Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Get a devDuck
Rubber duck debugging has never been so cute! Get your favorite coding language devDuck
Buy Now
-
I was looking for about a month for a laptop. Then on this one magical day I open kijiji and see a Toshiba Thinkpad T450s with 20gb of ram, 138 ssd and an i5-6300U cpu going fo 500$ (value 2000+).
My first thought was. Okay. Scam alert. But you know. What if?
So I call up this person. And its a girl who got a pc from her bf, but really she wanted a mac so she is selling it.
This straight up blew my mind. I decided, fuck it. Got 500. Ran to her. Ran a systems check on the laptop. Checked for any attempts at opening it up. Checked the harddrive. Checked the ram. Everything is solid.
Long story short. Thank god for apple fangirls!34 -
My friend: OMG OMG OMG My laptop is dead!
Me: What do you mean it's dead? It doesn't even turn on?
My friend: Nooo, it does nothing?
Me: Are you sure it's plugged in?
My friend: Yesss
Me: You sure?
My friend: Yess, it's actually plugged into a multiple socket thingy...
Me: And that thing is plugged in to the wall..?
My friend: Well duh!
Me: And did you turn the switch on?
My friend: Of course I....oh, wait!! Never mind!!!!!
Me: >:/6 -
People don't know how to use a normal laptop anymore.
This year I had at least three people touching my display multiple times, wondering why it doesn't respond to it. Totally clueless how to use it at all.
One of them worked for the biggest german ISP in the past.
Human degeneration is real.23 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe16 -
My old laptop had an ear bud warmer right here. This new one is defective, those ear buds are still cold.
7 -
The craziest shit in my life just happened.
I left my laptop(basically my whole life) and my handbag at my dinner table and went to the the toilet for 4 minutes. I live in a ground-house in a rural area, and the front door wasn't locked.
After I exited the bathroom I noticed eevrything was gone. My laptop, my bags, my wallet. Everything. I panicked.
I quickly informed the local security authority while canceling my credit card and resetting all of my credentials, they with the help of the police they tracked the theives in 10 minutes in a neighboring town, with what it seems all of my stuff intact, which I am supposed to get tommorow.
This is both insane and a miracle. I am speechless and thankful to G-d. This is divine providence. I can't explain it in any other explanation
Watch over your stuff like your life depends on them. Don't ever leave your laptop even for a few minutes.10 -
Am I the only one who prefers laptop with numpad?
I feel like keyboards without a numpad are incomplete.14 -
Power efficiency beyond this world.
I think I got Chuck Norris's laptop.
My MacBook WILL NOT FAIL ME, AT ANY COST. It nearly died... I felt sorry for it, I had to pet it later...
10 -
When your internet download speed is faster than your system copy speed. Damn! I need a new laptop !!13
-
Yesterday my friend told me that he bought a second hand laptop of dy. I was first shocked by the name but later i got it.
7 -
How to be badass?
Step 1: Buy a new windows laptop
Step 2: Boot a linux live cd
Step 3: sudo rm -rf /
Step 4: Install Linux
😂😂😂12 -
On a tiny vacation in another country. Don't have a converter plug (for the power sockets) so borrowed one.
*connects laptop to charger* (old charger which might die soon)
*nothing happens*
*slight panic*
*tries different sockets*
*nothing*
😨😲😭
"you might want to check your phone with that thing as the socket seems loose as hell"
*tries phone with charger that definitely works*
*nothing*
😰🙌
That was a fucking panic attack right there 😅2 -
How millionaires deal with laptops.
1. Buy a gaming laptop.
2. Install any OS.
3. Open IE11.
4. Place cursor in the new search bar in top right.
5. Type 4k wallpapers.
6. Download anything.
7. Open in MS Photos.
8. Right click, Set as > Wallpaper BG
9. Leave it in the corner.
10. Sell it at double 2 days later.14 -
Everyone takin screenshots of their new coding setups and stuff and I'm here using a 7-8 years old laptop making fucking weird sounds and praying for it to stay working...5
-
girl: Why is your laptop heavier than mine?
me: I have more files than yours
girl: oh! it's true, you and movies eh.
me: laughing inside... hehehe2 -
I'm thinking about getting a new work laptop/notebook early next year.
I'd prefer a small screen, enough RAM and possibly a quadcore CPU. It should work well with Linux, of course.
Can you guys and gals recommend a particular model? If so, why? No fucking Apple products, puh-lease, k, thx <347 -
"I think my next laptop is going to be a Chromebook. I can do everything from browser and any heavy computing/coding I will just ssh to home. Sounds good."
3 days later, my Chromebook is running Ubuntu 80% of the time since I bought it.18 -
My laptop started making faint high-pitched noises - I hope I misheard and it's actually just some coil singing inside the power-supply and not one of the disks/something else - also, I seem to have dropped 4GB of RAM suddenly where there should be 8GB.
(Also, I should really wipe the messed up dual-boot still residing on disk from last semester and replace it by a fresh arch-only install. (No time and joy in debugging that right now.) Probably something for tomorrow evening.)
The device is ~8 years old by now and starting to fall apart - nothing duct tape can't fix - but I'm somewhat worried about the rest right now. D:
Meh, I really need that laptop during the next two weeks, I just hope the hardware doesn't die on me in the meantime because I can't wait for an order to arrive, let alone afford some cheap replacement.13 -
Goddammit ASUS..
My laptop was not able to boot unless plugged in because of malfunctionning built-in Intel Anti theft technology.
Turns out its deprecated and there is a software available to remove it
So I installed windows to be able to run it but it was not working no matter what.. Turns out it was also deprecated and not supported anymore, so there is no way to remove the faulty anti theft system..
I sent my laptop to ASUS so they could find a way to remove the software and I got the reply "we will have to change the motherboard, it will cost $600"
No way I am paying this much for something that was supposed to be a software problem so I asked them to cancel and send it back
Now I got it back and its not even booting anymore and theres a few screws missing
Goddammit ASUS...10 -
The worst part of getting a new laptop is having to say goodbye to all the stickers you invested on your old one
44 -
Tell people you love them every day because you don't know when it will be the last time.
But more importantly, don't forget to "git push" every day, because you never know when your laptop is about to die, taking with him those last commits. RIP my friend.10 -
Dad: you should buy a laptop now
Me: But i just upgraded my pc
Dad: all your friends have their own laptop, you should buy too
Me: but i find pc comfortable
Dad: what if you need to work at college? You could carry your laptop to college
Me: dad! Every college have pcs for students to work
Dad: whenever i want to use the pc, i find you there. I never get to use it!
Me: New laptop sounds good to me5 -
Since everyone is posting their system, I'll do it now, too:
- Type: Laptop
- Age: about 5 years
- Weight: 2-3 kg (too much)
- Modifications: Paper below problematic keys; Samsung Evo 850 250GB SSD
- Usecase: School-Laptop with every Office-Suite I could find.
- Pros: Wrecks my PC with the boottime (Gnome > KDE); Looks really sick; Really lightweight Arch installed; Quiet when not under load
- Cons: Really heavy; Battery old and unreliable; Bluetooth stops working after closing lid
11 -
I closed the lid of my laptop and went for a lunch. When I came back the damn machine wouldn't start and I realised I didn't push anything to github today so wish me luck recovering data from the drive.
(At least lunch was good.)6 -
Tech support for Friend...
Again...
Ok...
A friend ran down the hallway to my Appartement, I opened the door for him and asked him "What The Fuck... Is wrong with you?!" He was just coughing like...
My... Laptop.... Is... Slow...
When he then eventually came to the point where he could Breath normally again I asked him to login into his by then super with shitty software bloated PC... It was a mess... A Desktop full of Shit... only Shit... I
then opened Chrome and Task Manager...
and holy shit... EVERYTHING! Literally ANYTHING was under 100% Load... Yet his shitty Fans werent spinning up... Shutdown the Laptop and opened it... not to my surprise it was full of Dust... I cleaned it and booted it again... still 100% Load... I couldnt do shit without being bombarded with porn and Hentai Ads... So... I asked him "Did you make any backups to this machine?" He was like.. "*Really long explenation* No *Really long Explenation*"
Great... i thought to myself... Then I said to him his PC was so trash that i only could Reset it to 0... He was like DO ANYTHING YOU CAN LITERALLY ANYTHING!
I then explained him, Resetting this PC Means literally 0 A Fresh start, nothing of your data will be there literally nothing...
He again Was like DO IT!
So I did... When it was done i showed him the result... He FREAKED OUT LIKE THE WORLD WAS GOING TO FUCKING END, HE SCREAMED AT ME WHAT THE HELL HAVE YOU DONE? REVERSE IT! REVERSE IT NOW!
I Then said to him, I reset it to 0, I said this would happen...
He then took his now perfectly running Laptop and Ran away...
tl;dr
Tech support for friend, Reset PC to 0, Freaked out AF...4 -
Just clean installed windows few days ago and my laptop is already mess again. Anyone else with same problem? 😂 I Suck at managing stuffs.
21 -
Finally made my laptop a dedicated linux machine, time to start working on a theme then to start on OS development until Gamemaker comes to linux! :-P
16 -
So the new laptop stopped powering on. Nothing I did worked, so I used the warranty service. I probably should have taken the SSD out...26
-
I was on the beach with my work laptop in my backpack in sleep mode. I lifted the backpack and saw water dripping out. The stupid plastic water bottle had failed. Let's hope that my master thesis is still alive. Pray for the HP.9
-
I miss laptop keyboards like this...
Look at delete and esc buttons!
😍
P.S.: No commercials here..you can't find this anymore! Even that company stopped from produce laptop like this..!
18 -
Just opened my laptop to see if I can upgrade my ram, and yes I can
And I've got space for a 2.5 drive as well!
Fuck yeah!
All I need is a 1080 inside of this :P
But I've just got a shitty built-in gpu...
16 -
Not being able to raise volume of my laptop with only one hand because the fn and f11 keys are just one hand and 3mm apart really kills me !3
-
Jesus fuck! I just ran out of battery (laptop) and the screen did the creepiest shit, where the screen became full of a repeated pattern of strips of blue, red and some other color. Restarted, logged in, same shit happens. Had a few small heart attacks every time I saw this shit.
Like, in which world is this shit a sign of "0% battery"????
Fucking creep is now working again after being plugged. 😒3 -
Ability to complaining about "Gradle is too slow in my laptop!" to my dad to get a better one.
Saying thanks to Google.5 -
So I had to buy a laptop
I had a Lenovo G50-70 (2014) it was really good, mid-range i5, 6GB of RAM and to speed it up I've installed an SSD. 3 years (and some formatting) later it started being slow, I couldn't even play Minecraft anymore (and the battery was dying)
This year we're learning and using PCs for the first (real) time, so I needed a good laptop.
I started searching everywhere, Google, shops, Amazon... (Excluding HP and Acers for good reasons 😂) so I've found this Asus, which isn't really famous, but the model is UX510UX.
FHD display, Nvidia 950M, i7-7500U, really good battery, 8GB of RAM, 1TB of hard disk
I bought an additional 128GB M.2 SSD from WD (I'm sorry but I can't live with a HDD 😂)
All of this for ~700€
I'm very happy for the purchase, the laptop is all metal (pinky bronze, but I like it)
It's really powerful, I can play GTA with mid-high details without any lag. (Remember, I play GTA on the desktop with a 1080 Ti so my standards are high)
I'm happy 😄!
23 -
Dear Laptop manufacturers,
Why the FUCK would you place the power button where the 'Delete' should be? Just so that you accidentally can turn off your pc while typing? Fuck you.
If anyone know a good laptop that is thin and light, 14" and has the power button outside of the keyboard area, please tell me.12 -
I have my laptop for almost two years now. I've never dropped it once, even though I carry it a lot. So I decided to buy a plastic case this Monday. Just in case.
It's Saturday and I dropped it 3 times already. Shit. --> Never buy a case for your laptop.
/**
* It did it's job though.
* No damage on the device,
* just on the case
*/
9 -
"Time to install Arch Linux!"
*8 hours later*
"Back to Open Suse!"
Repeat every 4-5 months.
Seriously, I would LOVE to get Arch running on my laptop, but everytime I try to something goes wrong, be it bootloader, audio, cooptimus drivers, undetected network card, window manager going crazy, etc etc etc... and I simply end giving up and reinstalling my backup.
Someday, Arch, someday...6 -
Heights of laziness.
My dad's laptop having "WINDOWS OS" got full of viruses and my dad wanted me to repair it since I visited my home.
But I insisted him to get it repaired at some IT shop. Went to an IT shop, my dad introduced the shopkeeper that I am his son and is a software engineer. That moment, I really felt bad that even I could have done formatting and installing applications back.
Now, let's hope it comes back full healthy and clean.19 -
My little brother to me.
Brother: If I plug PS4 into my laptop, will I be able to see PS4 screen on my laptop?
Me: This is going on devrant!35 -
*Randomly using laptop to serialize data
*Only 8:53, already at 47%
*Checks bag for laptop cord
*Sees its not there
Oh god what have I done1 -
Me: I am ready to marry my soulmate.
Everyone: Who's the luck girl?
Me: My laptop.
Everyone: 😳(speechless)
Ps: should i try it on april fool?8 -
I'm proud to announce that my work laptop has been officially devRanted!!!
Ps: Boss going to kill me, but fuck him anyway!
9 -
That moment when you make heads turn, coz you are using laptop with loads of devRant sticker on it in metro.....
Feeling l33t..... -
Scariest thing I've ever experienced...
Was compiling a mod and left my laptop alone to do it's thing while I went to the bathroom. A couple of minutes later I started to smell something burning.
Rushed back to my laptop and everything was ok.
Turns out with all the coding I forgot about my toasts...
1 -
Drilled holes and put some new bolts in my laptop to fix the hinge. Kind of looks odd but I like it😂
12 -
Recent experience (#2)
- a cousin wanted to reinstall Windows on his laptop
- gave it to a tech shop
- they couldn't, said hard disk faulty
- I took the laptop hoping that it's just a partition table issue
- I tried changing partition table from MBR to GPT, but failed
- removed his hard disk from his laptop and plugged into mine
- tried and failed
- so I thought I would give it a chance with Ubuntu
- tried and ... 👍
- reinstalled his hard disk in his laptop
- works like a charm
- want to see what complaints he comes up with
- he is not a tech guy
- let's see how he manages to use it for his daily tasks21 -
Whoever thought it was a good idea to put a 64 gb ssd in a laptop needs to rethink their decisions.5
-
Just bought my my first laptop!
I've had a PC desktop but this is the first laptop of my own! What do you guys recommend I should install from a programmer perspective? Any software you can't live without?29 -
I guess I had an EMP attack in my home.In a single day my laptop charger burst,my desktop monitor got damaged and my Lumia phone has stopped opening.Dont know what to do13
-
Rant on adaptive brightness....
So basically on my laptop there is this "function" that if the screen is mostly black it lowers the brightness, while if it's white makes it higher....
This means, if you are on devrant or discord or visual studio or any dark UI and then switch to something like google you will get freaking blinded by the max brightness, and when you'll switch back to the first program due to the lower brightness it won't look good and also it will be annoying to the eyes, and you CAN'T make it brighter because that's already the max brightness
...
WHO THE F*CK THOUGHT IT WAS GOING TO BE A GOOD IDEA
If you really want to do something like this at least make it opposite: white screen low brightness, black screen higher brightness.
Well, i don't like it, maybe someone likes it, so can i disable it ?
NO
I have it disabled both in power saving settings and in the intel control panel but it's still active, the only way to fix it is set a registry key i found online and then reboot, but guess what, after one or two weeks it reverts back to enabled :/5 -
My favorite thing on my desk would be my laptop.
If only it hadn't DIED three months ago after being impossibly slow for three months before that.
RIP you useless machine, RI bloody P ._.
11 -
!rant
My laptop is 8 years old this year. She’s still going strong but her Core 2 Duo is starting to show. I need a new dev laptop so I can put all my cool dev stickers on. Sponsorships? 😬24 -
Day 3 since I purchase a laptop and my productivity level has risen significantly. Love not being restricted to my desk.3
-
I went home for Chrismas, I got my laptop with me but forgot its charger in my renthouse. Battery is old and it takes about 10 mins for it to run out of power.
What am I supposed to do now?
Btw Merry Christmas!4 -
Haveing Arch Linux on my old laptop. Before Arch it was slow. Now I have OS so minimalistic that there's almost nothing after booting.
I even have to start GUI manualy beacouse I don't need it always.
Almost non of my friends can use it so my data is safe here (I like privacy).
But for downside I imagine useing vim in text envirement during flight. Non tech guys can assume that useing vim is plane hijacking.5 -
Got my new laptop today!
Traded my old laptop..
The devRant stickers were too difficult to remove, so I had to part with them. :(2 -
Thinking of making my own laptop stickers:
- Buy letter size sticker paper
- Print multiple logos/icons on sticker paper
- if needed, laminate the front side of the sticker paper with a thermal laminator (wife has one)
- Cut the stickers out
- ???
- Profit
I will report back with the results and pictures later. I assume they will end up a bit thick if I laminate them.7 -
When you buy new laptop battery and on the next day you spill beer all over the keyboard making laptop totally useless.11
-
Makes a joke about my work laptop im getting that we should all invest in some game development so we need some new laptops (we develop prototype apps to validate ideas for startups and i never work on proper projects). I get to work and see this.. Omw im so happy..
1 -
When you get a laptop that comes with freeDOS?
Link, just in case: http://ebuyer.com/786174-hp-255-g5-...
Yeah, it's a bit long. Sorry.
18 -
!rant
My laptop just died for the third time.
Need to buy a new one. Not a mac.
Linux machine with 15" screen, sdd, usb c, with 8gb ram and a graphics processor.
Suggestions?37 -
I had written a script to take a photo every time the laptop lid is open an year ago. It's like about 3000 images now and it's really pretty to do like a timelapse. Do it and you won't will never regret.2
-
I tought I'll buy a new laptop last week.
Went to the mediamarkt. I've choosen one with hdd. That was cheaper and I have a nice ssd at home, so I tought I'm gonna change that so I've asked the salesman about the hdd. I mean if I take it out and replace it with an ssd, it'll invalidate my warranty? Said yes. But they gladly change it to me if I bring my ssd in for a dirt-cheap €79. I said you are defenetly lost your mind. It takes 5 screws and around 5 minutes.
Anyway. I've choose an another one with ssd. But there was a sticker on it too, means it is prepared to use out of the box. It means as always, the windows is full with advertises, demos and annoying settings. And I don't use windows anyway. Ohh and it costs €29. I wanted one without this thing. Said ok, he'll check it. Comes back and said these modells are all prepared with this. I've asked him to show me a product which is 'clean'. He replied "actually all our laptops came prepared".
So I went mad and left them. This whole procedure takes more than an hour with one lesson: never go there again to buy a computer.
But at the end I've found a solution. Configurable laptops with 2 year warranty even if you upgrade it. Thats what I'll buy soon. I've had enough of big brands bullshits about unnecessary features and other bullshit. I'll buy what I need, not more, not less.
I'll write down the brand if anyone interested.26 -
I bought a Thinkpad E470 laptop for my wife' bday. Because she loves Linux, My first obvious choice was a Thinkpad. I chose the model from Ubuntu Certified Laptop list and installed Ubuntu 16.04 (Based on their recommendation)
now:
THE FUCKING UBUNTU IS UNABLE TO DETECT WI-FI ADAPTOR. LIKE WHAT THE FUCK YOU WERE THINKING WHEN YOU PUT THE LAPTOP MODEL ON THAT FUCKING STUPID LIST? I WANT TO EXACTLY UNDERSTAND WHAT THE FUCK YOU WERE THINKING AND WHY YOU UPGRADED YOUR FUCKING KERNEL WITHOUT REVIEWING YOUR FUCKING LIST?
AND I WANT TO KNOW WHAT THE FUCK LENOVO THOUGHT WHEN THEY RECOMMEND UBUNTU. WHY THEY STILL SELL THIS SHIT BASED ON THINKPAD' REPUTATION AND WHY THEY STILL SUGGEST THIS IS A LAPTOP FOR DEVELOPERS? NO THIS FUCKING SHITHOLE IS NOT FOR ME. IT'S DESIGNED FOR MASTERBATION WITHOUT INTERNET! BECAUSE IT'S NOT ABLE TO CONNECT TO INTERNET! YOUR MOTHER FUCKERS.
GARBAGE
27 -
My school class is going for a skiing trip soon. Since I don't have a laptop yet, no code for me in the evenings. :(13
-
I am upgrading my laptop ram from 4GB to 8GB. I can't wait to do use Android Studio with the required ram!5
-
So I'm about to buy a laptop, and as any good developer Im already thinking on what are the first things I'm going to do with it, so far I've this list:
1- Enter BIOS and make sure everything is right.
2- Boot and configure all the crap that Windows asks
3- Download and install chrome and uTorrent
4- Download Fedora
4.5- Format the HHD
5- Partition my SSD and install fedora
6- Configure my dev environment, IDEs, runtimes, git aliases etc
7- Install Windows in another partition.
I'm I the only one with a routine?11 -
So happy about having a laptop in these unproductive meetings so I'm actually able to continue working on real problems...
-
GOD FUCKING DAMMIT!!!
FUCK YOU WINDOWS!!!!
FUCK YOU SHITTY LAPTOP!!!!!!!
ok, so, I open Spotify on my shitty laptop, I go to visual studio, write 1 line of c++, copy it, AND MY FUCKING LAPTOP CRASHES!!!!
WTF KMN PLS!!!9 -
Laptop has died. This is probably a significant blocker to development...
Oh well time to buy a new one I guess!3 -
Lying to your misses about the purchase price of a new laptop - protecting the relationship or just plain wrong?7
-
Aaaarrrrgghhhhhhhhh
Out of all the days,
My laptop is lagging today, when I need to things to be done.
Fuck. Fuck. Fuck.
PS. It's so slow, that I ended up searching a meme too.
2 -
Going on a school camp where all the students in the school go.
2 nights and 3 days, planning to bring my laptop and my phone to make games there. (poor 15yo)
Any ideas not to be seen to the teachers? My loyal friends wont tell it because i promised to bring some old android devices for them to play games.10 -
I think my laptop is living and hates me... I press shutdown (Yes the actual windows shutdown and not long-press power button) I close my Laptop, expecting it to shutdown, right? Nope... It goes to sleep mode and next time I open it up, it continues to shutdown... It's like it doesn't want to shutdown and is playing a joke on me.....13
-
Dear diary,
It's been the second day without Internet at home. I have self-exiled to my parents where the last vestiges of civilization remain. Now my laptop starts throwing tantrums and won't move beyond the loading screen. I wonder what's next to break down.2 -
So guys I'm about to buy a laptop, I want something that will endure, I was thinking about 16 ram, 1 TB with SSD, and obviously 17.3" screen, any suggestions?24
-
I bought a new laptop yesterday and just fell like superheroes at the end on movies when they find out exactly how powerful they are and what real power tastes like :D
Moving from 4gb to 8gb of RAM and a to a working battery i just bliss :)4 -
Had given my laptop at the repair store. They were just suppose to do a checkup and then give a choice on whether to repair or not. They repaired it and charged me 2.8K. No unit replacement or anything, just service. I didn't mind it (was actually happy seeing my laptop boot up and not have a blank screen). It's a dual-boot (Windows/Antergos(Arch-linux)). It booted to Windows instead of GRUB. Didn't care too much, because it had happened before and I had handled it.
After I take it back home, I discover that the WiFi doesn't work (it doesn't even seem to be a driver issue). Live boot of arch doesn't have access to WiFi either. Reinstalled GRUB, only to discover it doesn't boot successfully (issues with video card). So, now I'm stuck with fucking Windows WITHOUT WiFi and an arch-linux that doesn't fucking boot.
Gonna reinstall Arch now.
P. S. : Windows is super fast, because I haven't really used it and don't really like using it. I feel very limited by Windows.9 -
I made the switch and my laptop is thanking me. The laptop is SATA II so I opted for a cheap SSD. Insane difference on boot up, shutdown, and opening programs.
1 -
What do you use to develop?
If laptop which one + specs?
If desktop specs + favorite accessories?
What type of development?
Editor?6 -
Fuck, I did not know it was possible to wait this long for something to boot up. Too scared to even install Visual Studio.
Downgrading from my own i7 pc with 16GB ram and an ssd to a company i3 budget laptop with 4GB ram and 5400rpm HDD.
Could never understand all this bitching about Windows 10 and how it is shit slow, but I have come to realize what everybody has been complaining about.6 -
The ethernet cable entry of my laptop is broken and now I have to use it with a tape! 😭😭 O don't want to take it back to the chipstore to they fix it!4
-
Got a new laptop, but it was not properly working, so while waiting for it to get replaced, I have to use the old one again.
Feels like the CPU is a freaking potato!2 -
I have used Mac since 2011 and I have made statements about how Windows PCs sucks.
I had to buy a Windows-laptop for engineering school and I have experienced problem after problem after problem.
It took about a month to get the right computer (I ordered online and they missed to add an extra hard drive).
I had to return the second one after 10 days because it was not able to boot.
The third one I had to send to HPs repair place in Poland for a week, because the “X”-button” did not work properly.
I have not used the computer for a couple of weeks and now I was going to create an Android Studio-project and found out that the extra hard drive is missing! (Not physically missing, it does not show up)
When I bought the computer I had to portion the disk, but this time it is not showing up in that tool either...18 -
Gotta make a decision matrix like the one in the picture. It's for a recommendation report concerning whether or not to distribute laptops to the CSCE students at my university and what kind of laptop if so.
I need help determining the weights for my matrix, because my personal preferences may not reflect the majority. As a programmer, how would you weigh the following three (very broad) categories?
Power(CPU, GPU, memory, HDD, I/O, etc..)
Quality (Durability, material, aesthetics, etc..)
Comfort(Weight, size, shape, keyboard, screen-eye comfort, OS familiarity, etc..)
Please write an integer 1-10 in the following format:
Power/Quality/Comfort ex: 7/4/9
Thanks, everyone!
-The Adderall'd-up devRant Noob, Benby
16 -
Some years ago but it's funny.
The company give to me a new laptop with windows Home Edition,
After few months I have installed Pro Version.
1 month later the laptop didn't work anymore, nothing on display, no beeps, zero.
Tried to replace ram and check but nothing works.
The CTO asked the supplier and they asked about SO, and they said it's not turning ON because i have installed Windows Pro.
Than the CTO had a brilliant idea: try put the hard disk in another laptop and install Windows Home, and put back in the defective one. I refused to to that, it's stupid and he insisted, then I put the laptop in his desk and I said: if you want do this you can do, im not stupid enough to do this.
He got really mad, 1 week later i got a brand new one 😅5 -
!rant
Alright, the Internet has failed me and even the mighty Amazon is proving useless in my quest for a new laptop bag. I request your aid brothers!
My old targus backpack has died a death and I need a new bag. I would prefer a messenger bag/cross body bag of some kind with enough space for a small laptop, a book, notepad, water bottle, mouse, tablet and all of the other pointless necessities I may desire (gotta carry the rubber duck somwhow) but my search and returned nothing but fancy stylish "slimline" bullshit.
I NEED PRACTICALITY AND WATERPROOF GOD DAMN IT!
Can you help a fellow nerd?9 -
I fell on the floor with my laptop in the company provided laptop sleeve inside a laptop bag. Now it has a ugly bend at the end. Can anything be done about this?
19 -
I seriously think my Laptop is slower than me when it comes to switching between workspaces and applications.
-
My Lenovo X1 Carbon 4th gen came with Windows pre-installed with a ton of bloatware. Reinstalled Windows just to clean all the crap off to learn that the SSD had an MBR partition table. Wiped the entire drive to change to GPT, then reinstalled Windows again and (of course) added linux. Gotta love how companies put random bloatware and crusty partition tables on brand new technology. It's ok, laptop. You're in good hands now.1
-
So in my school, all classes now have a laptop. Our laptop's touchpad just suddenly stopped working on Monday, but oddly enough, only in Windows. Rebooting the laptop or shutting it down didn't help. Now, on Wednesday, it magically started working again.
Umm okay thanks for working again I guess5 -
Finally, I got my laptop back after 4 gruelling days of separation with a new disc and more RAM!!!
I can't wait to finish up installing all the programmes I need to start writing code!!!10 -
Buys macbook starting uni because it should last six years. Breaks in 3 years, new mobo, new mobo again, new macbook, new screen and finally I'm out of warranty now and the screen breaks again (retina macbook lose some kind of coating because the screen touches the keys). Made it five years without paying any extra but I have an HP laptop costing less than half that has done seven years with no issues.5
-
When you realize devRant stickers are still in the super cool looking black pattern paper and not sticked in the laptop.
Me: Can I stick the stic...
Dad: Nooooo! WHY WOULD YOU PUT A STICKER IN THE EXPENSIVE LAPTOP????
(got the laptop in half price)
Me: (....)1 -
I need a new Laptop.
-AMD A8 processor 2,5ghz
- Windows 10 64 bit
-8gb ram
-1tb HDD
Etc..
Is this enough for programming, using eclipse and so on?16 -
!dev
When I was in 6 or 7th grade, the router was downstairs and I was watching a video on laptop and it stopped. I punched the screen in anger and it looked at me.. shattered by what I'd done.2 -
And finally I got the lovely stickers
Thanks devRant!
Any suggestions about where to stick them on the laptop ? Can you please share your laptop pic 😃😃☺
4 -
After struggling all morning with my laptop, I finally accepted the fact that my 1TB hard drive died. Now I'm on a dilemma: Should I replace the drive and upgrade the RAM, or should I buy a new laptop altogether?
Current laptop is Lenovo G50-45, with AMD APU, 6GB (4+2 on graphics) and said 1TB drive.
Before this misfortune befell me, I was planning to upgrade the RAM to 8+2.
Now I'm at a loss, but my folks are willing to help.
Should I buy a new drive and RAM or should I start looking a new more dev oriented laptop? If the latter, any recommendations?3 -
Week started of great.... :/
I always leave my laptop at work, except this weekend. Guess what I forgot to bring to work today.... -
12:55 AM, Subject gets and decides to look at crude oil chart.
1:05 AM, At it.
1:10 AM, Subject decides to check the temperature, using laptop screen in dark.
1:12 AM, Does a wild aerobic move to save flying laptop.
1:13 AM, Finds out that screen is gone.
1:23 AM, Orders new screen.
1:26 AM, Types this rant. -
Gotta learn myself through vim and tmux because I have no choice. My laptop burst and all I have is a Raspberry Pi with Raspbian core + MATE DE installed. Don't really wanna use heavy stuff with it because it'll become really snappy.
Oh well, as long as I can code.9 -
* sees a React sticker on a friend's laptop *
— I didn't know you are into React.
— Well, actually I've never even used it. Just had this sticker laying around and my laptop got a scratch so...2 -
I honestly can't remember what the hell was wrong with me when I configured my laptop. Now I am stuck with a very decent laptop with a 200something GB hdd that is even slower than any hdd I use in my other computers. Wtf. It is ok for most Situations because I only ise it to write emails or browse the internet on the go and for the demanding jobs I have several very powerful pcs at home. But for travelling it is such a pain in the ass! I can't always upload everything to a cloud and I often don't have reliable internet connection, so I help myself with usb harddrives but that sucks as well. Argh, I need to get myself to buy a 1TB ssd. But they are so expensive!
-
Keyboard in my laptop died, mobo issue. Work gave me an ex-lease Dell E6430s. First thing I did was dual boot with Ubuntu 16.10 - can't believe how smooth it was. When I put Debian on my Lenovo G570 I had a ton of issues. I love Linux.
-
I usually never put stickers on my laptop, as they usually fade away and leave nasty residue after a while, therefore I fucking hate having discovered stickermule, I have right now ~100$ worth of stickers favorited, I really have to hold back to not just pull the trigger on them and finally smash my laptop full of them, including my devrant stickers, that have been laying here for a long time now. 😫1
-
Almost died few minutes ago. My laptop was plugged to power, while I was using it, for last one hour. Then power cut and my laptop went off too. I was really afraid. Just 9 months ago I purchased a new battery for my laptop. When power came back, and I restarted my laptop, to check status, it was saying "Plugged in. Not charging" on windows. Now I was in serious shock. "Fuck battery died again. This time so soon". Also no red light which reflects charging but white, which reflects "laptop running on direct supply". It gave me some indication when it stopped showing red light during charging for last couple of days
I removed the battery and reinserted it. Replugged the charger. Now it's charging. And red light is back
This makes me even more serious. As similar to this, is what happened with me last time battery died.
Now let's see whether my laptop battery is going to see this night or not. Next few hours are crucial13 -
What kind of specs should i look for when I want to buy a laptop on which I will run Linux only?
I primarily wanna use it for coding, so running docker and an IDE shouldn't cause performance problems. I am not very versed in hardware, so any input is appreciated!10 -
!rant
Maybe it's because I'm drunk but the extra 8gb Ram I just added to my laptop really makes it faster. Everything seems a little bit faster and I can now power up 2-3 virtual machines and IDE etc. without problems 😍 -
[poll]
If you guys would be so kind, what kind of laptops do you use, and what kind of work does it endures daily,
I'm thinking of buying a new personal laptop, been using company's macbook for a while, and my old laptop doesn't seem to be suitable for any decent work anymore (literally too old)23 -
Today I almost burned my hand from touching my (metal) laptop
(Context: I left Rome: Total war running on it while it sat on a bed which meant the fans couldn't cool it and it was heating up because Rome: Total War -
I feel hopeless after Unity fails to start/run under your primary user but works fine using guest user and other user in the system. And i did my research to fix it, but none seems to work. :(
The last thing i did to my laptop that might cause the error is executed the commands below:
sudo apt-get update
sudo apt-get upgrade6 -
I just bought a laptop (without OS, so i can put on linux without buying a useless windows license) on Amazon and now i can't wait for that3
-
Ohhhhh...
My Laptop just broke friendship with me 😪😫😭😭😭
My Laptop was everything for me
My Friend, My Parter, and so on..
Ohhh my Laptop I'll miss you so much...
😭😭11 -
Well fuck. This laptop was nice, then the hinges decided to remove themselves from the mount points. Also a metal side rail mananaged break as well...
Anyone have good suggestions for laptops? Prefer machines with a distro of Linux on it, but not afraid to install
9 -
My laptop. Fuck I should've purchased a desktop pc instead. Oh yea and windows... Wish all games would run on linux without wine or similar shit.1
-
Just realized HD(1366x768) screen is too small, and Eclipse UI too big.
Maybe it's time to buy a laptop!6 -
Hey everyone!
This is really two things in one:
1). Asking about a good gaming laptop.
2). Follow up on a post I made a while back asking for suggestions for new programming languages to learn
So right now I have a surface pro 3 i7 256gb, it's great for development, but not so great for gaming (Overwatch).
Saw the Razer Blade Stealth and thought it looked pretty nifty. Suggestions?
Also I would like to say a big thank you to all the people who told me about some really cool new languages, like Crystal, Elixir..etc.
Thanks everyone!20 -
The past couple of weeks I've been struggling with my laptop. It regularly ran out of memory and when that happens everything runs in a snail pace. I always thought 8GB would be enough for developing software, but I was terribly wrong.
So I ordered another 8GB and installed it yesterday. Later at work I looked at the ram usage and noticed that it was up to nearly 13GB!
I have no idea how I managed to get by with only 8 for so long. 🤔
FYI: I usually have 2 to 3 IDEs and a gazillion chrome tabs open 😅8 -
As regular as it is, it's pretty hard to be a programmer and a pc gamer at the same time... You need a good easily portable laptop yet you want a powerful rig so you get a gaming laptop and curse yourself everytime you need to get somewhere with it cause it's fairly heavy and also curse yourself when you paid so much yet you can't play on that much of a high config...
The only good alternative is if you're rich enough to get a slim laptop and a powerful desktop at once17 -
Today I was looking for a new laptop online (my old one broke and it was more than 6 years old) when I came across this... Dual disk, 8 GB ram, dedicated graphics card, i7 processor. Everything looks nice, until I find out that "dual disk" is actually a 1TB HDD and 8GB SSD...
Seriously? Why do they even include 8GB SSD (actually, did they mean SD)? I can put a bare half of VS2017 on it... I am disappointed, they spend literally 3 additional dollars to make it "dual disk".
7 -
I'm a lazy ass person and I wanna learn web development.
However, I only have one problem.
I don't have a computer, or even a laptop.7 -
Which Programming Laptop do you recommend? It should be light, thin and 13". My budget is 1800$. My current favorite would be a Macbook Pro but I was always a Windows kinda guy so I'm not really sure...38
-
Battery life worth some sloppy seconds is part of all mobile devices nowadays, mainly because it's standard by now to charge all your devices in your dedicated charging room, stacked with millions of chargers, where you connect thousands of devices before you go sleep. (dont forget to put your smart pillow on charge too)
Having a day or two worth of battery life in a laptop with normal use or a phone that can easily power through heavy usage for 3-4 days or more is really just so rare.
I can see how all mobile processors jumped multiple thousands of generations with power consumption, but that doesnt help, if companies just put a thin layer of battery to actually power it.
I am so glad I am finally again able to have both a laptop and a mobile phone that don't force me to charge all the time or carry around my huge battery packs.
A full day of my new phone gets me only down to 75-80% and I really started appreciating again, how just a slightly thicker phone can make such a huge change.2 -
The laptop retailer sent me an email today that they had to give me a newer model 8570p instead of 8560p, same price. There was also a disclaimer saying that the mentioned specs are the minimum ones and that what i get could have more powerful specs. I wish all computer stores were like this.
miniRant: fuck ISPs who sent with their network gear ethernet cables that are too short, especially when using laptops. -
Best laptops for mobile devs? I personally love my Surface Pro 2 its been a little workhorse and does everything I need besides booting from a flash drive. But I wanna know the communities favorite laptop.12
-
!rant
My laptop now includes a DevRant sticker!
If you also have stickers on your laptop I would love to see them. Share photos of your laptops in the comments! :-)
8 -
Got a new laptop and now need a backpack that can comfortably carry 2 laptops plus a few notebooks and other small everyday items. Any recommendations?2
-
It's not an easy task to explain to your wife, why you need a new laptop... even if the current one has an 1.4 dual core amd APU (passmark rating: ~870) and only 4GB ram.3
-
So glad i moved from a desktop PC to a laptop for development. I still have 2 workstations (one at home and one at work) with 3 screens, mechanical keyboard + mouse. But if i ever have to demo to a client/PM i just un-dock and take my laptop to them. Plus if the office is loud i just go to another room.1
-
I was planning to buy a new laptop.. any suggestion...
requirements:
i7 7th gen
16gb ram
1tb storage
OS anything other than windows.
good to have:
128gb ssd16 -
Two weeks of camping ends tomorrow. Started missing coding after a week but no laptop carried with. Mind spends time thinking about projects to start.
-
Recommend me a lightweight operating system for about 6 years old laptop with Intel Atom. 'nuff said I guess...26
-
To all devs that aren't allowed to BYOD, what Specs has the PC/Laptop your company provided?
Mine:
i7 3rd gen
IGP
16GB of RAM
500GB HDD in RAID1
and two 27" FullHD Screens14 -
If I have all nighters with my laptop, does it make my girlfriend?
Inspired by:https://devrant.io/rants/906981/...1 -
Hey, fellow devranters!
I'd like to know what is your laptop-os choose. I am looking for new laptop now and quite tempted by Mac but a lot of people say it is overpriced. Another option for me is putting new ssd to my old laptop and upgrading its ram. I am a little bit confused :/15 -
Rant but also !rant
When I got the new remote dev job, there was no laptop purchase involved. We were down a computer at home when a desktop died and there was a lot of sharing going on with only one laptop. So we spent more than we planned to for Christmas and bought a replacement for the dead desktop so I could have more use of one for my job.
Yesterday my new boss says "Oh, we should get you a new laptop. Here's some money."
Oh well, at least this way there is more to go around!3 -
Did you end up with a desktop setup at home or do you strictly stick with a laptop and dock it at home?9
-
That feeling when your new laptop is arriving today but you're not getting home until late to set up the software you need...
-
I've got 2 questions.
1. Are there any laptops better than a maxed out Dell XPS 15 for a similar price?
2. Once I buy my new laptop I want to experiment with Linux (never used it before). Is there some really good tutorial out there to help me get it working and figure out how it works and what the best way to use it is?8 -
!rant
Buying a new laptop here
Is i7 worth the money or i5 more than enough? Both 6th generation
Mostly will be used for android development
(Gradle is hell 😂😂)13 -
So I bought this HP laptop about a year ago thinking HP was actually reliable. But oh boy was I wrong. The fucking screen cracked within the first 2 months, because of a small drop from a table, even while it was in my backpack. And the plastic casing is flimsy. It's only been a year, and it's already slowing down because of, what I'm almost positive is age. I've been careful not to do or download anything that might give it a virus. And this thing is supposed to last me another 2 years till college. And, it's fan is the most annoying thing ever. It'll run even if I'm not doing anything super demanding like browsing the internet with only a couple tabs. I'm not one of those people who usually have a ton of tabs open. What's worse is that it's the only machine I have to code with. The school chromebooks are complete shit, and I avoid them at all costs, my cs class has PC's to use but I can only use them during school hours.9
-
Guys, I'm planning to buy a new laptop for Dev purpose. My budget is under 45K INR. Need a laptop with 8GB RAM and I'm confused about the processor (i5 or i3 or AMD). Please suggest the processor I should choose and some laptop models meeting the above criteria.5
-
Bought a Dell laptop, didn't work properly. Returned, got another one. The second one has the same issues.
Why? It's been two months and fuck ton of stress, can't recommend Dell to anyone.
I'll probably get my money back and buy laptop that works as intended.13 -
fellow ranters, i need your advice!
i'm searching for an ultra portable laptop:
- 11" screen
- full HD resolution
it will run Linux (Kali or other debian based distro) and i need that just to do some work while i'm on the go. I don't need huge performance, so the budget is quite limited (~300 EUR / 350 USD).
is the Thinkpad x220/x230 still the best choice (even if the screen resolution is not full HD)? any other suggestion?
thanks!7 -
TLP is awesome.
My laptop battery life is improved incredibly, from 2h30m to 4h40m!
(Laptop is an Asuspro p2520la and I'm using Mint 18.3)2 -
Story, !rant.
So after previously telling the story of my laptop in the rain, I thought I should follow up with this one. (this is couple months later)
My laptop was bought second hand by my father (who doesn't know anything about computers) and the poor thing had a tendency to overheat. It worked fine, but under heavy load it would only last a couple minutes before it shut down.
So once I was cleaning out the fan (as dust accumulated in there) and I ran it under the tap, to get everything off. Sure, you might cringe at the idea but I thought some water wouldn't hurt it, especially after surviving en evening in the rain. So I cleaned it and let it dry.
A while later, when it finished drying I started to reassemble my laptop. After about 30 mins of fiddling with it, it was back together and ready for a fresh start! So I powered it on.
Sparks flew. Smoke started coming off the motherboard. More sparks.
😯
I pulled the cord. "Fuck, glad I caught it on time..."
I waited a while longer. Turn it back on. "Fan is not functioning properly or is missing". FML. After all it had survived, a bit of water in the circuit that made the fan spin is what took it down 😑
Fast forward two years (without a fan, shitty days), and I bought a second hand Lenovo laptop that I adore. So I thought I'd sell the laptop on Ebay, but first I should fix the fan so that I wouldn't have to sell it for next to nothing. Part number was hard to find, and bought it from somewhere in Europe. Four weeks later, the fan arrived at my doorstep.
Took the laptop apart (have I mentioned how hard that was?) and replaced the fan. Felt good to fix what I had ruined two years back. Put it back together (after applying thermal paste, I'm not a monster) and powered it on.
"Fan is not functioning properly or is missing"
😑
After checking the connection a couple times, I realized that what had given out was the motherboard connector for the fan, after the water incident. Wasted 40 dollars and several hours of my time for nothing.
The laptop that survived hours in the rain was taken down by a wee bit of water. So sad.2 -
tl;dr Which new laptop + Linux distro combo should I get when seeking for minimal configuration and maintenance hassle?
Hey devRant gang!
I'm looking for a new laptop: which one is supported out-of-the-box by Ubuntu based Linux distros like Elementary OS?
Why Elementary OS you ask? Well, I want to move away from macOS and/but keep the minimal (and pretty) design/interface!
But: I don't want to waste time configuring stuff after install or a kernel update. I don't have time for that: I need to get shit done.
As much as I dislike closed source/evil corporate stuff the fact of the matter is that my MacBook Pro Just Works (and lets me get shit done).4 -
What do you recommend?
15 inch laptop or 13 inch laptop?
I am a computer science student, who mostly work at the university in groups.9 -
So my laptop battery just turned from ~21000 MWh capacity to ~3500 MWh within one night, and it literally can't be charged above 300 MWh.... I can't even do much without it just running out of power even though my charger's plugged in... Urghhhhh thanks Lenovo for making/using cheap hardware8
-
!rant
Custom building a Gaming Laptop was the wrong choice I made 2 years ago :P I firmly believe I should only have a laptop for projects/work/web browsing and open up my overheating gaming laptop and effectively turn it into a desktop (maximum cooling and overclocking).
So I reach out to you Devs that own laptops for work purposes. How are your Dell XPS's? I am very close to purchasing one on my next paycheck, I would run Linux (probably Ubuntu) and want a great screen and battery life (very important! I like sitting on my bed and not feeling anxious about my laptop dying thorough uni next year for finals)
You find the 13" screen enough or 15" has to be? I won't game on this machine at all most likely, if anything it will be mobile games I'm building myself or 2d indie titles.
Thanks in advance guys. Don't want to make another purchase mistake again.7 -
Just got a new work laptop which is absolutely awesome. Only bad thing is that i can't transfer the sticker swag :/4
-
~rant
Hey all! M gonna b buying a new laptop for programming.
I need something with like 16 gigs RAM, decent processor, SSD.
I can't buy thinkpad because well... It shud have been ~$750 but in my country, it costs $1200. And that is for the 8GB RAM config... E470... 570 isn't even available.
Hence since the lack of laptops without dedicated GPU but high configs, I basically can find 2 options:
Dell XPS
MacBook
So I wanna ask what would you guys prefer? I code in C/C++ pretty much exclusively. And I definitely like butter smooth functioning of OS.
If it ain't a MacBook, i'll b using Arch Linux.
Finally, I live in india.
So... Which one do I pick? And if u have a recommendation, I m open for that too. It shud just have good specs BUT NO DEDICATED GPU.
Thanks 😄8 -
Hey devRanters! I need some help looking for a powerful laptop around (or obviously less than) $1000. Cousin recently stepped on my old reliable laptop and figured it was time for an upgrade. Any suggestions / experiences with your own laptops?13
-
Ugh why are people so tight!
I'm trying to sell a $1000 laptop for $600 and people are either not bothering to look at it or complain $600 is too much for a laptop -,-
Added that I'm willing to trade for a Mac of any sort so let's hope that adds something but fucking hell!
Gotta love not buying shit tech and trying to sell it -,-
Btw the laptop has been used for less than 2 hours -,-4 -
I currently have a 3+ year old laptop.
Dell Inspiron 15 3521:
OS: Windows 10 Pro
RAM: 8GB (4+4)
Processor: Intel Core i5 3rd Gen
Video/Graphics Card: AMD Radeon 8730M 2GB (and Intel HD 4000)
Hard Disk: 1TB
It's slowly becoming sluggish and has clearly outdated hardware. I want to pursue a Master's degree in CS (Machine Learning oriented).
Should I consider upgrading? Build a PC instead? Suggestions?40 -
I'm developing on PC and when I'll get a sticker, I will buy laptop only to paste sticker on its back.
PC users strugles :(4 -
!rant
I have a 7yo laptop which, for the last 4 years, has been a Ubuntu single boot.
It was previously on Windows Vista, as it's shipped with it. Worth nothing to say, after a couple of years, terrible performances, so I never thought twice to reinstall Windows.
Now, that I'm in need to write C# along with CUDA in VS (2013 Express is the last version that supports CUDA 6.5, last version for my old GT330M), I installed Windows 10.
I have to admit, it's going pretty well. For being a VS machine, it's coming along very well :) -
My one year hp laptop not charging to full.Needs calibration of battery.:(
Gotta calibrate it.
Anyone else faced the same issue?3 -
I’m shopping around for a new laptop and would like some recommendations.
Looking at Lenovo ThinkPad or Dell Latitude, Intel i5 2nd gen 2GHz - 3GHz, 200GB - 500GB ssd
Budget is a concern, I’m not trying to spend over $400.
ヾ(＠⌒ー⌒＠)ノ23 -
Hi all,
sadly my old laptop is dying (first was the hdd, then came the battery; today the keyboard just shut down, and the trackpad followed shortly). The warranty is expired, so I was thinking about a new notebook. I was looking around but I didn't find pretty much anything interesting.
So, I'm asking you for some advice on the matter, considering the following factors:
- I currently live in Italy and I'd like to keep the Italian keyboard layout, as well as the power socket;
- I usually buy everything on Amazon (Italy), but I don't mind any other online shop (in Italy), as long as they are trustworthy.
That being said, these are some of the specs I had in mind:
- screen size between 13" and 15.6", FullHD (or better), matte over glossy. I don't care about touchscreen;
- Intel i7 Kaby Lake (7th gen) or Kaby Lake Refresh (8th gen) CPU. Not the U series or any other undervolted revision;
- 16GB of DDR4 RAM (2400MHz or better);
- SSD as main storage (at least 128GB) and secondary HDD/SSD slot;
- I don't care about the GPU (right now I don't have to play :_( );
- the whole laptop (core + battery + etc.) should weight less than 2.3kg or ~5 pounds;
- it has at least one USB 3.0 TypeA port, and an ethernet port (and of course WiFi, Bluetooth, etc.);
- a price of €1200 or less (I can probably spend a little bit more for something I'm truly enthusiast of).
Thanks in advance for your time.7 -
Been using a MBP the last 5 years. I would like to move to pure Linux laptop. Any recommendations on laptop brand?
Back in the day it was always such a PITA getting Linux to run on a laptop due to non existent drivers for sound and wifi. Has any laptop manufacturer filled this gap yet?
I don't want to spend all my time getting the laptop to work, which is why I went with MBP. Reliability is my first requirement, followed closely by performance.6 -
When the screen resolution of your laptop and tower pc are completely different and you can't get used to fast workflows because the UI changes everytime you switch devices.
-
When someone is using your laptop and you want it back and go home, but he won't give it back to you!! >.<2
-
Any suggestions for a good beginner linux distro? Ive been looking at Elementary and Ubuntu, but im needing something that can still use the laptop touchscreen.
Any suggestions?4 -
!long rant
Trying to work from home is always a pain, since we need to use company laptops (no ifs, ands or buts about it).
Yesterday I took the laptop in to check for updates that just wouldn't run while at home (my first mistake), and I couldn't get past the "Press Ctrl+Alt+Delete to login" screen, laptop keyboard didn't seem to be registering clicks, and an external keyboard wasn't either (and I forgot about the on-screen keyboard). A couple of restarts later with no further changes to the situation, the laptop then didn't get past the BIOS screen.
So I called support (my second mistake) and logged an incident.
Couple of hours later someone comes to my desk and asks about the issue, so I describe it, show them (by now the laptop was once again getting past BIOS screen), and leave them to it. Since these laptops are just used as preconfigured VPN and RDP gateways, I said it would be okay if he just wanted to reinstall the OS (my third mistake).
Several hours later, after staying late last night waiting for it to finish, I loaded my profile, installed updates, shut down, grabbed my stuff and left, without checking VPN or RDP over WiFi (my fourth mistake).
Turns out that some of the buttons on the keyboard just no longer work, but now USB keyboards do work, and I can just use OSK to login while out. I figured this would be my only issue with things, and that it was acceptable.
This morning I attempt to use the laptop, and forgot about OSK and the faulty delete button, so spent a few minutes on that. Try to connect to WiFi and find it can't connect, because of course, it doesn't remember the WiFi password, so I root around for the code in some drawer, enter it, and it works. VPN tries to connect and... get told to insert my smart card, which is already inserted, because the driver is wrong!
So I'm sitting here writing a post, not quite believing that I'm considering cancelling my plans for the day to go into the office because of a bloody driver issue now...1 -
Looking for a new laptop where I can boot Linux. Any recommendations? Has to be light, a good battery and be my primary.10
-
I want to buy a new laptop and would like to double boot it with Linux and Windows 10. So should I buy a laptop with bundled Windows 10 OS or the other way round. Also will it be a problem if I buy a laptop with DOS OS ( DOS OS Supported)3
-
I was wondering...
What do you guys think of different work places e.g not working at your desk but instead working outside with a laptop?
I think you would lose alot if productivity because your screensize is limited and so on while coding. But if you're just writing/replying to Emails i think it could be fun.4 -
Time for a new laptop, bored with current. Taking community suggestions. May donate current laptop to some poor dev soul in need; has been a trustworthy machine.
I do some of a lot on any given day: c#, PHP, node and typically run vs 2017, phpstorm, datagrip, sql management, webstorm, plus slack, office, etc.
I have terrible browser tab management skills and prefer electron apps over web apps. Am a vm junkie, constantly spinning up linux distros to see something.
Do light gaming when the mood strikes, Spotify or Netflix always on.
Suggest away.9 -
You build, develop and test systems and software...but because its under the bracket of IT, they think playing music and kinda sorta being a DJ and watchman of a laptop during a promotion is sufficient for you.
-
Finally my laptop is back and it's keyboard problem, thanks for official repair stop. Other two unofficial repair stops told me it's main board problem, FUXK THEM.
-
I'd love to get stickers, but first I need laptop instead of PC :D any ideas for good cheap laptop for web dev? :)8
-
Anyone else here own the Dell XPS 13 laptop? I'm considering one. Also, I'm thinking of dual booting Windows and Arch Linux. Has anyone here had experience with setting up a Windows disk boot using the OEM license? I'm not sure if the reinstall is the normal process or one of those awful "use this CD to reset your machine"?2
-
Finally put my desktop back together after about 2 years of keeping it in storage and now I feel a bit sad because my laptop has become obsolete 😂1
-
!rant
I'm in the lookout for a new laptop for my dev work and occasional gaming (Dota 2 only), needs to have at least 16GB, 256 SSD, decent battery life and portable.
Which laptop do own?
Which do you recommend?8 -
I was going to install my SSD in my desktop, but I could also put it in one of my laptops. I feel like, since my desktop is faster anyway, it might be worth it to install it in a laptop so I can program faster while not at home.
What do you people think? If I do the laptop, should I do my Dell Inspiron 15 3542 or my 2008 macbook pro?1 -
What laptop would you guys recommend for development? I was thinking about a surface or surface book but those don't have dedicated gpus iirc and thus a friend recommended the Dell ultrabooks - what would you guys choose? MacBook is out of the game.12
-
As usual, the million-dollar question: whats the best laptop to buy for developers, in the price range up to $1,500?
I'm between a 2015 Macbook Pro, the new Dell Latitude or the Thinkpad T460 😕11 -
!rant
My stock hp 2000-369wm notebook laptop with 4GBmem won't boot (from USB) ReactOS, RemixOS, or Android-x866 -
I definitely need some stickers to hide scratches on my laptop! who else has a used and abused laptop?2
-
I'm looking for a good 10 inch laptop to run Linux. Standard size keyboard. I'd prefer atleast 4gb of ram and a quad core. Any recommendations?12
-
Hi guys, I need your help. Mostly those who use MacBook for development. I'm looking to buy a new laptop and was thinking of getting a MacBook. This will be my first time owning one. I always used Windows but for almost over a year now, I've been on Elementary OS. I do programming on my current laptop in Eclipse, IntelliJ and mostly, Android development in Android Studio. Also, I'm learning HTML and CSS. The battery of my current HP laptop has degraded to the point this thing only last 30 - 40mins when unplugged. Because of this, I can't do much on-the-go. Buying a new windows laptop, I know I will definitely dual boot with another Linux distro or better full boot Linux and get rid of Windows. My question is, how is programming or development on a MacBook. How's does Android studio perform? Are there anything that MacBook users wished worked better on Macs which involves Development? Please help because I can't decide and since I haven't used a MacBook as my daily driver, I'm not sure how it will affect my work writing code in there.
Thanks I'm advance for your answers. 😁6 -
Don't know why but I just love laptop keyboard. Not specific to what type of keyboard, just the fact it is a keyboard on my laptop... No wonder my neck pain is getting worse everyday :(
-
People of devRant, I need your help! I am finally buying a new laptop - ive been using a Dell N4140 for the past 4 years and I absolutely love it. But it's about time to retire the machine and upgrade.
I'm a programmer, I don't play games and haven't used windows in the last 2 years. Im looking for a 4-8GB RAM under $1000K. I plan to replace the HDD with an SSD. 13' is too small a screen and i feel 15.6' is slightly on the large side. I have a 21' external monitor anyway. My old dell was 14' and i loved it. And looks really matter for me. Alsooo, I dislike having a number pad. Its useless for me.
I know I'm picky. I can't afford a MacBook right now (about to graduate from university), but if you could help me in finding the right laptop, I'd be really grateful!14 -
So yeah Microsoft, all your new windows 10 updates look great in theory, but I would rather you not burning my goddamn laptop!!! now the fan is crazy !!
-
Really am getting tired of Windows. Seems to bloated for my old Elitebook. I want somehting sleek and lightweigh, that runs good on older hardware.
I did some research myself and even made a multiboot USB with some distros on it, but i feel like i still miss out on something.
On the few distros i tried, the battery drained really fast and the fans of my laptop spun almost constantly.
Here are the ones that i tried
- Kubuntu (was my fav)
- Elementary OS (no dark theme?)
- Xubuntu
- Puppy (didn't boot)
- Bunsenlabs (very sleek!)
and a few more i can't think of now.
I will use the OS for browsing and coding only. Oh andy system is an Elitebook 2560p, the i7 version (64bit). I really want to get into Linux, and i'm planning to install it on my desktop too, if i've gained enough knowledge and found a good distro7 -
I have a laptop with 8gb ram, 1Tb HDD, i5 7th gen running windows 10 and Ubuntu. Right now I'm using windows 10 as my primary OS, I'm simply addicted to the gestures especially the four finger swipe to switch desktops. I have been thinking of adding an SSD to the mix and my budget only permits a 120gb M.2 or a 250gb normal ssd.
The advantage with m.2 is that I can keep my HDD and boot my OS from the ssd and maybe install my IDEs on there but with the other ssd I'm gonna have to take my HDD out and use it as an external.
I read somewhere that 250gb above SSDs are the ones worth spending money on and that the 120 and 250 doesn't justify the price or life.
So my question is, should I go for an SSD? and if I do which one to go for m.2 or the normal one?4 -
!rant
I got an old laptop from my girlfriend that I can use for whatever I want.
As a programmer and computer nerd you can't deny that you wouldn't do anything with it, but what to do?
I want to use it for something, but can't figure out what. Maybe you have some ideas :D8 -
Alright, so i've just finished debugging my laptop. I planned to do some school project however the screen of my laptop suddenly decided i had something else to do and went dark on me. Took it apart, sprayed the hinges a couple of times with some conductor fluid in the hopes it would work again and sure enough it sort of works now.
I really hope it won't crap out on my tomorrow otherwise it'll be time to find a way to get a new laptop.. -
Guys can you help me?
I want to by laptop instead of pc, but i dunno if I should go with asus zenbook ux310ux with i7 and 16GB of ram and linux or used macbook with probably i7 and 8GB of ram.
I can't make up my mind whether to choose linux or mac os. I like linux but i have a feeling that someday I will need to do something, and program for that will be windows/mac os only.
PS. Arch linux with i3wm6 -
!rant
Finally.. I have decided to change my laptop. Please suggest me something good. Mainly worked with PHP and Java (Netbeans). Planning to start android.
Budget 1000-1200 USD4 -
//not a rant
In Semptember I will be attending information technology at university, and I was wondering what kind of laptop should I buy:
optimal screen size? (13.3 or 15.6)
ram? (for VMs)
processor?
dedicated graphics? (or should I just stick to integrated)
I will be mainly coding, running VMs and school stuff(maybe some casual game like League or Minrcraft), so I was wondering if you guys could help me out with the decision20 -
Hi, is anyone using Thinkpad E470?
Do you like it or it's waste of money?
Maybe sobie ideas for fancy 14' laptop?5 -
Why the fuck do I have to use a shitty Thinkpad with a crippled i5? It's at times like these that I miss my own i7 laptop... Even the screen on this is shitty. I asked if I can use my laptop and apparently it would have to meet some requirements. But if it was a MacBook, it would be A-Ok, totally fine! That's such fucking bullshit!!
-
My classmate forgot to lock his laptop when he went out to eat lunch. Needless to say, may other classmates raided his search history and came home with the spoils of war.... a good laugh about 'girl pool slide hurt' I dunno what's happening now
-
So, an employee at work told me that her daughter's laptop is acting strange and I said I would diagnose it for her. I was suppose to do it today but, her daughter left it at school, so I am going to work on it Saturday.
I was wondering, how much should I charge her if I wanted to get payed?1 -
The WiFi/Bluetooth chip in my SP3 died. Now I have to plug in this stupid adapter in my only USB port. So, that being said...
Ranters, best 2-in-1 convertible laptop, go!5 -
!Rant Suggestions
Guys what do you think of the laptop
Lenovo y700 touch model???
Or any other similar laptop that you suggest.1 -
!Rant
Planning on upgrading my laptop. Budget it's ~1000USD, any suggestions?
I'd prefer something with >=FHD screen, it's hard to code on my 1366x768 resolution (non glossy also)12 -
I have a pair of stickers from theHundreds since 3 years ago and I'm still waiting to get a laptop someday to use them... The struggle.
-
You know a good place to get stickers for my laptop?
Stickers like ubuntu, kubuntu, PHP, CSS, python and so on4 -
I wonder what other linux distro I should run on an extra hard drive I have for my laptop. I already have Xubuntu on the main one. I'm highly considering elementary OS.6
-
Does anyone here have a stack of stickers waiting for when their laptop is old enough it looks better plastered with stickers
-
Guys what are all the ways to install a os onto a laptop? I want to install some form of linux (haven't decided which distro yet, but I want linux), but my cheap shitty laptop freezes when I try to install the os. I've tried using a usb (live boot), cd and even SD card. What I mean by freezing, is everytime I run from the usb/cd/sd card, a black screen with a white underscore appears, but the underscore is frozen and nothing else happens. Is this fixable or not?
Thanks7 -
Did someone tried to glue iron beads on their laptop instead of stickers? Playing with the idea right now and don't know how to put them on without damaging the back of the laptop.2
Top Tags
Weekly Rant
View