Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "code player"
-
I'm a little late to this, but that Python master/slave issue.. what the fuck is up with that?!
You say that you're offended by words.
=> Fuck off. If you want to serve social justice, help people in third-world countries that need your help.
=> Also, you do realize that the use of master/slave is just as much applicable to technology as client/server or host/guest are, right? It's a relationship between fucking machines or code blocks, not humans.
You say "why the outrage over this?"
=> Fuck off. Your SJW bullshit has no place in technology. It's a fucking word in fucking code!!!
You say that you're improving the Python project with this.
=> Fuck off. It breaks existing documentation and needlessly abstracts terminology that is used pretty much everywhere. What do you prefer, conciseness and a language to be easy to understand or for it to become all cushioned to soothe your frail feelings?
You know, there's something else that I wanted to talk about that's related to this. I have Asperger Syndrome, which on paper is a disability. In practice it's difficulty to socialize while having an above average IQ. That "disability" is what drove me into technology. When I see job listings actively prefer people with disabilities for social justice, you know what? That offends ME. Because I wouldn't want to be chosen as the best applicant just because it ticks social justice boxes. I want to be chosen as the best applicant because I outcompeted every other applicant with actual skill and fitness to do my job.
Also, when a company sells you a defective unit, would you be happy? Of course not. So why are you happy when they employ a defective? I am someone that would - on paper - be impeded by natural selection, because I am "handicapped". But I'm all for it. Humanity is what it is today - shit - partly because defectives have become widely accepted into society. Call me a bigot, but I'd rather be called that than to not raise concerns about this trend.
On the subject of handicaps, that's a term that's used in games, what for aiding the player that can't win against the regular opponent (which is usually just a fucking bot, wtf yo). I am handicapped, therefore YOU shouldn't use the word in a sense where it's totally reasonable to use it!! Says no one ever, me neither. Grow a fucking pair and realize that code isn't written with the intent to offend anyone. So why are you?23 -
"full stack" means "you'll be doing everything from gathering client requirements through data architecture up to the UI design and of course implementing all of it"
"backend" means "you'll be coding everything from database through server-side code and client-side code including html and css"
"we need you on-site all day every day" means "we have no idea how and why we should use repositories with remote access despite being a company developing an internet app, and we don't trust that you would be working anyway"
"interesting challenging projects" means "the same boring crap as every other company, running on an incredibly botched and dezorganized codebase".
"competitive pay" means "actual pay is around 1.5 times the minimum allowed pay, and everything else is being siphoned off into (stupid and useless) 'benefits' like massage and fitness discount coupons"
"friendly collective having fun at numerous company events each years" means "it is mandatory for you to participate on our weekend drinking retreats but you'll only find out when we fire you because you're 'not a team player' after you refused to participate on those"9 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
#3 Worst thing I've seen a co-worker do?
A 20-something dev, 'A', back in the early days of twitter+facebook would post all his extracurricular activities (drinking, partying, normal young-buck stuff). The dev mgr, 'J', at the time took offense because he felt 'A' was making the company look bad, so 'A' had a target on his back. Nothing 'A' did was good enough and, for example, 'J' had the source control czars review 'A's code to 'review' (aka = find anything wrong). Not sorting the 'using' statements, and extra line after the closing }, petty things like that. For those curious, orders followed+carried out by+led by 'T' in my previous rant.
As time went on and 'T' finding more and more 'wrong' with A's code, 'J' put A on disciplinary probation. 'A' had 90 days to turn himself around, or else.
A bright spot was 'A' was working on a Delphi -> C# conversion, so a lot of the code would be green-field development and by simply following the "standards", 'A' would be fine...so he thought.
About 2 weeks into the probation, 'A' was called into the J's office and berated because the conversion project was behind schedule, and if he didn't get the project back on track, 'A' wouldn't make it 30 days. I sat behind 'A' and he unloaded on me.
<'A' slams his phone on his desk>
Me: "Whoa...whats up?"
A: "Dude, I fucking hate this place, did you hear what they did?"
<I said no, then I think we spent an hour talking about it>
Me: "That all sucks. Don't worry about the code. Nobody cares what T thinks. Its not even your fault the project is behind, the DBAs are tasked with upgrades and it's not like anyone is waiting on you. It'll get done when it's done. Sounds like a witch hunt, what did you do? Be honest."
A: "Well, um...I kinda called out J, T, and those other assholes on facebook. I was drunk, pissed, and ...well...here we are."
Me: "Geez, what a bunch of whiney snowflakes. Keep your head down and you'll get thru it, or don't. Its not like you couldn't find another job tomorrow."
A: "This is my first job out of college and I don't want to disappoint my dad by quitting. I don't even know what I'm supposed to be doing. All J told me was to get better. What the fuk does that even mean?"
Me: "He didn't give you any goals? Crap, for someone who is a stickler for the rules, that's low, even for J."
Fast forward 2 weeks, I was attending MS TechEd and I was with another dev mgr, R.
R: "Did you hear? We had to let 'A' go today."
Me: "What the hell? Why?"
R: "He couldn't cut it, so we had to let him go."
Me: "Cut what? What did he do, specifically?"
R: "I don't know, 'A' was on probation, I guess he didn't meet the goals."
Me: "You guess? We fire a developer working on a major upgrade and you guess? What were these so-called goals?"
R: "Whoa...you're getting a little fire up. I don't know, maybe not adhering to coding standards, not meeting deadlines?"
Me: "OMG...we fire people for not forming code? Are you serious!?"
R: "Oh...yea...that does sound odd when you put it that way. I wish I'd talk to you before we left on this trip"
Me: "What?! You knew they were firing him *before* we left? How long did you know this was happening?"
R: "Honestly, for a while. 'A' really wasn't a team player."
Me: "That's dirty, the whole thing is dirty. We've done some shitty things to people, but this is low, even for J. The probation process is meant to improve, not be used as a witch hunt. I don't like that you stood around and let it happen. You know better."
R: "Yea, you're right, but doesn't change anything. J wanted to do it while most of us were at the conference in case 'A' caused a scene."
Me: "THAT MAKES IT WORSE! 'A' was blindsided and you knew it. He had no one there that could defend him or anything."
R: "Crap, crap, crap...oh crap...jeez...J had this planned all along...crap....there is nothing I can do no...its too late."
Me: "Yes there is. If 'A' comes to you for a letter of recommendation, you write one. If someone calls for reference, you give him a good one."
R: "Yea..yea...crap...I feel like shit...I need to go back to the room and lie down."
As the sun sets, it rises again. Within a couple of weeks, 'A' had another job at a local university. Within a year, he was the department manager, and now he is a vice president (last time I checked) of a college in Kansas City, MO.10 -
rant? rant!
I work for a company that develops a variety of software solutions for companies of varying sizes. The company has three people in charge, and small teams that each worked on a certain project. 9 months ago I joined the company as a junior developer, and coincidentally, we also started working on our biggest project so far - an online platform for buying groceries from a variety of vendors/merchants and having them be delivered to your doorstep on the same day (hadn't been done to this scale in Estonia yet). One of the people from management joined the team working on that. The company that ordered this is coincidentally being run by one of the richest men in Estonia. The platform included both the actual website for customers to use, a logistics system for routing between the merchants, the warehouse, and the customers, as well as a bunch of mobile apps for the couriers, warehouse personnel, etc. It was built on Node.js with Hapi (for the backend stuff), Angular 2 (for all the UIs, including the apps which are run through a WebView wrapper), and PostgreSQL (for the database). The deadline for the MVP we (read: the management) gave them, but we finished it in about 7 months in a team of five.
The hours were insane, from 10 AM to 10 PM if lucky. When we weren't lucky (which was half of the time, if not more), we had to work until anywhere from 12 PM to 3 AM, sometimes even the whole night. The weekends weren't any better, for the majority of the time we had to put in even more extra hours on the weekends. Luckily, we were paid extra for them, but the salary was no way near fair (the majority of the team earned about 1000€/mo after taxes in a country where junior developers usually earn 1500€/month). Also because of the short deadline given to us, we skipped all the important parts like writing tests, doing CI, code reviews, feature branching/PR's, etc. I tried pushing the team and the management to at least write tests and make feature branches/PRs, but the management always told me that there wasn't enough time to coordinate and work on all that, that we'll do that after launching the MVP, etc. We basically just wrote features, tested them by hand, and pushed into the "test" branch which would later get tested and merged into master.
During development, one of the other juniors managed to write the worst kind of Angular code you could imagine - enormous amounts of duplication, no reusable components (every view contained the everything used in the view, so popups and other parts that should logically be reusable were in every view separately), fuck - even the HTML was broken (the most memorable for me were the "table > tr > div > td" ones, but that's barely scratching the surface). He left a few months into the project, and we had to build upon his shit, ever so slightly trying to fix the shit he produced. This could have definitely been avoided if we did code reviews.
A month after launching the MVP for internal testing, the guy working on the logistics system had burned out and left the company (he's earning more than twice the salary he got here, happy for him, he is a great coder and an even better team player). This could have been avoided if this project had been planned better, but I can't really blame them, since it was the first project they had at this scale (even though they had given longer deadlines for projects way smaller than this).
After we finished and launched the MVP, the second guy from management joined, because he saw we needed extra help. Again I tried to push us into investing the time to write tests for the system (because at this point we had created an unstable cluster fuck of a codebase), but again to no avail. The same "no time, just test it manually for now, we'll do that later when we have time" bullshit from management.
Now, a few weeks ago, the third guy from management joined. He saw what a disaster our whole project was. Him joining was simply a blessing from the skies. He started off by writing migrations using sequelize. I talked to him about writing tests and everything, and he actually listened. He told me that I'm gonna be the one writing them, and also talked to the rest of management about it. I was overjoyed. I could actually hear the bitterness in the voices of the rest of management when they told me how to write the tests, what to test, etc. But I didn't give a flying rat's ass, I was hapi.
I was told to start off by writing a smoke test for the whole client flow using Puppeteer. I got even happier, since I was finally able to again learn new things (this stopped at about 4 or 5 months into the project).
I'm using jest as the framework and started writing the tests in TypeScript. Later I found a library called jest-extended, but it didn't have type defs, so I decided to write them and, for the first time in my life, contribute to the open source community.18 -
So there it fucking goes.
Hi. I'm WillibertXXIV.
I'm not a programmer by trade; I have a more than fulltime job as a cook. As for the last year, I spent pretty much all my free time, overlapping my sleep time, to learn how to code.
All that so I can create a game that I started working on the same day I started my learning process. So far it's shit and it's going to stay that way for a long time. Only I can say this. It's my baby. It's fucking ugly and shit but it's mine.
Yesterday I broke it. I broke my baby. I don't know how it fucking happe. When I went to sleep I had a steady 175fps, nice realtime lightning and player / enemy that flowed like running water. I worked really hard to make that happened. Profiling, writing better code, profiling, etc. It's still not good, it's less shit.
I woke up, beautiful day. Not too warm, not too cold, that sweet spot right in the middle. Girlfriend already made the coffee. Perfect. Woke up, sat down to start my morning time work before going to my realjob and
BAM
Everything is shit, 20fps max. That one thing, gfx.waitforpresent, showing up in the profiler eating everything as the game run. Movements are now of stroboscopic nature. Light is still ok but what good does it do now fucking piece of shit. I'm not qualified enough for this shit.
Fuck,
Fuck this,
Fuck this shit,
Fuck this shit i'm out of here.26 -
The riskiest dev choice...
How about "The riskiest thing you've done as a dev"? I have a great entry for that. and I suppose it was my choice to build the feature afterall.
I was working on an instance of a small MMO at a game company I worked for. The MMO boasted multiple servers, each of them a vastly different take on the base game. We could use, extend, or outright replace anything we wanted to, leading to everything from Zelda to pokemon to an RP haven to a top-down futuristic counterstrike. The server in this particular instance was a fantasy RPG, and I was building it a new leveling and experience system with most of the trimmings. (Talents, feats/perks, etc. were in a future update.)
A bit of background, first: the game's dev setup did not have the now-standard dev/staging/prod servers; everything ran on prod, devs worked on prod, players connected and played on prod, etc. Worse yet, there was no backup system implemented -- or not really. The CTO was really the only person with sufficient access. The techy CEO did as well, but he rarely dealt with anything technical except server hardware, occasionally. And usually just to troll/punish us devs (as in "Oops ! I pulled the cat5 ! ;)"). Neither of them were the most reliable of people, either. The CTO would occasionally remote in and make backups of each server -- we assumed whenever he happened to think of it -- and would also occasionally do it when asked, but it could take him a week, sometimes even up to a month to get around to it. So the backups were only really useful for retreiving lost code and assets, not so much for player data.
The lack of reliable backups and the lack of proper testing grounds (among the plethora of other issues at the company) made for an absolutely terrible dev setup, but that's just how it was, and that's what we dealt with. We were game devs, afterall. Terrible or not, we got to make games! What more could you ask for!? It was amazing and terrible and wonderful and the worst thing ever, all at the same time. (and no, I'm not sharing the company name, but it isn't EA or Nexon, surprisingly 😅)
Anyway, back to the story! My new leveling system also needed to migrate players' existing data, so... you can see where this is going.
I did as much testing and inspection of my code as I could, copied it from a personal dev script to the server's xp system, ... and debated if I really wanted to click [Apply]. Every time I considered it, I went back to check another part or do yet more testing. I ended up taking like 40 minutes to finally click it.
And when I did... that was the scariest button press of my life. And the scariest three seconds' wait afterwards. That one click could have ruined every single player's account, permanently lost us players ...
After applying it, I immediately checked my character to see if she was broken, checked the account data for corruption or botched flags, checked for broken interactions with the other systems....
Everything ended up working out perfectly, and the players loved all of the new features. They had no idea what went into building them, and certainly had no idea of what went into applying them, or what could have gone wrong -- which is probably a good thing.
Looking back, that entire environment was so fragile, it's a wonder things didn't go horribly wrong all the time. Really, they almost never did. Apocalypses did happen, but were exceedingly rare, and were ususally fixed quickly. I guess we were all super careful simply because everything was so fragile? or the decent devs were, at least. We never trusted the lessers with access 😅 at least on the main servers where it mattered. Some of the smaller servers... well, we never really cared about those.
But I'm honestly more surprised to realize I've never had nightmares of that button click. It was certainly terrifying enough.
But yay! Complete system overhaul and migration of stored and realtime player data! on prod! With no issues! And lots of happy players! Woooooo!
Thinking back on it makes me happy 😊rant deploying straight to prod prod prod prod dev server? dev on prod you chicken migration on prod wk149 git? who's a git? you're a git! scariest deploy ever game development1 -
Tried deploying a new nginx server today, wrote the site config manually.
"Alright, done! Let's restart the service and look in the browser how it looks"
# systemctl restart nginx
> Process exited with error code.
"Fuuuuck..."
# nginx
> Unexpected } on line 13.
# vim /etc/nginx/sites-enabled/thatconfig.conf
"Wait wtf.. there's nothing wrong with the curly braces.. they're all opening and closing as they should..."
*takes another closer look*
Line 12, missed a fucking semicolon 😑
Append semicolon, :wq, # systemctl restart nginx
Works like a charm 🙄 all because of a stupid semicolon.
Until now I thought that the semicolon jokes were just lame.. but damn you semicolon, you are indeed the superior hide and seek player 😅9 -
First rant: but I'm so triggered and everyone needs a break from all the EU and PC rants.
It's time to defend JavaScript. That's right, the best frikin language in the universe.
Features:
incredible async code (await/async)
universal support on almost everything connected to the internet
runs on almost all platforms including natively
dynamically interpreted but also internally compiled (like Perl)
gave birth to JSON (you're welcome ppl who remember that the X in AJAX stood for XML)
All these people ranting about JS don't understand that JS isn't frikin magic. It does what it needs to do well.
If you're using it for compute-heavy machine learning, or to maintain a 100k LOC project without Typescript, then why'd you shoot yourself in the foot?
As a proud JS developer I gotta scroll through all these posts gushing over the other languages. Why does nobody rant about using Python for bitcoin mining or Erlang to create a media player?
Cuz if you use the wrong tool for the right job, it's of course gonna blow up in your face.
For example, there was a post claiming JS developers were "scared" of multithreading and only stick in their comfort zone. Like WTF when NodeJS came out everything was multithreaded. It took some brave developers to step out of the comfort zone to embrace the event loop.
For a web app, things like PHP and Node should only be doing light transforms between the database information and HTML anyways. You get one thread to handle the server because you're keeping other threads open to interface with databases and the filesystem. The Nexus.js dev ranting on all us JS devs and doesn't realize that nobody's actual web server is CPU bound because of writing HTML bodies, thats why we only use 1 thread. We use other worker threads to do the heavy lifting (yes there is a C++ bridge look it up)
Anyways TL;DR plz respect JS developers we're people too. ES7 is magic and please don't shit on ES3 or we'll start shitting on the Python 2-3 conversion (need to maintain an outdated binary just cuz people leave out ()'s in their print statements)
Or at least agree that VB.NET is an abomination and insult to the beauty that is TI-84 BASIC13 -
Today’s achievement: my phone didn’t autocorrect ‘fucking’ to ‘ducking’.
Clearly it’s as pissed off as I am about receiving shitty emails from the other team manager in my dept giving me and my team work to do and throwing us under the bus when he does jack shit all day except read BBC news and go on Facebook. On the odd occasion he does actually do work, it’s not good work, it’s riddled with bugs because he’s ‘too senior to need a code peer review’. Such a fucktard...
Oh, and the work he’s asked us to do technically sits in his team so I’ll be firing that straight back at him 😁
I’m all for being a team player and helping each other but I’m going to protect my team over helping someone. The gloves are about to come off....3 -
SuperCell is hiring.. Here is their job description:
Description
We need a new Builder. Are you an independent and passionate maker? Do you love spending 24 hours a day turning wood and gold into walls and defensive buildings? Do you answer the call to build even if that call comes at 4:00 a.m. and you haven’t had a day off in literally five years? If the answer to these questions is “Yes! Yes! A million times yes!” then we have a hammer with your name on it!
The Role
The focus of the Builder is to, uh, build.
You will be responsible for taking instructions from the player and building whenever and wherever they see fit. They say build and you say...well, you don’t say anything, you just build.
The world of Clash of Clans can get intense. Our Builder is expected to build quickly and expertly at all times, even while under great amounts of stress and/or attacks from Barbarians, Archers, Goblins, Giants, Wall Breakers, Wizards, and P.E.K.K.A.s.
Equally as important as building is rebuilding. All of the things you build will inevitably be destroyed, if not immediately, then soon after you just finished building or rebuilding everything. You can’t let it get you down. You must maintain your resolve and rebuild. Fast!
Responsibilities
Must be willing to relocate to the World of Clash
Must build and maintain a wide-range of buildings, statues, and war machines.
Must be on call 24 hours a day, 7 days a week, 365 days a year
Must have up-to-date Level 9 Tesla Tower maintenance certification
Must have proficiency with building materials both common (wood, stone, etc.) and uncommon (lightning, lava, etc.)
Requirements
Must provide own leather helmet
Must possess a passion for building
Must be comfortable working hands-on with molten lava.
Must adhere to strict dress code (orange sleeveless shirt, brown canvas pants, and boots).
Must speak fluent Barbarian
How to Apply
Send us your qualifications via e-mail to bethebuilder@supercell.com or write out your qualifications and send them to us via Baby Dragon. Either format is accepted.3 -
Scenario 1
Friend 1:"Hey, you're good at computers right?"
Me:"Erm yup."
Friend 1:"Can you hack Instagram? I've lost my password."
Me:"Oh My God."
Scenario 2
Me looking at a friend's unity C# code
Me:"You know there's an enter key right? Why is your code horizontal not vertical?"
(Means that after a semi-colon he continues his code)
Friend 2:"I like to read my code in horizontal, that feels natural to me"
Me:"What ever, as long as it works. But why do you have so many if function inside another if function?"
Friend 2:"Cuz I want the player to do this while moving"
Me:".........."3 -
Hi every developer! My name is Allen. English is not my native language so forgive me if I say something that does not make any sense. Let me tell you my story how I become a programmer. (I am still learning) My first computer was a DELL OptiPlex GX 720 desktop. My father bought it for our self-employee job. Before he allow me to use the computer, I used to sit next to him and watching what he do, what he click and what he gets. When he allow me to use the computer, I was slow at typing. One or 2 WPM (word per minute) my father taught me how to use the computer. Very slowly, my typing speed improves. I understand how to use the computer. but one day, I do what make me regret. I was playing with some executables, when I double clicking it, it does not work I used to associate files with apps. I associate music files with every player I want. So, I did what I used to, I associate exe files with windows media center! The computer started to open hundreds of windows media center (WMC for short) whenever an app is clicked, it opens windows media center. Today, I realized that windows were trying to open every app and every process that regularly run. However, since I associate it with WMC, instead of the app itself, it opens WMC some days after the mistake, I wonder how apps work and how I can create my own. My father told me before that a program is simply a binary file that the computer can read. However, it was too advanced to me at the time.I begin my search with google. Everytime I search, it says "learn to code" or something like that. I see some C++ code but, it was disgusting. when I read just a few lines of a hello world code in java. it was too complex
What I seen
#$$#% $%&$%&*#!@
~
(&*%&$ (_(*^% #&&* (^^$(&^$%^( %^*$())
~
^$70^(`*#%`*#&%^)*!" Hello world "#@
~
~
The actual code:
class helloworld
{
public static void main(String args[])
{
System.out.println("Hello World!");
}
}
I look for an easy way but my attempts fail. then. I push
I to learn how to code.I try learning java. but it still
Very complex. i tried LibertyBASIC. from LibertyBASIC to
Java. after learning LibertyBASIC, it was easy!
LibertyBASIC -> Java -> Ruby -> NOW, C# and XAML
Today, I am learning C# and XAML.
My first OS : Windows 7
My first Computer : DELL OptiPlex GX 720
My first successful click : The Start menu
My first used App : Microsoft Encarta 2009
My first created App : Hi-Lo(number-guessing game. written in LibertyBASIC)
Thankyou for reading this Long story.
8 -
I recently joined a new company where work is quite different than my previous company.
Every day at work is challenging for me. There is good exposure to learn technology in depth. But time constraint to deliver module like under 3 days does not let me learn my work, also I am not satisfy with the quality of my code that I provide, it more looks like a patch. In my previous company I was favorite developer of my team but here I feel like a fresher who doesn't know from where to start.
Even I feel like my presence does not make any impact in office as I am just like an extra player of the team. I am slow at my work because I learn then I code due to which my manager does not consider me for any new work. I feel like left out in my team.
Once I overheard one of my colleague he called me helpless and were making fun of me. With every passing day I am losing my confidence.
I have no github reputation. It's like I am jack of all trades but master of none.
Every day is like big fight day in office.
I know our only way to survive in this industry is to keep on learning but in smart way. I am not sure what's that smart way?
Any advice would be helpful.4 -
Well, my company hired a total amateur who can't do anything right on his own without copying code from me or the internet and I have to pretend he's helping in any capacity because otherwise I'm a "bad team player" and "should communicate more".
Helped me get over impostor syndrome, at least.7 -
I'm learning web development, and this is another small project that I made - a basic code player.
Used jQuery for the first time and realized how easy it makes things.
PS - I know it is pretty insignificant given that people here create much bigger things, but I'm proud of it!
PPS - Will post the previous small project I'd done. It was a browser based basic game.
17 -
I miss the good times when the web was lightweight and efficient.
I miss the times when essential website content was immediately delivered as HTML through the first HTTP request.
I miss the times when I could open a twitter URL and have the tweet text appear on screen in two seconds rather than a useless splash screen followed by some loading spinners.
I miss the times when I could open a YouTube watch page and see the title and description on screen in two seconds rather than in ten.
I miss the times when YouTube comments were readily loaded rather than only starting to load when I scroll down.
JavaScript was lightweight and used for its intended purpose, to enhance the experience by loading content at the page bottom and by allowing interaction such as posting comments without having to reload the entire page, for example.
Now pretty much all popular websites are bloated with heavy JavaScript. Your browser needs to walk through millions of bytes of JavaScript code just to show a tweet worth 200 bytes of text.
The watch page of YouTube (known as "polymer", used since 2017) loads more than eight megabytes of JavaScript last time I checked. In 2012, it was one to two hundred kilobytes of HTML and at most a few hundred kilobytes of JavaScript, mostly for the HTML5 player.
And if one little error dares to occur on a JavaScript-based page, you get a blank page of nothingness.
Sure, computers are more powerful than they used to be. But that does not mean we should deliberately make our new software and website slower and more bloated.
"Wirth's law is an adage on computer performance which states that software is getting slower more rapidly than hardware is becoming faster."
Source: https://en.wikipedia.org/wiki/...
A presentation by Jake Archibald from 2015, but more valid than ever: https://youtube.com/watch/...
32 -
In order to reduce support costs, manager instructed his team to remove all logging/reporting of errors in the company’s CRM application.
Team’s support tickets went down 80%, manager received an award for his efforts, but mysteriously, DBA/support workload increased, bad/missing data,
increased support tickets in other areas of the business (shipping, etc. that relied on correct data from the CRM) and other side-affectual behavior.
Even after pointing this out this correlation, showing before/after code, no one believed the two were related and I was accused of not being a ‘team player’.
“You and the other teams need to learn from his example!”. As ‘punishment’ was I was moved to the team managing the CRM application.1 -
that one legendary guy who cranks out code and builds insane features. PMs (product management) love him because he builds features in several months which 10 devs together couldn't have built in the same time (so they say), features that are loved by customers as well, become their new standard and that have saved our company's asses in the past.
features are really awesome, performant and have very few bugs (compared to the rest of the software シ).
but this guy seems to live for this job. he also works at weekends, at unholy times of day and night and even in his holidays (he doesn't care that this is actually illegal, in terms of employee's rights, and he wouldn't listen to his superiors, no matter what they tell him)
so far, so good - except that he will probably die of some stroke or something very soon due to this lifestyle.
but it must be an absolute pain in the ass to work with him, as long as you're a developer (or his superior).
he lives in his own world and within the software, his features are also his own world. since the different modules interact with each other, sometimes you would be assigned a bug that might have its cause in some interaction of your and his module. talk with him about it? forget it. he wouldn't answer most devs who contacted him for some reason. ever. fix it in his module yourself? might happen that he just reverts your changes to his module without comments. so some bugs would lie on your desk forever because theoretically you know what would need to be done but if you cannot reach out into HIS world, there's no way to fix it. also - his code might be good in terms of performance and low bug numbers. but it seems to be hard to work on that code for everybody else but him.
furthermore, he is said to be really rude. he is no team player, but works on a software that is worked on by a huge team.
PMs think he's a genius, just a great dev, but they don't understand that other devs need to clean up the mess behind or around him.
everyone who's been his superior so far recommends to get him fired, but the company wouldn't fire him because they don't want to lose his talent. he can just do what he wants. he can even refuse to work on certain things because he thinks they are boring and he is not interested in them. devs seem to hate him, but my boss said, they are probably also a bit jealous because of his talent. i think, he's not wrong. :)
i haven't actually met him so far or was actually "forced" to deal with him, but i've never heard so many contrastive things about one person, the reputation of his, let's say vibrant personality really hurries ahead. he must be a real genius, after all i've heard so far, like he lives in the code. i must say i'm a bit curious but also somewhat afraid of meeting him one day.
do you also have such a guy at your company?11 -
A follow up for this rant : https://devrant.com/rants/1429631/...
its morning and i have been awoke all night, but i am so happy and feel like crying seeing you people's response. :''''') Thank-You for helping a young birdie like me from getting exploit.
In Summery, I am successfully out of this trickery, but with cowardice, a little exploited and being continuously nagged by my friend as a 'fool'.
Although i would be honest, i did took a time to take my decision and got carried away by his words.
After a few hours of creating a group, he scheduled a conference call , and asked me to submit the flow by which my junior devs will work.
At that time i was still unclear about weather to work or not and had just took a break from studies. So thought of checking the progress and after a few minutes, came up with a work-flow, dropped in the group and muted it.
At night i thought of checking my personal messages , and that guy had PMed me that team is not working, check on their progress. This got me pissed and i diverted the topic by asking when he would be mailing my letter of joining.
His fucking reply to this was :"After the project gets completed!"
(One more Example of his attempts to be manipulative coming up, but along with my cowardice ) :/
WTF? with a team like this and their leader being 'me'( who still calls him noob after 2 internships and 10 months android exp), this project would have taken at least one month and i was not even counting myself in the coding part(The Exams).
So just to clarify what would be the precise date by which he is expecting the task, to which he said "27th"(i.e, tomorrow!)
I didn't responded. And rather checked about the details of the guy( knew that the company was start-up, but start-ups does sound hopeful, if they are doing it right) .A quick social media search gave me the results that he is a fuckin 25 year old guy who just did a masters and started this company. there was no mention of investors anywhere but his company's linkedin profile showed up and with "11-50" members.
After half an hour i told him that am not in this anymore, left the group and went back to study.(He wanted to ask for reasons, but i denied by saying a change of mind ,personal problems, etc)
Well the reality is over but here comes the cowardice part:
1)Our team was working on a private repo hosted on my account and i voluntarily asked him to take back the ownership, just to come out of this safely w/o pissing him off.
2)The "test" he took of me was the wireframe given by their client and which was the actual project we 5 were working on. So, as a "test", i created 15 activities of their client's app and have willingly transferred it to them.
3) in my defence, i only did it because (i) i feared this small start-up could harm my reputation on open platforms like linkedin and (ii)the things i developed were so easy that i don't mind giving them. they were just ui, designed a lot quickly but except that, they were nothing(even a button needs a code in the backend to perform something and i had not done it) . moreover, the guys working under me had changed a lot of things, so i felt bad for them and dropped the idea of damaging it.
Right now am just out of sleep, null of thoughts and just wondering weather am a good person, a safe player or just a stupid, easily manipulated fool
But Once again My deepest regard from my heart for @RustyCookie , @geaz ,@tarstrong ,and @YouAreAPIRate for a positive advice.
My love for devrant is growing everyday <3 <3 <3 <35 -
So recently I needed to make a little Tic-tac-toe game with Node.JS for an university project. I previously learned Java and C# so Javascript as a non-compiled, script based language was something new for me.
Now during the programming process I reached the point where I needed to implement a function to change the player who's playing.
I was testing the game and... It seemed like the player was changed twice so it immediately switched back to the previous player.
Using a lot of console.log's I finally stumbled upon the error... (since Javascript or at least Visual Studio Code, I honestly don't know, doesn't have any kind of debugger or something).
Why the fuck does js allow to make allocations in if conditions?
I accidentally wrote one '=' instead of three '==='.
No error, no warning... Nothing.
Since then js and me are not friends anymore.8 -
Code your own damn stuff!
I am building a RFID and button controlled music player for kids.
I am using a couple of different modules for that. The one for the input was really laggy. I thought it was so laggy because of the network delay. I tinkered with it a week but it didn't improved. So I just coded my own module which was much easier to do than I thought.
It was a really rewarding to code something yourself in less than a day instead of trying to get something working for a week. -
So, I'm still not certain if it's actually a bug or merely my lack of experience, but I've been working on a 2D platformer game (using only C++ and SDL2) for roughly 2 years now (on and off; sometimes off for months) and I'm extremely embarrassed about this, but for the life of me, I cannot seem to get the player character's movement and collision physics working properly. It's driving me absolutely insane.
I've read articles and tutorials, referenced books, and posted about it in game development communities (e.g., gamedev.com, Discord servers, etc.), but even though the fundamental structure and explanations made sense, getting the code to work has been unsuccessful, albeit not completely so, but if I get one thing working, another thing breaks. It feels like I'm trying to repair a vase that fell off of a skyscraper and turned to dust on the street below.
I've always been a very tech savvy person with a fiery passion for programming, electronics and game/software/embedded/web development, but to be honest, having such a difficult time with things like this that — in theory, at least — seem like trivial bumps in the road have made me feel like I'm never going to be successful in this field. But regardless of the depressing thoughts of worthlessness, my passion doesn't let me stop trying. Who knows, maybe it'll have to remain just a hobby. 😕4 -
I don't work for Walmart, but they almost put my job in jeopardy today. I have a console app in production that pushes Walmart orders from their marketplace into our system for fulfillment. For half a year, I have handled thousands of orders, but overnight, all customers were getting massive price cuts on products in the Walmart feed! I looked at the data and initially thought it was my error due to using a quotient instead of a product in the code. But upon closer inspection, some fool at Walmart had changed code on their end without telling my team! Broke all the things. Lucky we were able to pull a full stop before we lost disgusting amounts of money, but you would think that a big player like Wally would at least announce a breaking code change to their users. 😲😡1
-
I will never ever see, play, or think about video games the same way again. Even playing all my childhood games is never the same.
I will now forever see the game from the inside out, imagining what code the devs might have written to achieve what is happening: sprites, audio, triggers, AI algos, etc. No longer is a player or character just a player or character; they're sprites, animations, classes and variables and method calls. o.o2 -
Last night I spent 2 hours trying to explain probability to a drunk poker player.
He refused to accept that if Player A and Player B are flipping coins and player A wins 9 coin flips in a row, player B should still treat flip #10 as a 50/50 chance and bet accordingly.
This is basic logic, and when I tried to explain it in terms of computers and code he said "of course a computer would win but I'm saying that 51% against anyone I would win, I've been doing this for 20 years"
My brain hurts.2 -
My first software.. Okay. So first time I ever attempted was with my father, i was around 8 or so, i remember very little from it, but in nutshell, i somehow ended up at his job having day off school or something, no idea.
Apparently he was bored, so he decided yo show me... Basic. Yep, thats right. Frking basic. Anyway, he shown me some really basic stuff in basic, and pushed the envelope really hard, just trying to force into me more and more in these 8hrs. I started with filling screen with "o" characters. Most of times he was telling me what to write with elaborate explanation why. At the end of the day, we finished with simple maze game where player was "o" and maze walls was #. Without any goal, or anything.
Next day i was at point 0, understood nothing from it except how to handle keystrokes (and belive me, that for me was huge mindblow, and even bigger mindblow that it actually made prefect sense).
I dont remember much, but later i started with father-assisted c++ and some pascal. I immidietly loved c++ but dropped learning it for (NullPointer) reason.
Thats not really project imho, so now time for my actual first project.
It was about time when ARK survival evolved was a fresh thing, i was playing it a lot. Server admin became buddy. We all complained about max level cap, but to change it in config you needed to input whole new xp curve.
At that time i had great familiarity with google and computers, some thought i was some kind of PC god (seriously I heard someone saying so about me lol) just becouse I could ressurect most cases of broken windows. And I had next to zero programming expirience. It was about to change. I made first c++ actual program, that was making xp curve for you. It took me just bearly 2 days and was series of cin, cout, one file open, some maths in loop, and done. Maths was very bad. But i pushed it into steam forums, and one guy responded how.bad my math was, so we colabed on making 2 iteration. Took around week. Than half a year passed and we wanted go big. Go gui. I had no freaking idea how making gui looks like. Community liked my cli tool, we had quite a lot of downloads, why not go GUI. And thats when I discovered QT framework. And we had few features in mind... It took us half a year to make it. From 60 lines of code i jumped into 1k lines of code. We pushed it and immidietly started working on 4th version with much greater customizability etc.
Than i finished 18 and found a job. Job in php. I got it becouse I made this project.
Now project is abandon. This project also gave me a lesson that donations will not feed you.
Edit: and before you think about my father that he was nice person to show me code, trust me, i dont know bigger dick than him. -
Have to change out the audio player on a WordPress site for a podcast. Can't follow the code properly because wp forgets that standards are a thing. Code readability is shit as well. Fucking WordPress.6
-
If you ever feel like your code is useless, remember, someone made the “Jazz” equalizer preset on that cheap mp3 player you had in your childhood.
As if people ever chose something other than “Bass”.3 -
So I'm writing a function in Unity3D that walks a rectangular grid. At one place in the code, I got the x+y coordinates backwards, which caused the function to infinitely loop between two coordinates.
Not seeing a way to kill the loop, I looked it up on Google. The suggestions I get are. . .
1. You need to kill the Unity3D task and lose your edits because the environment and the player run on the same thread.
2. You can pay ten bucks for an extension that lets you break out of infinite loops.
3. You should really avoid writing infinite loops. That's just bad form.
SERIOUSLY?
1 -
v0.0005a (alpha)
- class support added to lua thanks to yonaba.
- rkUIs class created
- new panel class
- added drawing code for panel
- fixed bug where some sides of the UI's border were failing to drawing (line rendering quark)
v0.0014a (alpha) 11.30.2023 (~2 hours)
- successfully retrieving basic data from save folder, load text into lua from files
- added 'props' property to Entity class
- added a props table to control what gets serialized and what doesn't
- added a save() base method for instances (has to be overridden to be useful beyond the basics)
- moved the lume.serialize() call into the :save() method on the base entity class itself
- serialized and successfully saved an entities property table.
- fixed deserializion bugs involving wrong indexes (savedata[1] not savedata[2])
- moved deserialization from temp code, into line loading loop itself (assuming each item is on one line)
- deser'd test data, and init()'d new player Entity using the freshly-loaded data, and displayed the entity sprite
All in all not a bad session. Understanding filing handling and how to interact with the directory system was the biggest hurdle I was worried about for building my tools.
Next steps will be defining some basic UI elements (with overridable draw code), and then loading and initializing the UI from lua or json.
New projects can be set as subfolders folders in appdata, using 'Setidentity("appname/projectname") to keep things clean.
I'm not even dreading writing basic syntax highlighting!
Idea is to dogfood the whole process. UI is in-engine rendered just like you might see with godot, unity, or gamemaker, that way I have maximum flexibility to style it the way I want. I'm familiar enough with constructing from polygons, on top of stenciling, on top of nine-slicing, on top of existing tweening and special effects, that I can achieve exactly what I want.
Idea is to build a really well managed asset pipeline. Stencyl, as 'crappy' as it appeared, and 'for education' was a master class in how to do things the correct way, it was just horribly bloated while doing it.
Logical tilesets that you import, can rearrange through drag-n-drop, assign custom tile shapes to, physics materials, collisions groups, name, add tag data to, all in one editor? Yes please.
Every other 2D editor is basic-bitch, has you importing images, and at most generates different scales and does the slicing for you.
Code editor? Everything behavior was in a component, with custom fields. All your code goes into a list of events, which you can toggle on and off with a proper toggle button, so you can explicitly experiment, instead of commenting shit out (yes git is better, but we're talking solo amateurs here, they're not gonna be using git out the gate unless they already know what they're doing).
Components all have an image assignable to identify them, along with a description field, and they're arranged in a 2d grid for easy browsing, copying, modifying.
The physics shape editor, the animation editor, the map editor, all of it was so bare bones and yet had things others didn't.
I want that, except without the historic ties to flash, without the overhead of java, and with sexier fucking in-engine rendering of the UI and support for modding and in-engine custom tools.
Not really doing it for anyone except myself, and doubt I'll get very far, but since I dropped looking for easy solutions, I've just been powering through all the areas I don't understand and doing the work.
I rediscovered my love of programming after 3-4 years of learning to hate it, and things are looking up.2 -
WCF doesn't like me adding to lists...
I have to make an uno game that supports multiplayer with WCF for school...
I have a player class that has a list of card classes.
I have a function called dealHand, it adds Cards to the hand list...
I also have a callback function for updating my wpf gui...
For whatever reason if when the gui calls dealhand and I try to use myList.add(new Card()) then the updategui function in my wpf client doesn't fire...
But if I take a seperate method called makeHand which returns a list of cards, and just do myList = makeHand() then that works fine...
Never been so baffled/cursed so much at code before... Is there something about Lists that WCF doesn't like? Seriously... was weird...
Hopefully that was somewhat coherent...4 -
Like age 8?
As a kid I really liked flash games and animations and wanted to get into it. I couldn't do flash, it looked too complicated but I found a little software by the name od KoolMoves that was just a simpler flash animation tool.
I did a bunch of shitty stick figure animations in it (hello to everyone from stick figure death theatre) but eventually I realized that I can make it do things (interactive menus, choose your story kinda things, move the player around, shoot...!)
I fell in love with AS1 and later AS2.0 and made bunch of demos and proof of concepts for systems and games. Most are lost to time and datarot by now)
Age 12
Eventually I found out I can make the entire Windows machine do what I want using first Batch files and later Visual Basic script (made a skype bot!) At this point I was also really into graphics and logo/web design
Age 15 - 20 or so
Then it was pretty natural to move to actual Visual Basic, then C# and finally I to C++. And I had the C family in my heart forever. I managed to get a but into 3D graphics too and got a part-time in archviz
Even by this point I never believed I could be a programmer as a profession. I thought of it just as something I love, but have no chance getting into compared to some of the names out there. I half expected to be either doing graphics (cause I found it simple at the time) or some shitty random job in an office.
20+
Finally I decided to go to uni and study software development, see if I can touch the future I always dreamed of! And... Well... I found out more than 80% of the people there never touch a language up until now and most people are just as retarded as I thought..
For a while I also worked as a game designer (still not being comfortable calling myself a programmer, so I chose a non programming position) but I ended up going into the code and improving and fixing game designer tools (it was unity and C#)
After seeing actual programmers at work in a company, and talking to a bunch of them I realized I already have everything I need to do this seriously and with that experience out of the way I breezed through uni, learned to love Linux and landed a proper job :)
I kinda hope my experience with long lasting self doubt will be useful for someone -
Does anybody else have the project where every time you try to change something, no matter how small, you always end up screwing it up and needing a bunch more time to fix it just to get back to the starting position?
I have this project I've done, a custom Ambilight system for my TV, and everytime I try to add a feature the lights stop working altogether... Tried adding detection of when I start my media player to automatically start the Ambilight mode (I made several modes, one of which is just shine a certain color all the time which is great if you don't want to use normal lights and want to be able to control the lights from your phone).
I had the code for detecting app start and stop from before when I implemented it for a slightly different system. I just changed the few things that are different and poof, no more lights... I managed to forget the other system checked a flag after every process exit and overrode the mode and I removed the setting of the flag, but not reading of it...
Every single time I do changes on this it's something... Other projects sometimes go smoothly, sometimes not, but this one just doesn't want to be kind to me....
Results are awesome, though :)5 -
Surely I can't be the only one curious enough to start this discussion; so what's everyone's backgrounds?
I'm sure we're all under the assumption that we're all developers of some sort and like to rant about what we do-- hence the app name-- but what does everyone do? Such as what you make, what you've made, your skill set and a little info about yourself
Myself, I'm a 21 year old male from the North West of England. My name isn't actually Markshall, it's Mark, but I'm a huge fan of Eminem so it's a play on my name on his (Marshall).
I'm primarily focused on web development but I started programming at the age of 11ish in Visual Basic 6 and found the web development was my chosen area of expertise. I know the obvious HTML and CSS, but also know PHP and JavaScript and have lots of experience with MySQL databases and rather extensive knowledge of the jQuery library -- yes, I do know it's a library and not a separate language before people get pissy!
I'm not yet employed by a web development company, I work in retail whilst I freelance my web development skills
I have an online portfolio at http://mark-eriksson.com (needs a little updating-- not all my projects are on there and you're unable to view any information about them)
I write code in Brackets (http://brackets.io) on my 21.5" iMac. I use Google Chrome and have iPhone 6s Plus 64GB. PS4 player. Vodka and Jack Daniels enthusiast.
So, what about you?
Side note: devRant needs an edit feature :-(12 -
I'm working on a very-customized web player at work.
I filled my code with a plenty of comments, many to justify those functions / fixes.
For those comments, Safari is depicted as worse than Edge.
Is it even possible?
The next dev, which will take my code in his hands, must know how much we suffered to build it.4 -
Background: I am working on task x. On successful completion of task x, task y may be given to me. Task x is haaaaaard. My group is not the only player and any fuck up will break my group and at least two others. Now here is my story:
Me: Yeah I am doing this hard thing and that hard thing and getting ready for these hard meetings.
FormerCoWorker fcw (): wow that sounds hard.
CurrentCoWorker ccw (): yeah he's working on task x and task you.
Me me (): what? No I'm not. I am working on task x. Don't go randomly assigning me tasks like that.
ccw: well if you finish task x you will be an expert in section z of code. So it is only natural you take on task you.
me: yeah but task x sucks and task y is why several engineers have quit the company. You never know. You could be assigned task y and quit. Why do I have to take on task y and quit?
NGL, I will do it of they promote me. I may be a whore, but I am gonna get paid. -
People always say thet you should not quit your job before you have the next job lined up, but what if you plan to do freelance? This is my dilemma.
A bit of context (rant).
My current job is my first official job. Small company, VERY HIGH staff turnover rate. I have been here for 2 and a half years. My commute on a good day is < 20 mins, and money is relatively good.
During the last 6 months, all devs above me resigned, which lead to the system maintenance being passed on to the few devs left. Our biggest system is a legacy system (Windows CE), and new clients are actively signed up and new features requested. The codebase is not even worthy of being called spaghetti, changes break every client, I need to wash my hands every couple of minutes. Seriously, I would rather maintain obfuscated code. It is like a bunch of highschoolers wrote the system, though I think they would have done a better job.
Management is nice and understanding, but the state of the codebase is killing the spirits.
I fill my nights and weekends moonlighting to keep my mind off of the 'daymares' at work. I have never been a team player, and thrive on my own. I have been thinking quiting and going full freelance/contract the last couple of months. Should things not work out, I can always go job hunting (see issue in par. 1)2 -
Just spent an hour salvaging some code from an app project I abandoned so I can reuse it in the future and add what I salvaged to a portfolio of small things I've made.
It was a simple multiple player name menu that generated player objects once the user was done entering names.
Loads of potential future uses.
No point letting it sit inside an abandoned project even if it is somewhat trivial to reproduce. -
Start standing up for my health and my expertise more, dive deep into animation, get a job on the product side, find time for my neglected side projects, go on more walks, get with a hot dev girl who can act as my lead and can spank and beat me when my code is shitty, network more with other devs to build collective safety nets for each other, buy a house with a record player room and hockey garage, practice more love3
-
Okay so there are a lot of things that are left by us students as "this would be taught to us on job, why bother now?" So i have many questions regarding this:
- is it a safe mentality? I mean University is teaching me, say a,b,c and the job is supposed to be like writing full letters, than am i stupid to stick to just a,b,c and not learning how to write letters beforehand?
- what is even "taught" on job? This is especially directed towards people in Big firms. I mean i can always blame that small ugly startup who treated me badly and not gave me any resources, but why do i feel its going to be same at every other company?
I guess no one is gonna teach me for 6 months on how to write classes with java, or make a ml engineer out of me when i don't know jack shit about ml.... That's the task for college, right?
I feel that when these companies say they "teach", you they mean how to follow instructions regarding agile meetings, how to survive office politics and how to learn quickly and produce an output quickly. I don't think that if i don't know how MVI works, then they are gonna teach me that, would they?i guess not unless they already have someone knowledgeable in that topic
- what about the things that are not taught in our colleges and we wanna make a career in it? Like say Android. From what i have experienced , choosing a career in a subject that's not taught you in grad school immediately takes away some kind of shield from you, as you are expected to know everything beforehand. So again, the same questions bfrom above
i did learned something from job life tho, and that too twice. Once it was when i first encountered an app sample for mvvm and once when i found out a very specific case of how video player is being used in a manner that handled a lot of bugs.
Why i didn't knew those approaches when i was not in job? Well, the first was a theoretical model whose practical implementation was difficult to find online that time and the second was a thing that i myself gave a lot of hours, yet failed to understand. However when i was in the company , i was partnered with a senior dev who himself had once spent 30 days with the source code to find a similar solution.
So again , both of above things could have been done by me had i spent more time trying to learn those "professional tools" and/or dwelve deeper into the tech. And i did felt pretty guilty not knowing about those...5 -
Previously, I half-assedly theorized that, given a timeline on which I'd store state mutations, with each mutation being an action taken ingame by either the player or computer, I could feasibly construct a somewhat generative narrative engine.
Basis: the system reads the current state, builds [some structure] holding possible choices, and prompts the player to take an action from those choices. The action modifies the state, and the loop begins anew, save that now it's the system "prompting itself", so to speak.
Utterly barebones and abstract as it may be, it was useful to build this concept in my head as it gave me a way to reason about what I wanted to build. But there were two problems which I had to grapple with:
- What would [some structure] even be?
- How would the computer make choices based on an instance of [some structure]?
I found myself striking the philosopher pose for long hours on the toilet, deeply pondering these questions which I couldn't help but merge into one due to the shared incognita; silly brain wanted trees but I kept figuring out that's not going to work as the relationships between symbols are sometimes but not always hierarchical. Shhh, silly brain, it's not trees.
So what is the answer?
Well, can you guess it?
Graphs, of course it's fucking graphs. Specifically, a state transition graph. It was right in my face the whole time and I couldn't see it. Well, close enough.
It's ideal as the system in question is a finite state machine with strong emphasis on finite -- the whole point is narrowing down choices, which now that I think about it, can also come down to another graph. Let me explain.
A 'symbol' or rather SIGIL is an individual in-game effect. To this FSM, it's an instruction. Sigils are used to compose actions, which you can think of as an encapsulation of some function, or better yet, an *undoable transaction* which causes some alteration in the game world.
But to form a narrative from a sequence of such transactions, and to allow the system to respond to them coherently, relationships need to be established between sigils in a manner that can be reasoned about in code. You may not realize this yet but this is both a language processing and text generation problem, so fuck me.
However, we have a big advantage in that we are not dealing with *natural* language, that is to say, each sigil is a structure from which we can extract valuable information on the nature of the state transformation applied.
This allows us to find relationships between sigils programmatically: two words are related if some comparison between the underlying structure -- and the transformation it describes -- holds true. Therefore, if we take the sigils that compose the last transformation in the timeline, fetch relationships for said sigils according to a given criteria, then eliminate all immediate relationships that are not shared between all members of the group, we end up with a new one that can be utilized as starting point to construct a reply.
More elimination of possibilities would have to be performed as this reply is constructed [*], but the point is that because the context (timeline) is itself made of previous transforms, the system *could* make such a reply coherent, or at the very least internally consistent.
Well... in the world of half-assed theory. I don't know whether I'm stupid, insane, both, pad for alignment, or this is an actual breakthrough. Maybe none of the above.
Anyway, it's another way to mentally model the problem which is very useful. New challenge would be the text generation part, extremely high chance of gibberish within existing vision; need more potty-pondering.
[*]: I'll break it into bits OK.
0. Determine intention. That's right, the reply isn't actually _fully_ generated, it's just making variations on a template. So pick a template depending on who is taking a turn and replying to who (think companion relationship score bullshit)
1. Sort the new group according to the number of connections the constituent sigils had to the context from which they were extracted, higher first.
2. Pop from the sorted group (least connections). If there are other nodes left in the group, and it doesn't connect back to any of the other nodes (sigils) up to a certain distance, then discard it and repeat. Else keep going.
2. Unshift from the sorted group (most connections). If can traverse up to another sigil in the same group, then go for it. Else derive search criteria from current context (including intention), so as to look for another sigil to concatenate. Some form of weighting would be needed here, need to think about that.
3. Decide when to stop. Probably some chance, as in the more sigils you have, the lower the chance a new one will be added maybe. Need to think about this too.
4. Send transform, loop begins anew.
And that's it. So alright brb I'm going to take a dump on the Agora.14 -
I was once trying to create a video player since the format was not supported by the browsers today, so i started to download the video files from the server. Only to discover a bug in my code was trying to download a video file from the server. This was way to much for the server to handle and caused it to crash. People where running in the building to get the stream back up, i sat there silently and killing my browsers process. Since then i always test my request from local if they are okay before downloading a file from a server
-
So apparently my code went to prod more or less all right. Phew, the deadline was this week-end. This project have been sitting there for month, they gave me the technical requirement and never bothered to ask the stakeholders about it. When the contract went in, they started to freak out it wasn't usable.
The thing is, this project had way more moving part and trying to threat video in the frontend is not the easiest. But now is REFACTOR TIME.
I dream of getting rid of the browser video api (too flaky), download the bitmap directly and render it in requestAnimationFrame. I call it just-in-time rendering. I think i'd need to put a decoder in aws, I did it already with ffmpeg. I could not manage to put it in streaming mode though, so it was still a bit slow, but i could decode, write and re-encode faster than the video player speed.
What do you lads think? Doable or not? I at least need to general tidy up (this codebase have grown organically without any fucking direction from above, like this project took all my time on the technical side, I did not have time to run after people to get specs), centralizing state, improve monorepo and tooling, perfs,...
Hopefully they understood i cant keep adding whatever feature they want today. -
I'm fucking tired of my computer having random
2 seconds latency on any basic action and being slow as fuck regardless of powerful processor, ssd and 32GB RAM. Music via bluetooth is basically unusable since every few seconds the music stops for a 0.2s then plays again. I installed this system (opensuse tumbleweed) in February this year and it's just sad that I have reinstall again (any ideas for distro) ?
I made a dummy mistake of buying a CPU without internal graphics and this resulted in having to buy a GPU. So I got myself Nvidia(another mistake) since i though i would be using CUDA on the university. Turnes out CUDA cannot be installed for some retarded reason.
With Nvidia GPU the screens on my two monitors are swapping every time I use a hdmi switch to use other computer. On AMD GPU this problem does not exist. AMD GPU pro drivers are impossible to install. Computers barely fucking work, change my mind. Shit is breaking all the time. Everything is so half assed.
The music player that i use sometimes swaps ui with whatever was below it like for example the desktop background and i need to kill the process and start again to use the program. WTF.
Bluetooth seems to hate me. I check the bluetooth connected devices on my computer, it says headphones connected. BULLSHIT. The headphones are fucking turned OFF. How the fuck can they be connected you dumbass motherfucker computer. So I turn on the headphones. And I cannot connect them since the system thinks that they are already connected. So I have to unpair them and pair them again. WTF. Who fucking invents this bullshit?
Let's say i have headphones connected to the computer. I want to connect them to phone. I click connect from the phone settings. Nothing happens. Bullshit non telling error "could not connect". So I have to unpair from computer to pair to phone. Which takes fucking minutes, because reasons. VERY fucking convenient technology.
The stupid bluetooth headphones have a loud EARRAPE voice when turning them on "POWER ON!!! PAIRING", "CONNECTED", "DISCONNECT". Loudness of this cannot be modified. The 3 navigation buttons are fucking unrecognizable so i always take few seconds to make sure i click the correct button.
Fucking keyboard sometimes forgets that I remapped esc key to caps lock and then both keys don't work so i need to reconnect the keyboard cable. At least it's not fucking bluetooth.
The only reason why hdmi switches exist is because monitor's navigation menus have terrible ui and/or infrared activated, non-mechanical buttons.
Imagine the world where monitors have a button for each of it's inputs. I click hdmi button it switches it's input to hdmi. I click display port button - it switches to display port. But nooo, you have to go through the OSD menu.
My ~ directory has hundred of files that I never put there. Doesn't feel like home, more like a crackhead crib.
My other laptop (also tumbleweed) I click on hibernate option and it shuts down. WTF. Or sometimes I open the lid and screen is black and when i click keyboard nothing happens so i have to hold power button and restart.
We've been having computers for 20 + years and they still are slow, unreliable and barely working.
Is there a cure? I'm starting to think the reason why everything is working so shitty and unreliable, is because the foundations are rotten. The systems that we use are built with c, ridden with cryptic abbreviated code, undefined behavior and security vulnerabilities. The more I've written c programs the more convinced I am, that we should have abandoned it for something better long ago. Why haven't we? And honestly what would be better? Everything fucking sucks. The rust seems to be light in the tunnel but I don't know if this is only hype or is it really better. I'm sure it can't be worse than c or c++. Either we do something with the foundations or we're doomed.
16 -
I was given a project to fix and improve a legacy unity VR project I was told was for the oculus rift Now the problems started almost immediately partly stemming from the fact I’ve never used unity before this project was handed to me as my long term TA assignment
And partly from the fact there was no oculus integration in the game at all. it was built for GoogleVr and most of the code the last person wrote consisted of massive sections (25-50 lines) of commented out code and no explanation of what the hell the non-commented parts are supposed to be doing
So long story short. I’m now in a basic unity course, six feet deep in documentation trying to read resources that go way over my head in understanding, and am rebuilding the project from basically scratch (took the assets and saved the c# scripts for reference) and have finally figured out how to at least get the player character constantly moving forward and stream in the WRLD3D environment like the last guy did. Now to get the player character to turn and change direction when the player turns their head with the oculus headset
By the way. WRLD3D is a really cool api thing in my opinion -
Hell, I always thought I was a team player, but is it a great week being the sole developer (all the other on vacation). So I didn't get interrupted all the time, read overblown PR. Still, even in their absence I spent about three days fixing their build issues and PR's, but I could sit down and read the code, some documentation to get a better understanding why it all sucks and what we should do with our pain in the ass build system.
It's really a blast, deleting some stupid code, removing superfluous dependencies and above all leaving snarky remarks in the commit messages and code comments. Just letting some steam off. Code is where my devrant is. -
update : we are at hr round baby!!!
part 1 : https://devrant.com/rants/5528056/...
part 2 (in comments) : https://devrant.com/rants/5550145/...
the tech market is crazy mann! it's one of the top indie fintech companies in our country and has a great valuation.
i totally felt that they i am crashing the interviews , and am seriously not trying to be humble. before the dsa round , i was trying to mug up how insertion sort works 🥲
--------
now my dilemma is should i switch if i get the offer. in a summary:
current company:
- small valuation but profitable (haven't picked funding for last 3 years , so poast valuation is some double digit million $, but can easily be a unicorn company)
- very major b2b player in my country. almost all unicorns (including this fintech company) and some major MNCs are their client and they have recently acquired a few other companies of us and eu too, making them- a decent global player
- meh work : i love being a cutting edge performer in android but here we make sdks that need to support even legacy banking apps. so tech stack is a lot of verbose java and daily routine includes making very minor changes to actual code and more towards adding tests , maintaining wrapper sdks in react/cordova/unity etc, checking client side code etc.
- awesome work life balance : since work is shit and i am fast enough, i am usually working only 2-4 hours a day. i joined gym, got into shape , and have already vsited 5 places in last 6 months, and i am a guy who didn't used to have time even on sundays. here, we get mote paid leaves than what i would usually need.
- learning opportunities: not exactly from the company codebase, but they provide unlimited access to various course learning platforms like linkedin learning, udemy and others, so i joined some web dev baches and i now know decent frontend too. plus those hybrid sdks also give a light context to new things
new company :
- positives : multi billion valuation, one of the top players in fintech , have been mostly profitable ( except a few quarters)
- positive : b2c so its (hopefully) going to put me back into racing shoes with kotlin, jetpack and latest libraries.
- more $$$ for your boy :)
- negetive : they seem to be on hiring spree and am afraid to junp ship after seeing the recent coinbase layoffs. fintech is scary these days
- negetive : if they are hiring people like me, then then they are probably hiring people worse than me 😂. although thats not my concern what my main concer is how they interviewed. they have hired a 3rd party company that takes interviews of people FOR THEM! i find that extremely impolite, like they don't even wanna spare their devs to hire people they are gonna work with. i find this a toxic, robotic culture and if these are the people in there then i would have a terrible time finding some buddy engineer or some helpful senior.
- negetive : most probably a bad wlb : i worked for an year for a fast paced b2c edtech startup. no matter how old these are , b2c are always shipping new stuff and are therefore hectic. i don't like the boredom here but i would miss the free time to workout :(
so ... any thoughts about it?4
