NOT FAIL ME, AT ANY COST. It nearly died... I felt sorry for it, I had to pet it later...
10 -
How to be badass?
Step 1: Buy a new windows laptop
Step 2: Boot a linux live cd
Step 3: sudo rm -rf /
Step 4: Install Linux
😂😂😂12 -
When your internet download speed is faster than your system copy speed. Damn! I need a new laptop !!13
-
Yesterday my friend told me that he bought a second hand laptop of dy. I was first shocked by the name but later i got it.
6 -
On a tiny vacation in another country. Don't have a converter plug (for the power sockets) so borrowed one.
*connects laptop to charger* (old charger which might die soon)
*nothing happens*
*slight panic*
*tries different sockets*
*nothing*
😨😲😭
"you might want to check your phone with that thing as the socket seems loose as hell"
*tries phone with charger that definitely works*
*nothing*
😰🙌
That was a fucking panic attack right there 😅2 -
How millionaires deal with laptops.
1. Buy a gaming laptop.
2. Install any OS.
3. Open IE11.
4. Place cursor in the new search bar in top right.
5. Type 4k wallpapers.
6. Download anything.
7. Open in MS Photos.
8. Right click, Set as > Wallpaper BG
9. Leave it in the corner.
10. Sell it at double 2 days later.14 -
girl: Why is your laptop heavier than mine?
me: I have more files than yours
girl: oh! it's true, you and movies eh.
me: laughing inside... hehehe2 -
I Don't want to be that guy that has stickers on his laptop that he didn't "earn" them.
That is, if I am not fluent in AWS I won't plaster their stickers, even though I attented one course one time.
Just a thought14 -
I had to edit it or else it would look boring af.
Just a cheap laptop
Btw: I made the photo and edit one week before knowing devRants wk119 will be devDeks xD
13 -
Goddammit ASUS..
My laptop was not able to boot unless plugged in because of malfunctionning built-in Intel Anti theft technology.
Turns out its deprecated and there is a software available to remove it
So I installed windows to be able to run it but it was not working no matter what.. Turns out it was also deprecated and not supported anymore, so there is no way to remove the faulty anti theft system..
I sent my laptop to ASUS so they could find a way to remove the software and I got the reply "we will have to change the motherboard, it will cost $600"
No way I am paying this much for something that was supposed to be a software problem so I asked them to cancel and send it back
Now I got it back and its not even booting anymore and theres a few screws missing
Goddammit ASUS...10 -
The worst part of getting a new laptop is having to say goodbye to all the stickers you invested on your old one
44 -
Dad: you should buy a laptop now
Me: But i just upgraded my pc
Dad: all your friends have their own laptop, you should buy too
Me: but i find pc comfortable
Dad: what if you need to work at college? You could carry your laptop to college
Me: dad! Every college have pcs for students to work
Dad: whenever i want to use the pc, i find you there. I never get to use it!
Me: New laptop sounds good to me5 -
My laptop started making faint high-pitched noises - I hope I misheard and it's actually just some coil singing inside the power-supply and not one of the disks/something else - also, I seem to have dropped 4GB of RAM suddenly where there should be 8GB.
(Also, I should really wipe the messed up dual-boot still residing on disk from last semester and replace it by a fresh arch-only install. (No time and joy in debugging that right now.) Probably something for tomorrow evening.)
The device is ~8 years old by now and starting to fall apart - nothing duct tape can't fix - but I'm somewhat worried about the rest right now. D:
Meh, I really need that laptop during the next two weeks, I just hope the hardware doesn't die on me in the meantime because I can't wait for an order to arrive, let alone afford some cheap replacement.11 -
Since everyone is posting their system, I'll do it now, too:
- Type: Laptop
- Age: about 5 years
- Weight: 2-3 kg (too much)
- Modifications: Paper below problematic keys; Samsung Evo 850 250GB SSD
- Usecase: School-Laptop with every Office-Suite I could find.
- Pros: Wrecks my PC with the boottime (Gnome > KDE); Looks really sick; Really lightweight Arch installed; Quiet when not under load
- Cons: Really heavy; Battery old and unreliable; Bluetooth stops working after closing lid
13 -
I was on the beach with my work laptop in my backpack in sleep mode. I lifted the backpack and saw water dripping out. The stupid plastic water bottle had failed. Let's hope that my master thesis is still alive. Pray for the HP.9
-
I miss laptop keyboards like this...
Look at delete and esc buttons!
😍
P.S.: No commercials here..you can't find this anymore! Even that company stopped from produce laptop like this..!
17 -
So the new laptop stopped powering on. Nothing I did worked, so I used the warranty service. I probably should have taken the SSD out...20
-
Finally made my laptop a dedicated linux machine, time to start working on a theme then to start on OS development until Gamemaker comes to linux! :-P
16 -
Why would someone do this to his/her laptop????
There is a point after which this "stickers on a laptop" thing starts looking like shit, and in this case the point is long gone. Also at this point most of the stickers start to lose meaning.
16 -
Ability to complaining about "Gradle is too slow in my laptop!" to my dad to get a better one.
Saying thanks to Google.5 -
Finally got time to share my new laptop. I love its rgb backlight keyboard. I will buy a NVMe SSD and second monitor asap.
7 -
Not being able to raise volume of my laptop with only one hand because the fn and f11 keys are just one hand and 3mm apart really kills me !3
-
"Time to install Arch Linux!"
*8 hours later*
"Back to Open Suse!"
Repeat every 4-5 months.
Seriously, I would LOVE to get Arch running on my laptop, but everytime I try to something goes wrong, be it bootloader, audio, cooptimus drivers, undetected network card, window manager going crazy, etc etc etc... and I simply end giving up and reinstalling my backup.
Someday, Arch, someday...6 -
My little brother to me.
Brother: If I plug PS4 into my laptop, will I be able to see PS4 screen on my laptop?
Me: This is going on devrant!32 -
I have my laptop for almost two years now. I've never dropped it once, even though I carry it a lot. So I decided to buy a plastic case this Monday. Just in case.
It's Saturday and I dropped it 3 times already. Shit. --> Never buy a case for your laptop.
/**
* It did it's job though.
* No damage on the device,
* just on the case
*/
9 -
I just dropped my office laptop !
😨😨😨😨
There is a crack on the corner of the body but the device is Ok !
I am worried they will charge me the whole cost of the laptop ( i.e. 3 months worth salary )21 -
So I had to buy a laptop
I had a Lenovo G50-70 (2014) it was really good, mid-range i5, 6GB of RAM and to speed it up I've installed an SSD. 3 years (and some formatting) later it started being slow, I couldn't even play Minecraft anymore (and the battery was dying)
This year we're learning and using PCs for the first (real) time, so I needed a good laptop.
I started searching everywhere, Google, shops, Amazon... (Excluding HP and Acers for good reasons 😂) so I've found this Asus, which isn't really famous, but the model is UX510UX.
FHD display, Nvidia 950M, i7-7500U, really good battery, 8GB of RAM, 1TB of hard disk
I bought an additional 128GB M.2 SSD from WD (I'm sorry but I can't live with a HDD 😂)
All of this for ~700€
I'm very happy for the purchase, the laptop is all metal (pinky bronze, but I like it)
It's really powerful, I can play GTA with mid-high details without any lag. (Remember, I play GTA on the desktop with a 1080 Ti so my standards are high)
I'm happy 😄!
22 -
Dear Laptop manufacturers,
Why the FUCK would you place the power button where the 'Delete' should be? Just so that you accidentally can turn off your pc while typing? Fuck you.
If anyone know a good laptop that is thin and light, 14" and has the power button outside of the keyboard area, please tell me.12 -
Just received my $1 UnixStickers pack in the mail. Can't wait to put these on my laptop. Kinda sad that the Arch stickers won't really have a place on my Ubuntu laptop, but I'm sure I could find a use for them somewhere else.
6 -
*Randomly using laptop to serialize data
*Only 8:53, already at 47%
*Checks bag for laptop cord
*Sees its not there
Oh god what have I done1 -
Me: I am ready to marry my soulmate.
Everyone: Who's the luck girl?
Me: My laptop.
Everyone: 😳(speechless)
Ps: should i try it on april fool?7 -
Scariest thing I've ever experienced...
Was compiling a mod and left my laptop alone to do it's thing while I went to the bathroom. A couple of minutes later I started to smell something burning.
Rushed back to my laptop and everything was ok.
Turns out with all the coding I forgot about my toasts...
1 -
I'm proud to announce that my work laptop has been officially devRanted!!!
Ps: Boss going to kill me, but fuck him anyway!
9 -
That moment when you make heads turn, coz you are using laptop with loads of devRant sticker on it in metro.....
Feeling l33t..... -
Home office!
-Everyday PC
-Laptop for the convenient mobility.
-Old Mac Mini for iOS builds.
Here is where I pretend to do work.
-
Recent experience (#2)
- a cousin wanted to reinstall Windows on his laptop
- gave it to a tech shop
- they couldn't, said hard disk faulty
- I took the laptop hoping that it's just a partition table issue
- I tried changing partition table from MBR to GPT, but failed
- removed his hard disk from his laptop and plugged into mine
- tried and failed
- so I thought I would give it a chance with Ubuntu
- tried and ... 👍
- reinstalled his hard disk in his laptop
- works like a charm
- want to see what complaints he comes up with
- he is not a tech guy
- let's see how he manages to use it for his daily tasks21 -
I guess I had an EMP attack in my home.In a single day my laptop charger burst,my desktop monitor got damaged and my Lumia phone has stopped opening.Dont know what to do13
-
I needed a new laptop to work/study and found a suitable one on Lenovo's website...
25th of july :
- "your order has been placed... blablabla.. it will take approximately from 1 to 2 weeks to prepare and 3-5 days shipping.."
- hum... Ok.. seems long to just put RAM and SSD inside my laptop but alright..
31st of july :
- "unfortunately your order has been delayed, the new shipping date is estimated for August, 14"
- Fuck ! Ill be patient then.. hopefully it'll be ready earlier than that..
10th of August :
- "unfortunately your order has been delayed, the new shipping date is estimated for september, 7"
- WHAT THE FU.. ?!? YOU DENSE MOTHERFUCKER, HOW LONG DOES IT TAKE TO PUT 8 FUCKING GIGS OF RAM AND AN SSD PLEASE TELL ME ?!? IS IT A JOKE OR WHAT ?! I FLY ABROAD THE 17TH OF SEPTEMBER YOU BETTER SHIP MY LAPTOP IN TIME !!
I'm really mad now and thinking of cancelling the order.. I might have no time to test the laptop before flying.. FUCK !!6 -
My work laptop , a 2015 MacBook Pro, finally bricked today. I put in a request for a 15.6" System76 Oryx tonight. Crossing my fingers!19
-
Just bought my my first laptop!
I've had a PC desktop but this is the first laptop of my own! What do you guys recommend I should install from a programmer perspective? Any software you can't live without?29 -
Drilled holes and put some new bolts in my laptop to fix the hinge. Kind of looks odd but I like it😂
11 -
Day 3 since I purchase a laptop and my productivity level has risen significantly. Love not being restricted to my desk.2
-
TL;DR - Developers, do not buy HP Stream models laptop unless they are selling at $1.
Cannot even handle Sublime + Firefox + LAMP use case well. On lubuntu OS with literally nothing else on it. Sublime crashes every hour.
Now I am learning how to code using other tools before I can buy a better replacement for it. Failure with gedit; very slow and sluggish. Currently trying Geany.
It's a pain in the ass to learn new tool especially when you are so accustomed to something. 😣17 -
Got my new laptop today!
Traded my old laptop..
The devRant stickers were too difficult to remove, so I had to part with them. :(2 -
When you get a laptop that comes with freeDOS?
Link, just in case: http://ebuyer.com/786174-hp-255-g5-...
Yeah, it's a bit long. Sorry.
18 -
Anyone else hate their Macbook Pro 2018? RIGHT after the return policy the speakers start acting like it has fucking tourette's, plus my machine randomly SHUTS DOWN.
Apple Store "Genius": "Yup, we gotta send it in for repair, 10 business days."
10 business days without my work laptop, gee thanks asshole, at least be a little more empathetic about it.
My 2015 Macbook Pro gave me ZERO problems. The only reason why I upgraded was that compiling took forever (React Native).
If I didn't have to work with Xcode I would just sell this thing and buy a PC laptop. (The Surface book looks nice =))11 -
When you buy new laptop battery and on the next day you spill beer all over the keyboard making laptop totally useless.11
-
I had written a script to take a photo every time the laptop lid is open an year ago. It's like about 3000 images now and it's really pretty to do like a timelapse. Do it and you won't will never regret.2
-
!rant
My laptop just died for the third time.
Need to buy a new one. Not a mac.
Linux machine with 15" screen, sdd, usb c, with 8gb ram and a graphics processor.
Suggestions?37 -
Thinking of making my own laptop stickers:
- Buy letter size sticker paper
- Print multiple logos/icons on sticker paper
- if needed, laminate the front side of the sticker paper with a thermal laminator (wife has one)
- Cut the stickers out
- ???
- Profit
I will report back with the results and pictures later. I assume they will end up a bit thick if I laminate them.7 -
Black Friday is the time where you consider to buy a new laptop and finds that laptop companies don't know how to make one for programmers. Either they are shit or they are gamer laptop that have 2~4 GB of video memory you will never use and costs thousands of dollars.
Is it hard to make one with good CPU, RAM and a SSD without concluding that you are a hardcore gamer and you need an expensive video card along with it?10 -
Really wish we would see some OLED equipped laptops, we have massive 4K OLED TV's and Tony high resolution smartphone displays, why can't we just get a nice 1080p OLED panel, makes so much sense in a laptop IMO3
-
Lying to your misses about the purchase price of a new laptop - protecting the relationship or just plain wrong?7
-
I bought a Thinkpad E470 laptop for my wife' bday. Because she loves Linux, My first obvious choice was a Thinkpad. I chose the model from Ubuntu Certified Laptop list and installed Ubuntu 16.04 (Based on their recommendation)
now:
THE FUCKING UBUNTU IS UNABLE TO DETECT WI-FI ADAPTOR. LIKE WHAT THE FUCK YOU WERE THINKING WHEN YOU PUT THE LAPTOP MODEL ON THAT FUCKING STUPID LIST? I WANT TO EXACTLY UNDERSTAND WHAT THE FUCK YOU WERE THINKING AND WHY YOU UPGRADED YOUR FUCKING KERNEL WITHOUT REVIEWING YOUR FUCKING LIST?
AND I WANT TO KNOW WHAT THE FUCK LENOVO THOUGHT WHEN THEY RECOMMEND UBUNTU. WHY THEY STILL SELL THIS SHIT BASED ON THINKPAD' REPUTATION AND WHY THEY STILL SUGGEST THIS IS A LAPTOP FOR DEVELOPERS? NO THIS FUCKING SHITHOLE IS NOT FOR ME. IT'S DESIGNED FOR MASTERBATION WITHOUT INTERNET! BECAUSE IT'S NOT ABLE TO CONNECT TO INTERNET! YOUR MOTHER FUCKERS.
GARBAGE
25 -
Laptop has died. This is probably a significant blocker to development...
Oh well time to buy a new one I guess!3 -
So I'm about to buy a laptop, and as any good developer Im already thinking on what are the first things I'm going to do with it, so far I've this list:
1- Enter BIOS and make sure everything is right.
2- Boot and configure all the crap that Windows asks
3- Download and install chrome and uTorrent
4- Download Fedora
4.5- Format the HHD
5- Partition my SSD and install fedora
6- Configure my dev environment, IDEs, runtimes, git aliases etc
7- Install Windows in another partition.
I'm I the only one with a routine?11 -
Small update to this rant
https://devrant.com/rants/1789703/... :
A classmate of mine lend me his old laptop with an SSD and an HDD and I could install Ubuntu Budgie on it and use it while my laptop is under repairment. The thing is, this temporary laptop is pretty awesome and fast and the fact that I don't have to deal with all the NVidia proprietary drivers and other gaming laptop bs makes me pretty happy
Update to the story above: the HDD of the temporary laptop died (didn't have anything important on it, so no problem). But I must be going through some bad omen tech times, since, beside my laptop and this HDD dying, my cooking plate, inflatable mattress, some sockets and lightbulbs broke inside my apartment. Hail! -
I made the switch and my laptop is thanking me. The laptop is SATA II so I opted for a cheap SSD. Insane difference on boot up, shutdown, and opening programs.
1 -
My laptop now finally refuses to connect to the company wifi, and here i am browsing bitbucket on my phone
I didn't expect me to be productive today anyway, but that's another rant.11 -
Fuck, I did not know it was possible to wait this long for something to boot up. Too scared to even install Visual Studio.
Downgrading from my own i7 pc with 16GB ram and an ssd to a company i3 budget laptop with 4GB ram and 5400rpm HDD.
Could never understand all this bitching about Windows 10 and how it is shit slow, but I have come to realize what everybody has been complaining about.6 -
Some years ago but it's funny.
The company give to me a new laptop with windows Home Edition,
After few months I have installed Pro Version.
1 month later the laptop didn't work anymore, nothing on display, no beeps, zero.
Tried to replace ram and check but nothing works.
The CTO asked the supplier and they asked about SO, and they said it's not turning ON because i have installed Windows Pro.
Than the CTO had a brilliant idea: try put the hard disk in another laptop and install Windows Home, and put back in the defective one. I refused to to that, it's stupid and he insisted, then I put the laptop in his desk and I said: if you want do this you can do, im not stupid enough to do this.
He got really mad, 1 week later i got a brand new one 😅5 -
So, brand new laptop. Running an i5-7200U, 8gb of RAM, just put a 1tb SSD in there. Even has an optical drive my dudes! Also got a nice lineup of new mechanical pencils cause my mom is a fucking boss. Today's been a good day.
Merry Christmas everyone! -
So it's 2018 and i am wondering is there a:
Laptop with at least 16go of ram that can last AT LEAST 24 hours ?
Tasks involved:
Running vms
Ide
Browser
Work related stuff
No Apple products please
Thanks!
Ps: i already got a couple of laptops so i am not in a hurry i am more looking for something that i can carry around while traveling in a lightweight manner14 -
Got a new laptop, but it was not properly working, so while waiting for it to get replaced, I have to use the old one again.
Feels like the CPU is a freaking potato!2 -
I fell on the floor with my laptop in the company provided laptop sleeve inside a laptop bag. Now it has a ugly bend at the end. Can anything be done about this?
17 -
Gotta make a decision matrix like the one in the picture. It's for a recommendation report concerning whether or not to distribute laptops to the CSCE students at my university and what kind of laptop if so.
I need help determining the weights for my matrix, because my personal preferences may not reflect the majority. As a programmer, how would you weigh the following three (very broad) categories?
Power(CPU, GPU, memory, HDD, I/O, etc..)
Quality (Durability, material, aesthetics, etc..)
Comfort(Weight, size, shape, keyboard, screen-eye comfort, OS familiarity, etc..)
Please write an integer 1-10 in the following format:
Power/Quality/Comfort ex: 7/4/9
Thanks, everyone!
-The Adderall'd-up devRant Noob, Benby
16 -
What do you use to develop?
If laptop which one + specs?
If desktop specs + favorite accessories?
What type of development?
Editor?6 -
The ethernet cable entry of my laptop is broken and now I have to use it with a tape! 😭😭 O don't want to take it back to the chipstore to they fix it!4
-
I have used Mac since 2011 and I have made statements about how Windows PCs sucks.
I had to buy a Windows-laptop for engineering school and I have experienced problem after problem after problem.
It took about a month to get the right computer (I ordered online and they missed to add an extra hard drive).
I had to return the second one after 10 days because it was not able to boot.
The third one I had to send to HPs repair place in Poland for a week, because the “X”-button” did not work properly.
I have not used the computer for a couple of weeks and now I was going to create an Android Studio-project and found out that the extra hard drive is missing! (Not physically missing, it does not show up)
When I bought the computer I had to portion the disk, but this time it is not showing up in that tool either...18 -
What kind of specs should i look for when I want to buy a laptop on which I will run Linux only?
I primarily wanna use it for coding, so running docker and an IDE shouldn't cause performance problems. I am not very versed in hardware, so any input is appreciated!9 -
Week started of great.... :/
I always leave my laptop at work, except this weekend. Guess what I forgot to bring to work today.... -
My Lenovo X1 Carbon 4th gen came with Windows pre-installed with a ton of bloatware. Reinstalled Windows just to clean all the crap off to learn that the SSD had an MBR partition table. Wiped the entire drive to change to GPT, then reinstalled Windows again and (of course) added linux. Gotta love how companies put random bloatware and crusty partition tables on brand new technology. It's ok, laptop. You're in good hands now.1
-
So,
Acer has a corrupt BIOS,
Lenovo is a bug fest,
HP supposedly also sucks.
So which brand of laptop does not suck?48 -
I seriously think my Laptop is slower than me when it comes to switching between workspaces and applications.
-
I think my laptop is living and hates me... I press shutdown (Yes the actual windows shutdown and not long-press power button) I close my Laptop, expecting it to shutdown, right? Nope... It goes to sleep mode and next time I open it up, it continues to shutdown... It's like it doesn't want to shutdown and is playing a joke on me.....13
-
And finally I got the lovely stickers
Thanks devRant!
Any suggestions about where to stick them on the laptop ? Can you please share your laptop pic 😃😃☺
4 -
Keyboard in my laptop died, mobo issue. Work gave me an ex-lease Dell E6430s. First thing I did was dual boot with Ubuntu 16.10 - can't believe how smooth it was. When I put Debian on my Lenovo G570 I had a ton of issues. I love Linux.
-
!dev
When I was in 6 or 7th grade, the router was downstairs and I was watching a video on laptop and it stopped. I punched the screen in anger and it looked at me.. shattered by what I'd done.2 -
Gotta learn myself through vim and tmux because I have no choice. My laptop burst and all I have is a Raspberry Pi with Raspbian core + MATE DE installed. Don't really wanna use heavy stuff with it because it'll become really snappy.
Oh well, as long as I can code.9 -
* sees a React sticker on a friend's laptop *
— I didn't know you are into React.
— Well, actually I've never even used it. Just had this sticker laying around and my laptop got a scratch so...2 -
Update to my laptop rant: https://devrant.com/rants/1822853/...
I finally got my gaming laptop back, with its motherboard changed under warranty, which was nice. Now all I gotta wait for is 1 month worth of Windows updates. Fun!1 -
I honestly can't remember what the hell was wrong with me when I configured my laptop. Now I am stuck with a very decent laptop with a 200something GB hdd that is even slower than any hdd I use in my other computers. Wtf. It is ok for most Situations because I only ise it to write emails or browse the internet on the go and for the demanding jobs I have several very powerful pcs at home. But for travelling it is such a pain in the ass! I can't always upload everything to a cloud and I often don't have reliable internet connection, so I help myself with usb harddrives but that sucks as well. Argh, I need to get myself to buy a 1TB ssd. But they are so expensive!
-
I need a new Laptop.
-AMD A8 processor 2,5ghz
- Windows 10 64 bit
-8gb ram
-1tb HDD
Etc..
Is this enough for programming, using eclipse and so on?16 -
Hey everyone!
This is really two things in one:
1). Asking about a good gaming laptop.
2). Follow up on a post I made a while back asking for suggestions for new programming languages to learn
So right now I have a surface pro 3 i7 256gb, it's great for development, but not so great for gaming (Overwatch).
Saw the Razer Blade Stealth and thought it looked pretty nifty. Suggestions?
Also I would like to say a big thank you to all the people who told me about some really cool new languages, like Crystal, Elixir..etc.
Thanks everyone!20 -
OK, today I tried to install Windows 10 on my laptop. The laptop was working fine, until I tried booting from the stick
Now I can't even get into the BIOS, even without having inserted the stick
https://streamable.com/tsp4n (that's me trying to boot it)
Does anyone have a clue why and how I could fix it?20 -
Which Linux distro would you recommend for a brand new laptop? I want to use it for many things, like programming, browsing the internet, doing some work for school, etc. I want to have good battery life and have support for drivers on the laptop (it's Huawei Matebook D 14" with Ryzen). I found two distros that could be good for me - Kubuntu and Manjaro (KDE flavor). Which would suit me more? I think Kubuntu is more bloated but I'm afraid that the bleeding edge updates on Manjaro could break my drivers...21
-
I usually never put stickers on my laptop, as they usually fade away and leave nasty residue after a while, therefore I fucking hate having discovered stickermule, I have right now ~100$ worth of stickers favorited, I really have to hold back to not just pull the trigger on them and finally smash my laptop full of them, including my devrant stickers, that have been laying here for a long time now. 😫1
-
Well fuck. This laptop was nice, then the hinges decided to remove themselves from the mount points. Also a metal side rail mananaged break as well...
Anyone have good suggestions for laptops? Prefer machines with a distro of Linux on it, but not afraid to install
9 -
Suggestion for a cheap, leightweight Laptop?
As I want to code outside, the screen should be bright, SD Card Slot would also be nice.
I actually wanted to buy a MacBook, but the prices are...13 -
~rant
Hey all! M gonna b buying a new laptop for programming.
I need something with like 16 gigs RAM, decent processor, SSD.
I can't buy thinkpad because well... It shud have been ~$750 but in my country, it costs $1200. And that is for the 8GB RAM config... E470... 570 isn't even available.
Hence since the lack of laptops without dedicated GPU but high configs, I basically can find 2 options:
Dell XPS
MacBook
So I wanna ask what would you guys prefer? I code in C/C++ pretty much exclusively. And I definitely like butter smooth functioning of OS.
If it ain't a MacBook, i'll b using Arch Linux.
Finally, I live in india.
So... Which one do I pick? And if u have a recommendation, I m open for that too. It shud just have good specs BUT NO DEDICATED GPU.
Thanks 😄8 -
Today I almost burned my hand from touching my (metal) laptop
(Context: I left Rome: Total war running on it while it sat on a bed which meant the fans couldn't cool it and it was heating up because Rome: Total War -
I'm Ruby on Rails Developer, Currently using Dell vostro laptop ( it hangs like hell with Ubuntu)
Suggest me the best laptop for rails and other development.8 -
Just realized HD(1366x768) screen is too small, and Eclipse UI too big.
Maybe it's time to buy a laptop!6 -
So glad i moved from a desktop PC to a laptop for development. I still have 2 workstations (one at home and one at work) with 3 screens, mechanical keyboard + mouse. But if i ever have to demo to a client/PM i just un-dock and take my laptop to them. Plus if the office is loud i just go to another room.1
-
[poll]
If you guys would be so kind, what kind of laptops do you use, and what kind of work does it endures daily,
I'm thinking of buying a new personal laptop, been using company's macbook for a while, and my old laptop doesn't seem to be suitable for any decent work anymore (literally too old)24 -
I just bought a laptop (without OS, so i can put on linux without buying a useless windows license) on Amazon and now i can't wait for that2
-
It's not an easy task to explain to your wife, why you need a new laptop... even if the current one has an 1.4 dual core amd APU (passmark rating: ~870) and only 4GB ram.3
-
I'm a lazy ass person and I wanna learn web development.
However, I only have one problem.
I don't have a computer, or even a laptop.7 -
I will need a laptop for uni and I thought you guys could give me some tips on good brands/models. I want it to have at least 16GB of RAM, preferably a newer generation of i7 and dedicated NVidia graphics. The bigger the screen is the better. I don't care too much about the battery but I would like to have a few USB type A ports and some HDMI/DP outputs. The maximum price (shipping included) should be around 1000 - 1200€15
-
!rant
Maybe it's because I'm drunk but the extra 8gb Ram I just added to my laptop really makes it faster. Everything seems a little bit faster and I can now power up 2-3 virtual machines and IDE etc. without problems 😍 -
I feel hopeless after Unity fails to start/run under your primary user but works fine using guest user and other user in the system. And i did my research to fix it, but none seems to work. :(
The last thing i did to my laptop that might cause the error is executed the commands below:
sudo apt-get update
sudo apt-get upgrade6 -
TL;DR Laptop suggestions.
I do all my work on my desktop, but I have a really shitty laptop. Been thinking about getting a better laptop. I want to use something that isn't Windows.
So any thoughts on:
- a Pixelbook
- a Mac19 -
Ohhhhh...
My Laptop just broke friendship with me 😪😫😭😭😭
My Laptop was everything for me
My Friend, My Parter, and so on..
Ohhh my Laptop I'll miss you so much...
😭😭10 -
Best laptops for mobile devs? I personally love my Surface Pro 2 its been a little workhorse and does everything I need besides booting from a flash drive. But I wanna know the communities favorite laptop.10
-
Which Programming Laptop do you recommend? It should be light, thin and 13". My budget is 1800$. My current favorite would be a Macbook Pro but I was always a Windows kinda guy so I'm not really sure...38
-
!rant
My laptop now includes a DevRant sticker!
If you also have stickers on your laptop I would love to see them. Share photos of your laptops in the comments! :-)
8 -
Got a new laptop and now need a backpack that can comfortably carry 2 laptops plus a few notebooks and other small everyday items. Any recommendations?2
-
Did you end up with a desktop setup at home or do you strictly stick with a laptop and dock it at home?9
-
So I bought this HP laptop about a year ago thinking HP was actually reliable. But oh boy was I wrong. The fucking screen cracked within the first 2 months, because of a small drop from a table, even while it was in my backpack. And the plastic casing is flimsy. It's only been a year, and it's already slowing down because of, what I'm almost positive is age. I've been careful not to do or download anything that might give it a virus. And this thing is supposed to last me another 2 years till college. And, it's fan is the most annoying thing ever. It'll run even if I'm not doing anything super demanding like browsing the internet with only a couple tabs. I'm not one of those people who usually have a ton of tabs open. What's worse is that it's the only machine I have to code with. The school chromebooks are complete shit, and I avoid them at all costs, my cs class has PC's to use but I can only use them during school hours.9
-
So my laptop battery just turned from ~21000 MWh capacity to ~3500 MWh within one night, and it literally can't be charged above 300 MWh.... I can't even do much without it just running out of power even though my charger's plugged in... Urghhhhh thanks Lenovo for making/using cheap hardware8
-
I was planning to buy a new laptop.. any suggestion...
requirements:
i7 7th gen
16gb ram
1tb storage
OS anything other than windows.
good to have:
128gb ssd15 -
Great. So my laptop just died and it's time to send it to RMA. That's not a big deal. except I forgot to push few commits and now there's no way of doing it. Just great3
-
Rant but also !rant
When I got the new remote dev job, there was no laptop purchase involved. We were down a computer at home when a desktop died and there was a lot of sharing going on with only one laptop. So we spent more than we planned to for Christmas and bought a replacement for the dead desktop so I could have more use of one for my job.
Yesterday my new boss says "Oh, we should get you a new laptop. Here's some money."
Oh well, at least this way there is more to go around!3 -
The past couple of weeks I've been struggling with my laptop. It regularly ran out of memory and when that happens everything runs in a snail pace. I always thought 8GB would be enough for developing software, but I was terribly wrong.
So I ordered another 8GB and installed it yesterday. Later at work I looked at the ram usage and noticed that it was up to nearly 13GB!
I have no idea how I managed to get by with only 8 for so long. 🤔
FYI: I usually have 2 to 3 IDEs and a gazillion chrome tabs open 😅7 -
Guys, I'm planning to buy a new laptop for Dev purpose. My budget is under 45K INR. Need a laptop with 8GB RAM and I'm confused about the processor (i5 or i3 or AMD). Please suggest the processor I should choose and some laptop models meeting the above criteria.5
-
My friend wants to sell her old laptop saying it's old. I'm guessing the spec to be 2GB RAM. I thought I could keep it and install Linux on it and make it a small server. What are other ideas?3
-
That feeling when your new laptop is arriving today but you're not getting home until late to set up the software you need...
-
Two weeks of camping ends tomorrow. Started missing coding after a week but no laptop carried with. Mind spends time thinking about projects to start.
-
Any laptop suggestions? My budget is around £400, preferably AMD but Intel is acceptable
RAM isn't an issue as I have a spare 4GB ram stick
It's mainly just for programming, so a fancy GPU isn't important16 -
Need Help
I need a new laptop mainly for Android Development and I am thinking of buying Macbook Air 2017.
Can you suggest me if it will work fine or should I look for other laptops.
And can you suggest some good laptops to buy in India.
BTW this will be my first Mac.22 -
If I have all nighters with my laptop, does it make my girlfriend?
Inspired by:https://devrant.io/rants/906981/...1 -
Hey, fellow devranters!
I'd like to know what is your laptop-os choose. I am looking for new laptop now and quite tempted by Mac but a lot of people say it is overpriced. Another option for me is putting new ssd to my old laptop and upgrading its ram. I am a little bit confused :/12 -
!rant
Buying a new laptop here
Is i7 worth the money or i5 more than enough? Both 6th generation
Mostly will be used for android development
(Gradle is hell 😂😂)13 -
Hey devRanters! I need some help looking for a powerful laptop around (or obviously less than) $1000. Cousin recently stepped on my old reliable laptop and figured it was time for an upgrade. Any suggestions / experiences with your own laptops?11
-
So my laptop is getting pretty slow, but I don't want to use Ubuntu on it on a daily base, especially since my school uses windows for almost anything.
I'm thinking about resetting my PC and purchasing a 64gb usb stick for Ubuntu dual boot only..
Advice/better options?13 -
My road trip still lasts for another 5 hours and my laptop does not have power anymore 😧😧😧
I could refactor or comment so much code. Maybe add even more loggings and unit tests, but noooo 😔4 -
What laptop should I buy to run Linux?
My experience on my desktop with Nvidia is just horrible, so I'm considering to buy a laptop with the new AMD Ryzen when I go to university next year. I'm a little bit unsure about the compatibility with Linux though. Should I go for AMD, or buy a laptop with Nvidia graphics and pray everything works fine?
Do you have any suggestions? I would like to be able to do some light gaming, but I don't want it to be to heavy and I don't want to spend to much money either (around €800).
Do you have any good or bad experiences with running Linux on a laptop?
Are there things I should be aware of?37 -
Recommend me a lightweight operating system for about 6 years old laptop with Intel Atom. 'nuff said I guess...22
-
Ugh why are people so tight!
I'm trying to sell a $1000 laptop for $600 and people are either not bothering to look at it or complain $600 is too much for a laptop -,-
Added that I'm willing to trade for a Mac of any sort so let's hope that adds something but fucking hell!
Gotta love not buying shit tech and trying to sell it -,-
Btw the laptop has been used for less than 2 hours -,-3 -
hi everyone just want your input planing to get a cheap laptop for development
Usage:
PHP
Nodejs
Yarn
Photoshop
Option1: Lenovo IdeaPad 330
Specs: Intel Core i3-7020U / 4GB DDR4 / 1TB HDD
Option2: Lenovo IdeaPad 330
Specs: AMD Ryzen 3 2200U / 4GB DDR4 / 256 SSD
Option3: ASUS X407UA
Specs: Intel Core i3-7020U / 4GB DDR4 / 1TB
im going cheapest as possible but it you guys think going to i5 would benefit more let me know19 -
TLP is awesome.
My laptop battery life is improved incredibly, from 2h30m to 4h40m!
(Laptop is an Asuspro p2520la and I'm using Mint 18.3)2 -
!rant
Custom building a Gaming Laptop was the wrong choice I made 2 years ago :P I firmly believe I should only have a laptop for projects/work/web browsing and open up my overheating gaming laptop and effectively turn it into a desktop (maximum cooling and overclocking).
So I reach out to you Devs that own laptops for work purposes. How are your Dell XPS's? I am very close to purchasing one on my next paycheck, I would run Linux (probably Ubuntu) and want a great screen and battery life (very important! I like sitting on my bed and not feeling anxious about my laptop dying thorough uni next year for finals)
You find the 13" screen enough or 15" has to be? I won't game on this machine at all most likely, if anything it will be mobile games I'm building myself or 2d indie titles.
Thanks in advance guys. Don't want to make another purchase mistake again.6 -
How do you guys handle wifi on laptop with i3 setup? Isnt it ugly as fuck to scan and connect to wifi multiple times via cli? I mean setting default dns per wifi, spoofing mac in public wifi etc?9
-
What specifications should I look for when looking for a laptop I want to program with? I prefer Windows OS and I'm training to be a web developer.3
-
Any suggestions for a good beginner linux distro? Ive been looking at Elementary and Ubuntu, but im needing something that can still use the laptop touchscreen.
Any suggestions?4 -
fellow ranters, i need your advice!
i'm searching for an ultra portable laptop:
- 11" screen
- full HD resolution
it will run Linux (Kali or other debian based distro) and i need that just to do some work while i'm on the go. I don't need huge performance, so the budget is quite limited (~300 EUR / 350 USD).
is the Thinkpad x220/x230 still the best choice (even if the screen resolution is not full HD)? any other suggestion?
thanks!8 -
Looking for a new laptop where I can boot Linux. Any recommendations? Has to be light, a good battery and be my primary.10
-
I’m shopping around for a new laptop and would like some recommendations.
Looking at Lenovo ThinkPad or Dell Latitude, Intel i5 2nd gen 2GHz - 3GHz, 200GB - 500GB ssd
Budget is a concern, I’m not trying to spend over $400.
ヾ(＠⌒ー⌒＠)ノ19 -
Hi all,
sadly my old laptop is dying (first was the hdd, then came the battery; today the keyboard just shut down, and the trackpad followed shortly). The warranty is expired, so I was thinking about a new notebook. I was looking around but I didn't find pretty much anything interesting.
So, I'm asking you for some advice on the matter, considering the following factors:
- I currently live in Italy and I'd like to keep the Italian keyboard layout, as well as the power socket;
- I usually buy everything on Amazon (Italy), but I don't mind any other online shop (in Italy), as long as they are trustworthy.
That being said, these are some of the specs I had in mind:
- screen size between 13" and 15.6", FullHD (or better), matte over glossy. I don't care about touchscreen;
- Intel i7 Kaby Lake (7th gen) or Kaby Lake Refresh (8th gen) CPU. Not the U series or any other undervolted revision;
- 16GB of DDR4 RAM (2400MHz or better);
- SSD as main storage (at least 128GB) and secondary HDD/SSD slot;
- I don't care about the GPU (right now I don't have to play :_( );
- the whole laptop (core + battery + etc.) should weight less than 2.3kg or ~5 pounds;
- it has at least one USB 3.0 TypeA port, and an ethernet port (and of course WiFi, Bluetooth, etc.);
- a price of €1200 or less (I can probably spend a little bit more for something I'm truly enthusiast of).
Thanks in advance for your time.7 -
I want to buy a new laptop and would like to double boot it with Linux and Windows 10. So should I buy a laptop with bundled Windows 10 OS or the other way round. Also will it be a problem if I buy a laptop with DOS OS ( DOS OS Supported)3
-
Ok, so my laptop just shut itself down out of the blue while I was working. That's nice.
Just *click* dead. Not even a BSOD or anything. The *click* being the sound of the hdd stopping.
I thought it was a linux-related issue, but this time I was on windows, so it might be a hardware issue I guess...6 -
I need a new laptop at work. Money isn't really a problem but it should at least meet the following specs:
14" 1080 bright ips screen
Small form factor, this is very important
Good keyboard and Touchpad. I really hate Apple style keyboards, they hurt my fingers.
Quad core coffee lake, i5 should be fine
>=7 hours of battery life.
Be able to run Linux without any major issues
12-16 GB RAM, preferably upgradable but I think that is impossible these days.
>=256GB ssd, upgradable.
Graphics card is unimportant.
Quiet operation for easy tasks such as coding or web browsing.
I/O is not that important as long as it has hdmi and USB B and C.
Bonus : Small power adapter
It feels like I have looked everywhere for such a machine but I can't find any that is good. There is always compromises.3 -
When someone is using your laptop and you want it back and go home, but he won't give it back to you!! >.<2
-
I'm developing on PC and when I'll get a sticker, I will buy laptop only to paste sticker on its back.
PC users strugles :(4 -
I'm looking into buying a new laptop. I want something speak and ultrabookish, but dedicated graphics are a must.
Will be mostly for work, so a good CPU and RAM are important, but probably will do some gaming. Battery life and cooling are pretty big too. I've looked at the Aero 15X, the XPS 15, Razer Blade, etc. I just can't decide. Need to get it this year for the the tax deductions for my contracting income. Any thoughts? What's the best one out there?17 -
!rant
I'm in the lookout for a new laptop for my dev work and occasional gaming (Dota 2 only), needs to have at least 16GB, 256 SSD, decent battery life and portable.
Which laptop do own?
Which do you recommend?8 -
Just got a new work laptop which is absolutely awesome. Only bad thing is that i can't transfer the sticker swag :/4
-
I definitely need some stickers to hide scratches on my laptop! who else has a used and abused laptop?2
-
I was on an 8h bus ride yesterday, and thought "Hey, I take my Laptop with me, then I can do some tech." Normally I have my Laptop on a docking station, and use a nice big keyboard. End of the story; thinking of using the small Laptop keyboard demotivated me so much, that I didn't do anything but sleeping on the bus. Am I the only one who doesn't like small Laptops?2
-
I was wondering...
What do you guys think of different work places e.g not working at your desk but instead working outside with a laptop?
I think you would lose alot if productivity because your screensize is limited and so on while coding. But if you're just writing/replying to Emails i think it could be fun.4 -
Been using a MBP the last 5 years. I would like to move to pure Linux laptop. Any recommendations on laptop brand?
Back in the day it was always such a PITA getting Linux to run on a laptop due to non existent drivers for sound and wifi. Has any laptop manufacturer filled this gap yet?
I don't want to spend all my time getting the laptop to work, which is why I went with MBP. Reliability is my first requirement, followed closely by performance.6 -
My one year hp laptop not charging to full.Needs calibration of battery.:(
Gotta calibrate it.
Anyone else faced the same issue?2 -
!rant
My stock hp 2000-369wm notebook laptop with 4GBmem won't boot (from USB) ReactOS, RemixOS, or Android-x866 -
So I'm getting a new job in a legal software company and I wanted to ask your opinion on computers. I know many are very biased towards OSX and windows and prefer linux but I'm trying my luck lmao.
I'm currently on a late 2012 macbook pro and its starting to fizzle out on me.
Not a bit fan of the new macbooks because of dongles and no direct HDMI. I was wondering if the surface laptop 2 was any good compared? All the reviews online are basically paid to praise it and the reviews on reddit are polarized. I prefer laptops that are thin and in aluminum.15 -
What laptop would you guys recommend to buy for development ?
I'd need to use it for Android App development, but also for BSP ( AOSP ) builds, so it'd need to be ...uhmm insanely powerful ( as the builds can take hours in a mediocre laptop).
Read some reviews, and lots are recommending Dell XPS 15-9570?9 -
Finally put my desktop back together after about 2 years of keeping it in storage and now I feel a bit sad because my laptop has become obsolete 😂1
-
I currently have a piece of shit Acer. It made a bunch of weird beeps at me last night and the screen had a seizure. What brand of should I look at for a new laptop?
My last computer was a MacBook Pro that I loved. I didn’t have any problems with it until my cat spilled Pepsi on it. I’ve used Dells and Lenovo’s at work - they both got the job done.
Should I go back to Apple because I liked their laptop more than any other I’ve used or should I go for a Windows laptop that is priced reasonably? Should I try to build my own laptop?9 -
Do you consider a nice laptop an investment? (I'm planning to buy one and pay it with credit for 15 months)9
-
Any recommendation (super) thin laptop under $1000?
I think of lenovo yoga, but I don't need the touch screen, and I think it's just upping the price.17 -
I'd love to get stickers, but first I need laptop instead of PC :D any ideas for good cheap laptop for web dev? :)8
-
RIP my fucking dog laptop. And FUCK Asus. The solution to fixing the fucking laptop is to get a new MB and display. But the motherboard is so God same expensive because you obviously have to solder every fucking component on it so that it's much more of a PITA.
PS yes I'm fucking angry but I hope y'all having a nice day.5 -
I want to buy a laptop. I got a suggestion like ssd laptops are very fast. But I got confused wether to go for Mac 128ssd or windows 256ssd.
The reason for above comparison is both price are more or less same.
Give me your suggestion please9 -
As usual, the million-dollar question: whats the best laptop to buy for developers, in the price range up to $1,500?
I'm between a 2015 Macbook Pro, the new Dell Latitude or the Thinkpad T460 😕11 -
Finally my laptop is back and it's keyboard problem, thanks for official repair stop. Other two unofficial repair stops told me it's main board problem, FUXK THEM.
-
My classmate forgot to lock his laptop when he went out to eat lunch. Needless to say, may other classmates raided his search history and came home with the spoils of war.... a good laugh about 'girl pool slide hurt' I dunno what's happening now
-
Don't know why but I just love laptop keyboard. Not specific to what type of keyboard, just the fact it is a keyboard on my laptop... No wonder my neck pain is getting worse everyday :(
-
People of devRant, I need your help! I am finally buying a new laptop - ive been using a Dell N4140 for the past 4 years and I absolutely love it. But it's about time to retire the machine and upgrade.
I'm a programmer, I don't play games and haven't used windows in the last 2 years. Im looking for a 4-8GB RAM under $1000K. I plan to replace the HDD with an SSD. 13' is too small a screen and i feel 15.6' is slightly on the large side. I have a 21' external monitor anyway. My old dell was 14' and i loved it. And looks really matter for me. Alsooo, I dislike having a number pad. Its useless for me.
I know I'm picky. I can't afford a MacBook right now (about to graduate from university), but if you could help me in finding the right laptop, I'd be really grateful!14 -
So yeah Microsoft, all your new windows 10 updates look great in theory, but I would rather you not burning my goddamn laptop!!! now the fan is crazy !!
-
I'm looking for a good 10 inch laptop to run Linux. Standard size keyboard. I'd prefer atleast 4gb of ram and a quad core. Any recommendations?11
-
So, an employee at work told me that her daughter's laptop is acting strange and I said I would diagnose it for her. I was suppose to do it today but, her daughter left it at school, so I am going to work on it Saturday.
I was wondering, how much should I charge her if I wanted to get payed?1 -
I was going to install my SSD in my desktop, but I could also put it in one of my laptops. I feel like, since my desktop is faster anyway, it might be worth it to install it in a laptop so I can program faster while not at home.
What do you people think? If I do the laptop, should I do my Dell Inspiron 15 3542 or my 2008 macbook pro? -
Hi, is anyone using Thinkpad E470?
Do you like it or it's waste of money?
Maybe sobie ideas for fancy 14' laptop?5 -
So I'm planning to buy a new laptop but I have no idea what's the best option for my budget 800-1000€. (would prefer something in the middle)
It'll be used mainly for development and I'm planning to transport it a lot so I expect something with good battery life.
Any advice?2 -
//not a rant
In Semptember I will be attending information technology at university, and I was wondering what kind of laptop should I buy:
optimal screen size? (13.3 or 15.6)
ram? (for VMs)
processor?
dedicated graphics? (or should I just stick to integrated)
I will be mainly coding, running VMs and school stuff(maybe some casual game like League or Minrcraft), so I was wondering if you guys could help me out with the decision19 -
Really am getting tired of Windows. Seems to bloated for my old Elitebook. I want somehting sleek and lightweigh, that runs good on older hardware.
I did some research myself and even made a multiboot USB with some distros on it, but i feel like i still miss out on something.
On the few distros i tried, the battery drained really fast and the fans of my laptop spun almost constantly.
Here are the ones that i tried
- Kubuntu (was my fav)
- Elementary OS (no dark theme?)
- Xubuntu
- Puppy (didn't boot)
- Bunsenlabs (very sleek!)
and a few more i can't think of now.
I will use the OS for browsing and coding only. Oh andy system is an Elitebook 2560p, the i7 version (64bit). I really want to get into Linux, and i'm planning to install it on my desktop too, if i've gained enough knowledge and found a good distro5 -
!rant
I got an old laptop from my girlfriend that I can use for whatever I want.
As a programmer and computer nerd you can't deny that you wouldn't do anything with it, but what to do?
I want to use it for something, but can't figure out what. Maybe you have some ideas :D7 -
I have a laptop with 8gb ram, 1Tb HDD, i5 7th gen running windows 10 and Ubuntu. Right now I'm using windows 10 as my primary OS, I'm simply addicted to the gestures especially the four finger swipe to switch desktops. I have been thinking of adding an SSD to the mix and my budget only permits a 120gb M.2 or a 250gb normal ssd.
The advantage with m.2 is that I can keep my HDD and boot my OS from the ssd and maybe install my IDEs on there but with the other ssd I'm gonna have to take my HDD out and use it as an external.
I read somewhere that 250gb above SSDs are the ones worth spending money on and that the 120 and 250 doesn't justify the price or life.
So my question is, should I go for an SSD? and if I do which one to go for m.2 or the normal one?4 -
!rant
Finally.. I have decided to change my laptop. Please suggest me something good. Mainly worked with PHP and Java (Netbeans). Planning to start android.
Budget 1000-1200 USD4 -
exactly the day when holidays/vacations start, my laptop doesn't boot, nothing helps...
and only on january 8 we're back at work so i could take it to IT guys to repair it.... UGH! :(1 -
!Rant Suggestions
Guys what do you think of the laptop
Lenovo y700 touch model???
Or any other similar laptop that you suggest.1 -
I have a pair of stickers from theHundreds since 3 years ago and I'm still waiting to get a laptop someday to use them... The struggle.
-
Did someone tried to glue iron beads on their laptop instead of stickers? Playing with the idea right now and don't know how to put them on without damaging the back of the laptop.2
-
Keycaps are like teeth to a laptop, it loses them with time and you can replace them but you don't until it really becomes a hassle without them. And sometimes you can even pimp them up to show how cool you are3
-
I wonder what other linux distro I should run on an extra hard drive I have for my laptop. I already have Xubuntu on the main one. I'm highly considering elementary OS.6
-
You know a good place to get stickers for my laptop?
Stickers like ubuntu, kubuntu, PHP, CSS, python and so on4 -
Hello guys, Did you know how to build a PHP development enviroment for a low spec laptop?
Well, low spec laptop I mean:
CPU: AMD E2 quad Core 1,5
RAM:4 GB
I switched from w10 because it was so laggy, Im currently using Xubuntu
I tested virtual machines bit also it was so laggy too
PD: have a good day :)7 -
Lenovo x240, x230 or T430 and why. It won't be my primary device, I do most of my work at home on my desktop, I just want a laptop to school and when I go to cofee. I'm a working with Go, Vue and Flutter1
-
Does anyone here have a stack of stickers waiting for when their laptop is old enough it looks better plastered with stickers
Top Tags
Never tell anybody that you know how to code...