Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Get a devDuck
Rubber duck debugging has never been so cute! Get your favorite coding language devDuck
Buy Now
Search - "flash"
-
Prof: Okay guys, i need a flash drive to put a copy of your next project.
Me: *pulls out a flash drive and sho-..*
Prof: except you, I dont trust you.44 -
The highest data transfer rate today - 256 gigabytes per second - was achieved when the cleaner's vacuum cleaner accidentally sucked the flash drive in from the floor.9
-
Does anyone else have this?
When you flash something onto your android phones and the boot process afterwards takes very long and you start to get veeeeeery nervous 😅28 -
I’ve been inspired by programming many times, but a few early moments really stand out for me. Some of those most memorable early moments came when I developed Flash games with my friend in high school.
Growing up, at this point in time, around 2005, Flash games were really hot. All the kids in my school played games on addictinggames.com during any classes that took place in the computer lab, and when my friend and I started making games, it was our dream to get a game featured on addictinggames.com.
When one of our early games ended up getting featured, we were absolutely ecstatic and I’ll never forget the feeling of seeing our own work on this game website that we loved for years prior and that so manly people at our school used. It was the coolest thing and I think went a long way to encouraging me to continue to want to create things, after seeing the impact we were able to make with a simple game (as two high school students).
And I think that shows the beauty of the internet today and the power people with few resources have to get stuff out there. I think it’s maybe gotten harder as of late since there’s probably more competition, but I also think the audience is ever-growing and I hope many more people get to experience that awesome feeling of having something you worked hard on become popular.14 -
An old client reappeared the other day wanting his Flash website updated to HTML5. He didn't want to pay because "It is exactly the same, just needs to work on tablets.".14
-
A friend called me up today . Here's how the conversation went
Jack :- Hey dude , my computer is lagging way too much . Do you think there's something wrong ? Like Virus ?
Me :- I don't know . What do you think might have caused that ?
Jack:- Oh , I kept my flash drive open without a cover , it might have caught some virus from the air.
Me :-7 -
Dude comes for an interview for a mobile position - one of the first things he says is "Adobe is killing Flash, don't know why, big mistake."7
-
How to secure yourself from flash 0-day attacks:
1. Uninstall flash
2. Don't reinstall flash
3. Seriously, you don't need flash7 -
At middle school they kept on banning the flash game sites so I made one my self but it was called something like mathhomework.somefreehost.com, the landing page looked like a homework site and all the flash games were called something like problem_1.swf. I use to sell logins to class mates at like £2.50.3
-
*Interview*
Interviewer: We have an opening. Are you interested to work?
Me: What is that I'll be doing?
I: What technologies and languages do you know?
Me: I know Scala, Java, Spark, Angular, Typescript, blah blah. What is your tech stack?
I: Any experience working on frontend?
Me: Yes. But what do you use for it?
I: Can you work with databases?
Me: I can, on SQL based. What are yours?
I: Can you do big data processing?
Me: I know Spark, if that's what you are asking for. What is it that you actually do?
I: Any experience in cloud development?
Me: Yes. AWS? Azure? GCP?
I: Do you know CI CD?
Me: Excuse me.. I've been asking a lot of questions but you're not paying attention to what I'm asking. Can you please answer the questions I asked.
I: Yes. Go ahead.
Me: What will be my position?
I: A full stack developer.
Me: What technologies do you use in your project?
I: We use all the latest tech.
Me: Like?
I: All latest tech.
Me: You mentioned big data processing?
I: Yes. Processing data from DB and generating reports.
Me: what do you use for that?
I: Java.
Me: Are you planning to rebuild it using Spark or something and deploy in the cloud?
I: No we're not rebuilding it. Just some additions to the existing.
Me: Then what's with cloud? Why did you ask for that?
I: Just to know if you're familiar.
Me: So I'll be working with Java. Okay. What do you use for UI?
I: Flash
Me: 🙄
I sat for a couple of minutes contemplating life.
I: Are you willing to join?
Me: No. Not at all. Thankyou for the offer.6 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe15 -
Last year I got an Acer notebook from a guy that stated that "it isn't working". "Okay" I thought, let's boot it up.
> Screen turns on, no splash screen, no hard drive activity
> Well fuck
> Tries to enter BIOS, nothing
> Openes case to reset CMOS
> Nothing
> Okay I think I need to flash a new BIOS
> Acer support site
> "Download the exe to flash the BIOS"
> What
> Spend two hours researching
> Find out that you can flash via USB and by pressing a key combination
> Extract the BIOS binary from the exe file
> Flash it on the notebook
> Splash screen and working BIOS
> Yay!!!
> No bootable devices found
> Fuck
> Connects hdd with test bench
> Completely fucking dead
> WTF
> Order a new hard drive
> 3 days later
> Install hdd
> Install Windows
> Finally working
WTF did you do to this notebook to not only mechanically break your hdd but also fuck up the BIOS completely??!!14 -
HBO, the network that owns Game of Thrones, one of the highest grossing and most popular shows, still use Flash for their web streaming service.
I cry in dothraki7 -
Me: "Delete this folder"
Windows: "Oki, done."
Me: "How is it still there, F5. Still there! Hey, you forgot to delete this one file. Fix it."
Windows: "Nope."
Me: "Why?"
Windows: "Requires permissions."
Me: "Eh, it was my file, but here you are, my admin credentials."
Windows: "None shall pass."
Me: "Wtf, this is my computer. Who owns this file?"
Windows: "No one."
Me: "What do you mean? Oh, time for your reboot pills, ms. Wandows."
Windows: "Noooooo... ... ... Welcome."
Me: "Ha, the file is gone. Glorious victory."
Windows: "It's just a flash wound."
Credit for style: https://mobile.twitter.com/cmurator...4 -
A moment of silence for all the USB flash drives that we purchased and have no idea where they are or who did we borrow them to.7
-
Best computer/hacking/tech TV and movies?
I'll start the list with some of my favorites.
1. Hackers
2. The Net
3. Jumpin Jack Flash
4. Antitrust
5. Swordfish
6. Wargames
7. Mr Robot
Anyone else?34 -
>Be me
>Decide to root phone first time without technical knowledge
>Root it and be happy
>Some apps do not work
>@RantSomeWhere and @Condor suggest trying again with MasgisK
>Wait a week until weekend to experiment
>Parents leave for short trip
>Love movies and plan to enjoy over weekend once phone rooted
>Happy.gif
>Go home after work on Friday
>Start rooting
>Soft brick the phone
>@Condor helps
>Download 1.5 GB stock rom
>Download all night and in morning see download corrupted at 97.71%
>Scream.mp3
>Spend four hours downloading
>Flash stock rom
>Phone works and bit relaxed, spend evening with friend
>Start with MagisK on Sunday
>Waste all day while waiting to enjoy movie
>Phone bricked
>Somehow manage to flash custom recovery and root
>Blocked apps work. Be happy
>Remove bloatware. Accidentally remove critically file
>annoying pop-up every 0.5 seconds
>Flash stock rom again
>Spend Monday without phone at office
>Update all night
>Wake up at six on Tuesday and repeat everything
>Works
>Doesn't remove bloatware
>Seeks assistance
>Sleepy and tired af
Now after wasting countless hours and entire weekend, I just need more and more coffee to get through the day. Need to fix everything before parents return tonight.
Also, need help with removing bloatware. Which ones can I remove? I have Default Phone, Message, Sim toolkit, Video app that I replaced with other apps.
So can I remove them? Because I removed phone app and it started throwing 'process.android.phone has stopped' and 'process.android.acore has stopped'. IDK whether it was default phone app or sim toolkit.
Also, which app shall I use?56 -
Upon suggestion of @platypus I went to the cafe and just took my tablet there (unfucking the laptop's rootfs flash drive took too long, and ArduinoDroid's avrdude didn't seem to work very well), so just doing some chatting in IRC and trying to figure out how the hell I'm supposed to make a serial link to a Proxmox VM from the host (thinkstation on the top left pane).
Attached below is the screenshot of that.. much turminel, very h3xx0r! But so far nobody has come up to me calling me "evul h3xx0r" yet.. very intriguing! I expected things to be much worse.
A glass of Duvel in front of me, tastes great! Cheers!19 -
Decided to try and remove everything google from my phone by using a root app uninstaller since my phone runs the stock rom.
Thought it would break my phone and was preparing for a recovery flash...
I now run a stock rom without anything Google 😍
Even signal works fine with a background websocket connection.
Google, unkindly go fuck yourself.27 -
It's a Sunday, playing around with code/servers/config stuffs and decided to give Arch another try! Downloaded Apricity OS (Yes, I still love beautiful interfaces I don't have to fully configure), realized I didn't have any spare discs so went looking for a USB flash drive.
Seriously. Those FUCKERS are always around when you don't need them.
But ohhhhh, the FUCKING SECOND YOU NEED THEM, THEY ARE NO-FUCKING-WHERE TO BE MOTHERFUCKING FOUND.
Well, there goes my FUCKING plans for today.16 -
We recently signed a huge deal with a big, very known vendor. I asked if they had a web interface to the software. Of course, they said, and gave us a link. I clicked the link and was asked to install java. Turns out the web version is just the desktop version wrapped in a Java applet. The applet didn't do well with openjdk, so they asked me to file a support ticket. They gave me another link. The service desk required shockwave flash.6
-
Me and a junior coder are working on a project. However, he likes to think he's funny and say "Ok google" to stop me from using my phone.
He said "Ok google, search midget porn" when I was calling my mom so naturally I need to get back at him, so when he's in the rec room, I backed up all his code on my flash drive, and copied it to the clipboard, and removed all project files from his computer.
He came back while I was in the bathroom, and when I reentered the room and was balling his eyes out, that his project was gone. I said to him, don't ok google me again and I handed him the flash drive back. He has never done anything bad again.12 -
Teacher: Computer settings are stored in the ROM on the motherboard.
Me: *internally* Uhm, yea, sure... and I am the pope
Me: Sorry to interrupt you but how come the BIOS settings get reset when the CMOS battery is pulled out or dies if they are stored in ROM?
Teacher: ....
Me: *internally* yea, that's what I thought, you have no clue what you are even saying - the BIOS is stored in ROM or flash memory while the settings are stored in NVRAM also called CMOS memory...10 -
Once had a classmate schedule a meeting with me to "go over something" for a project we had together. (Not a CS class, but it was a general education class.)
I agree, make time on my schedule for this meeting.
I get there and they say "Yo I just wanted to let you use my flash drive so you could make some changes to the PowerPoint I started last night. Just get it back to me a few days before the project is due and we'll look over it together."
You asshole. Go fuck yourself.
This lesson taught me to ask what meetings are about in order to prevent this bullshit2 -
STOP using Adobe flash motherfuckers
It's annoying, it's unsupported, and it's shit. Stop.
I have to do homework on a site that uses flash simply to make time wasting and fucking worthless animations on text. How about instead of giving me a paragraph and making me wait for 2 seconds before the next page of shit loads, you just put it all on one fucking page. And yes, this applies to every other site with this shitty design. Just. Give. It. All. At. Once. AND STOP USING FLASH12 -
Being a techie surrounded by "normal" people is like a torment you didn't ask for. I just watched someone copy a whole folder of images to their flash drive.
File by file.
Without keyboard shortcuts.
In one explorer window.
Select, copy, navigate to flash drive, paste, navigate to folder, repeat.8 -
So this happened a few days ago. I always want to root my smartphones for that little bit more control.
*Put's new smartphone into fastboot mode*
*Tries to flash root zip onto it*
"You have to OEM unlock the bootloader first"
*OEM unlocks the bootloader*
*Tries to flash but fails*
*Tries to reboot*
Phone: "The bootloader has been tampered with, the device will boot in 5 seconds".
*Screen just hangs there for ages*
FUCK.
*Tries to enter fastboot again to OEM re-lock the bootloader*
*Fastboot appears to startup RIGHT AFTER THE FUCKING ERROR MESSAGE so can't boot into that anymore*.
FUCKING FUCK.
Hmm... TWRP is still installed...
*Tries to flash some stuff through TWRP*
"The zip file you are trying to flash is corrupt".
FUCK MY FUCKING LIFE.
*Connects phone to Linux for adb flashing*
*Nothing happens after half an hour of trying*
*Connects phone to ancient windows 7 laptop*
*Laptop doesn't even RECOGNISE the phone although all drivers are installed*.
*Le me about to completely lose my fucking mind*
*Connects phone desperately with Linux again*
*Phone is recognised right away but the SPL flash tool can't detect it*
*Tries to put it into fastboot again*
*Fails for about an hour*
*phone in charging mode again*
*Presses the power button for a last, desperate attempt*
*SPL flash suddenly recognises the phone*
FLASHING
FLASHING
FLASHING
DONE.
*Android boots again like nothing happened*
I can use it again like normal but the No-Root firewall is draining my battery like crazy.
That was one hell of a journey though!10 -
Downloaded Kubuntu because i couldn't seen to be able to boot from a freshly created KDE Neon bootable usb.
Installed it onto my netbook (Lenovo Thinkpad X121E) and it worked great!
But just the fact that somehow the installer froze when trying to setup hdd encryption kept bugging me.
Took a random flash drive which was laying around and put it in to see what would happen. KDE Neon booted just like this and everything worked very well with hdd encryption.
I now have a very secure netbook 😊15 -
Job title :
"PHP and MySQL Programmer"
Job description :
"We are looking for a Flash Developer with a high level of proficiency developing ActionScript solutions.... bla bla Development in a 2D and 3D environment"
doesnt say ANYWHERE what is require to know in php nor mysql
EDIT: actually it does but why would they put php and mysql programmer if thats not the main things they are looking for6 -
We had to learn flash and actionscript because it is the future of the Internet! That was only 2 years ago. Apparently that teacher also added silverlight after I graduated...1
-
Found my missing flash drive... at the bottom of my broken washing machine... *sigh*
So I've got a broken Windows installation, destroyed flash drive and a washing machine that decided to explode and trip all circuit breakers in the building... what's next?25 -
I soldered a flash chip onto a game boy cartridge and made my own game boy games for a while. If i had time, i would love to experiment with making Atari 2600 cartridges. The programmers that made those games were so badass that they could print the entire assembly source on a poster at font sizes that were easily readable because there was so little code for such a complex program. Now that takes genius. Always wanted to try my hand at it.13
-
So I have a 4 GB USB flash drive (which is fucked, dead sectors everywhere). But I want to use it to copy small files and whatnot.
Genius idea, so I have a program which tells me which of those sectors are dead.
And all I need to do is to write an algorithm that will use that data to determine the largest block of working sectors. After running it (turns out largest alive is 49 MiB) I made a partition between those sectors and formatted the drive...
And lord and behold, the data didn't get corrupted for now atleast.14 -
I just flashed BIOS on my server. I don't own a UPS, and i was only using 1 of the 2 PSU's since i couldn't find a second power cord.
Without a doubt the scariest 30 seconds I've ever experienced while working with IT1 -
*wondered for 4 years how a bootloop looks like*
Nexus: yOU wAnE kNoW wHaT a BoOtLoOp LoOkS LiKe?!
*bootloops itself to shit*
Well I guess that I know what I'll be doing tonight then. Flash that new StatixOS build because the phone shat itself.
*tries to reflash the recovery*
*still bootloops*
*tries to flash the stock OS*
*still fucking bootloops*
*finds a post on XDA saying something about fucked big cores that need to be disabled*
Fucking piece of junk. So not only the battery is shit, but also the CPU is shit, huh. Certified pieces of shit.
*flashes the patched boot.img that disables the big cores*
*phone loads Google logo.. good*
*BOOTLOOPS FUCKING AGAIN*
MJHUIETHNIUBESZPTUIBG ESVGU d
FUCK!!! Fuck you Google, fuck you Nexus, fuck you Huawei, HOW DIFFICULT CAN IT BE TO DESIGN A FUCKING PHONE?!!!
So yeah. Looking for suggestions for a new phone. Anything of which the kernel source is released and of which the battery is halfway decent (unlike this fucking piece of shit) should do.8 -
"When we have clients who are thinking about Flash splash pages, we tell them to go to their local supermarket and bring a mime with them. Have the mime stand in front of the supermarket, and, as each customer tries to enter, do a little show that lasts two minutes, welcoming them to the supermarket and trying to explain the bread is on aisle six and milk is on sale today." - Jared Spool2
-
Wohoo! Adobe kills flash in 2020 👍
"Adobe chose to end Flash because it believes coding technologies like HTML5, WebGL, and WebAssembly "
http://fortune.com/2017/07/...3 -
"To use the clock you need Adobe Flash"
Really 1&1? You really need flash to show a fucking clock? Its not that hard to do this in javascript, or? Even if it is an analog clock :D There is even a tutorial of the "quality content page" w3schools about implementing this in javascript ... just whyyyyyyy? it 2018, not 2004.
(1&1 is an german ISP. This message occured in their webmailer using it without flash.)7 -
When working in embedded, you basically write your program, compile it and flash it on some hardware.
Compiling and flashing usually require some black magic commands with lots of parameters so i set up two shortcuts in my terminal
yolo to compile
swag to flash
Understandably i keep it to myself2 -
The moment you flash new ROM and the question is. Will alarm work or will i be late to school again and have to explain teachet that i totally fucked up and sound doesnt work or that time was wrong.
Lets find out !9 -
Raspberry pi worked perfectly fine. Reinstalled the sd card for some reason (on purpose) and now, no matter what system I flash, it always crashes at stone point. That point is random every fucking time.
I just want this fucker to work 😥20 -
Adobe will end-of-life Flash by 2020, and all big Browsers are joining this by disabling Flash features slowly
Let's make a petition to end-of-life Electron, it is basically Flash for Desktops and it is A RESOURCE-HUNGRY LAZINESS-PROMOTING PIECE OF SHIT THAT SHOULD IMMEDIATELY BE REMOVED FROM THIS VERY PLAnet.. what do you think about that particular idea?
#StopElectron2017smhOkayAtLeastBy2020Please22 -
Good bye Intel, and your AMT, secure boot, and other assorted items engineered to restrict user freedom, hello PowerPC. Today, working on firmware flash for my new Radeon card to get it working in my powermac G5 quad.
Picture: nothing quite like a fresh manual bootstrap of Debian.16 -
deadmau5 exclusive on tidal streaming.
Fuck, okay.
*Sign up*
>> enters email, password
>> redirect to different signup page
>> enters email, password
>> redirect to original signup page
>> ????
>> enters email, password
>> redirect to second signup page again
>> ????????????
>> try to login
>> enters email, password
>> nope
>> listen to preview of album
>> please enable flash
>> okay, fuck you, deadmau5.9 -
I've managed to design, source parts, solder together and flash a firmware to produce a custom numeric keypad.
I've also managed to put up two curtain poles and cook a nice meal.
I am a proper adult.6 -
Dear IT,
STOP FUCKING RESETTING SERVERS AT 9PM AT NIGHT, WHEN DEV PRODUCTIVITY IS AT IT'S EPITOME!!!!
DO YOU EVEN FUXKING UNDERSTAND THAT IT TAKES 20 MINUTES TO GET ALL THE SERVICES BACK FUCKING UP? ALL THE FOCUS BUILT UP, GONE IN A FLASH BECAUSE YOU COULDN'T KEEP IT IN YOUR PANTS TILL LATER.
sincerely,
mahaDev,
mind-fucked software engineer.4 -
I found and bought this floppy disk in an old supermarket. This brings back my memories where flash drive are so expensive I can only afford to buy multiple floppy disk.3
-
Employer: I want to make a search engine but only for our products.
Me: Sure. It's called an eshop.
Employer: You know that eshops are not engines right?
Me: Technology has changed the past few years. (hidden irony)
Employer: I guess that's geeky stuff. Tell me more about this.
Me: First, you need to upgrade your flash eshop.
Employer: (frustrated) You IT people always want to do things your way, aren't you? Nevermind, let's get to business, how can I make my site better?1 -
I seriously wanna fucking knofe this guy who says JS is shit and Kotlin is superior well NEWS FLASH YOU FLYING PIECE OF WANK, every fucking language has its pros and cons
If you still think JS is supposed to be in browser well I say to you fucktard this isnt the 80s anymore and we ain't using Java applets and Flash for some limp dicked stuff JS has covered today. A language might have its dark sides but they are all fucking good. There is no superiour language there's only Mother fucking preference. I swear to god this is the worse limp dicked argument I've heard and I have to argue that JS has matured over the years11 -
LPT: If you use Linux, always carry another one in your pocket (flash drive) in case you'd need to fix your main one after you kill it again7
-
https://blogs.adobe.com/conversatio...
Adobe Flash Player will officially die in 2020.
No more updates. If there'is a security bug, it remain.48 -
I once had a flash usb stick which i tried to rename to "/dev/null" just for the lols
Just to see the face of newbies as i pull files out of /dev/null 😂😂3 -
This, my friends, is a very common virus in Turkey called "Musallat" (which is just a tiny program that hides all of your data in your flash drive inside a hidden folder that has a blank name, and forces you to click it's shortcut to infect all other drives thag plugged in your pc) being clicked by my dumb ass friend eventhough I told everyone to not click the .lnk if they see it.
I am so fucking mad right now.7 -
On my first year of high school made a flash webpage for my class. It is still online.
...
Too embarrassed to share link.8 -
At my previous job we had to complete an online security training exercise. It shows you how to behave secure in the work place, to not open unknown links etc. The scary part was that the entire training thing was BUILT IN FUCKING FLASH. So I'm suppose to listen to some god damn virus shitting flash application on how to do online security?! Get your shit together before teaching others.5
-
TMUX. The best thing EVER.
These days I can go around with my trusty 64GB USB3.0 flash drive, boot Linux off it, and use the VT to start Tmux.
Window 0: Editing
Window 1: Build testing
Window 2: CMakeLists.txt editing
Window 3: Web (Lynx!)
Window 4: Research (Manpages and Info)
Window 5: Music (CMus!)
I can launch the whole thing with a quick script. I don't even need to open the GUI. Everything is accessible from the VT.1 -
Got an offer to work at a game development company. Office looked awesome (decked out in pinball machines and a huge marble track), located overlooking Schreveningen beach, young energetic team.
Then I saw the code. Oh God the code. And they wanted me to become system architect.
Hybrid PHP 4/5 OOP/procedural code custom framework running on a spaghetti database creaking by on the skin of its teeth... all backing Flash Facebook games.
Nope.5 -
Oh fucking Huawei.
Fuck you.
Inventory:
- Honor 6x (BLN-L22C675)
- Has EMUI4.1 Marshmallow
- Cousin brother 'A' (has bricking XP!)
- Uncle 'K'
- Has Mac with Windows VM
Goal:
- Stock as LineageOS / AOSP
Procedure (fucking seriously):
- Find XDA link to root H6X
- Go to Huawei page and fill out form
- Receive and use bootloader code
- Find latest TWRP
- Flash latest TWRP
- TWRP not working? Bootloops
- XDA search "H6X boot to recovery"
- Find and try modded TWRP
- TWRP fails, no bootloop
- Find & flash TWRP 3.1.0
- Yay! TWRP works
- Find and download LineageOS and SuperSU
- Flash via TWRP
- Yay! Success.
- Attempt boot
- Boot fails. No idea why
- Go back to TWRP
- TWRP gives shitload of errors
"cannot mount /data, storage etc."
- Feel fucked up
- Notice that userdata partition exists,
but FSTAB doesn't take
- Remembers SuperSU modded boot
image and FSTABS!
- Fuck SuperSU
- Attempt to mod boot image
- Doesn't work (modded successfully
but no change)
- Discover Huawei DLOAD
Installer for "UPDATE.APP" OTAs
Note: Each full OTA is 2+ GB zipped
- Find, download, fail on 4+ OTAs
- Discover "UPDATE.APP Extractor"
Runs on Windows
Note: UPDATE.APP custom format
Different per H6X model
- Uses 'K''s VM to test
- My H6X model does not have
a predefined format
- Process to get format requires
TWRP, which is not working
- FAIL HERE
- Discover "Firmware Finder"
Windows app to find Huawei
firmwares
- Tries 'K''s VM
- Fails with 1 OTA
- Downloads another firmware ZIP
- Unzips and tries to use OTA
- Works?!
- Boots successfully?!
- Seems to have EMUI 5.0 Nougat
- Downloads, flashes TWRP
- TWRP not working AGAIN?
- Go back to XDA page
- Find that TWRP on EMUI 5 - NO
- Find rollbacks for EMUI5 -> EMUI4
- Test, fail 2-4 times (Massive OTAs)
- DLOAD accepts this one?!!!
- I HAVE ORIG AGAIN!!!
- Re-unlock and reflash TWRP
- Realise that ROMs aren't working on
EMUI 4.1; Find TWRPs for EMUI5
- Find and fail with 2-3 OTAs
Note: Had removed old OTAs for
space on Chromebook (32GB)
- In anger, flash one with TWRP
instead of DLOAD (which checks
compatability)
- Works! Same wasn't working with
DLOAD
- Find and flash a custom TWRP
as old one still exists (not wiped in
flash)
- Try flashing LineageOS
- LineageOS stuck in boot
- Try flashing AOSP
- Same
- Try flashing Resurruction Remix
- Same
- Realise that need stock EMUI5
vendor
- Realise that the firmware I installed
wasn't for my device so not working
- FUCK NO MORE LARGE DLs
- Try another custom TWRP
- Begin getting '/cust mounting' errs
- Try reflashing EMUI5 with TWRP
- Doesn't work
- Try DLOADing EMUI5
- Like before, incompatability
- DLOAD EMUI4
- Reunlock and reflash TWRP
- WRITE THIS AS A BREAK
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAARRRRRRRRRRRRRRRRRRRRRRRRGGGGGGGGGGGGGGGGGGGGGGGGGHHHHHHHHHHHHHH11 -
My relative once called me and asked if she could come over to my house so that I can copy Facebook over to his flash drive. Turns out that she accidentally deleted the bookmark to facebook.com and thought that she'd lost it forever.
This is want happens to you when all of your relatives found out that you are "good with tech".3 -
What I should do:
- organise my files
- make a pp presentation for English that I haven't even started
- learn for a test about insurances
- learn about characterising, processing and evaluating data
- more shit
What I do:
- browse devrant
- play games
- flash a new ROM until I find a good one
- restore a backup
- flash another ROM
- restore a backup
- go with the least worst ROM I had installed
- sleep
- sleep
- sleep
- sleep
- FUCKING SLEEP
At least I completely blocked YouTube...undefined android time waster fuck this shit list tasks sleep wasted time wasted time management rom school6 -
Yes, today storage memory is "cheap".
But 100MB for an image flash tool
Wtf!?!
An arch iso is 600MB
Rufus on windows is ~1MB9 -
MAD scientist time! Can the USB type C port on Nvidia RTX tuning card used as a standard USB port? Eg charging your phone, or read USB flash drive🤔55
-
Tutorials w examples that don't even work. Would run into these all the time back in my Flash days, so frustrating.2
-
Flash has made Java programs look desirable. And anyone keeping up with me knows I despise Java and C#, despite having written C# and currently working on deciphering a Java server to create documentation.
Before I begin, I want to make this clear: IT IS TWO THOUSAND AND FUCKING EIGHTEEN. 2018. WE HAVE BETTER TECH. JAVASCRIPT HAS TAKEN OVER THIS BITCH. So, firstly, FUCK FLASH. Seriously, that shit's a security liability. If you work for a company that uses it, find a new job and then fucking quit, or go mutany and get several devs to begin a JS-based implementation that has the same functionality. There is no excuse. "I'm fired?" That's not an excuse - if there is a way to stop the madness, then fucking hit the brakes on that shit or begin job hunting. Oh, and all you PMs who are reading this and have mandated or helped someone else to mandate work on an enterprise flash program, FUCK YOU. You are part of the problem.
The reason for this outburst seems unreasonable until you realize the hell I went through today. At my University, there is a basic entry-level psychology course I'm taking. Pearson, a company I already fucking hate for some of the ethically sketchy shit they pulled with PARCC as well as overreach in publishing to the point they produce state tests here in the US - has a product called "My PsychLab" and from here on out, I'm referring to it as MPL. MPL has an issue - it is entirely fucking Flash. Homework assignments, the textbook, FUCKING EVERYTHING. So, because of that, you need to waste time finding a browser that works. Now let me remind all of you that just because something SHOULD WORK does NOT mean that it actually does.
I'm sitting on my Antergos box a few days ago: Chromium and Firefox won't load Flash. I don't know why, and don't care to find out. NPAPI and whatnot are deprecated but should still run in a limited mode or some shit. No go on Antergos.
So, today I went to the lab in the desolated basement of an old building which is where it's usually empty except a student hired by the university to make sure nobody fucks things up. I decided - because y'all know I fuckin' hate this - to try Windows. No go in Chrome still - it loaded Flash but couldn't download the content. So I tried Firefox - which worked. My hopes were up, but not too long - because there was no way to input. The window had buttons and shit - but they were COMPLETELY UNRESPONSIVE.
So the homework is also Flash-based. It's all due by 1/31/18 - FOUR CHAPTERS AND THE ACCOMPANYING HOMEWORK - which I believe is Tuesday, and the University bookstore is closed both Saturday and Sunday. No way to get a physical copy of the book. And I have other classes - this isn't the only one.
Also, the copyright on the program was 2017 - so whoever modded or maintained that Flash code - FUCK YOU AND THE IRRESPONSIBLE SHIT YOUR TEAM PULLED. FUCK THE SUPERIORS MAKING DECISIONS AS WELL. Yeah, you guys have deadlines? So do the end users, and when you have to jump through hoops only to realize you're fucked? That's a failure of management and a failure of a product.
How many people are gonna hate me for this? Haters gonna hate, and I'm past the point of caring.7 -
I was once requested to update a website and the requirements were that it "must be flash based...and use our company's color scheme."
I saw the current site and critiqued the color before knowing that the color was the company's signature and had to be there. The colors were a pukish yellow like someone pissed all over the site and that color was everywhere. I said that site looked like something from 1998 and flash was not the way to go.
They wouldn't hear any of that. No need to mention I didn't take that job. -
!rant I'm beginning my nerd project of getting my IBM 5150 to the internet via my raspberry pi and a terminal emulator. Oh and the IBM has a 4gb (yes gigabytes) HDD in the form of a compact flash.
The pi is a model B. Even as an older pi, look at the difference in size versus performance!
The 5150 is 4.77 mhz
The Pi is 900mhz12 -
I know we're trying to stay away from Flash. I've heard that most browsers these days support cookies. Could you work it into a "cookie applet?"1
-
I just wanted to watch that video! who on EARTH still uses adobe flash player! seriously can anyone tell me?8
-
Me trying to get an edge in Bloodborne be like,
Spent the whole afternoon figuring out what to do with all the hex values in the save game file.
I'm too lazy to grind out blood echoes (in game equivalent of money, for those who don't know), not that I had any difficulties with it (all those times playing monster hunter finally paid off).
*copy saves to flash drive
*open in hex editor
*find current amount of blood echoes in hex value
.....1109 instances found
*tries to find a pattern
*tries to change the value in the game hoping it would reduce the search
*repeat until evening5 -
Today we got a company announcement saying "Our time management tool got updated."
..still uses Flash Player.
For god's sake how is this even possible. Who did this?!2 -
Had to use a cmd window for adb to push some files to my phone so I could flash them and everyone is staring at me...
It's just a cmd window people... #Hackerman4 -
Typical interaction in any XDA development thread:
User: How do I put these ROMs on my phone? Plz halp!
Me: ROOT -> flash RECOVERY -> enter recovery -> flash ROM -> flash Gapps -> profit.
User: How to get the roots? Can halp me?
Me: You're in a Nexus forum. There are directions on how to root everywhere.
User: I can't find. Plz halp.
Me: Fastboot oem unlock, fastboot flash recovery.img, flash SuperSU, flash ROM...
User: Where I can get fastboot?
Me: *link to Google developer's page*
User: Can you just tell me?
Me: No, you need to figure it out, so you know what you're doing.
*2 hours later*
User: HALP! I use toolkit for to get roots, and now phone won't come on! How to fix?! Halp, halp, halp!
*5 minutes later*
User: bump
Me: Looooooool12 -
When I got my Raspberry Pi a couple of years ago, I had all these grandiose ideas of what I wanted to do with it. So far, all I've done is get it to flash my lights when my dryer's done.6
-
While trying to install OpenSUSE on my home server, something has gone wrong...
I appear to have installed OpenSUSE onto the flash drive plugged into my server instead... 😐10 -
I DID IT!!! just fucking installed lineage os <3 never imagined that it could be so complicated... they really don't want you to flash your phone man. I guess the main problem was that my phone is old x)
So I'm trying to get a clean and free environment, any advice about applications? My biggest problem is with telegram, I'll try wire, bit there is anything else that can replace telegram and on android and Linux? I mean I need to keep conversations sync, and I won't use a Chrome application TT so no signal.41 -
I work in a corporate, and we are required to complete 10 hours worth of training every quarter. Systems don't have admin rights and we can't install anything on our own.
This is what I mailed to the coordinator after to and fro of a few mails. He initially suggested clearing browser cache, when it didn't work, I raised an IT ticket to get it updated. Didn't fuckin work.
Damn you, you hippo fucking imbeciles. I mean who the fuck in their right state of mind would have the audacity to recommend using flash. Absolute cunts ☠ 👿1 -
Now that the Phone has a custom rom with root, with only a little issue with some split screen nonsense I'm finally ready to use my phone like a normal ph- OH MY GOD WHAT IS THIS? WHERE THE HELL ARE MY BLOBS? WHAT THE FUUCK!?
Good thing that I rooted with Magisk and I could flash the blobs https://forum.xda-developers.com/ap...9 -
!wk119_compliant
Sadly I don't have an nice view in a less than 20km range from my place. so this is the indoor.
FLASH ON View:1 -
Motherfuck! God I hate xcode worst development environment ever conceived! Have to update it right now to be able to push to my device. Fucking appstore is the worst program ever. How about telling your users what the fuck is going on instead of just sitting there displaying a flash load circle. Gaaaaaahhh I wanted to go home 2 hours ago. Fuck you apple and all you stand for may you rot in the deepest crevices of he'll for all eternity! Fuuuuuck8
-
Nothing like taking a company IT security training that requires Flash.
The first step to be able to run the training?
Override your browser's security setting to allow Flash to be able to run.
Anyone else see the irony here?1 -
Bad things:
1. Windows or any Microsoft implementation of anything
2. C#
3. Systemd
4. Docker
5. Any window manager that takes up more than 100mb of ram
6. Internet service providers
7. JS or any client side browser code
8. Flash
9. Chrome or any browser that is not Firefox or another Netscape derivative. Some notable exceptions like lynx.
10. PayPal
11. Facebook/google botnet
12. Proprietary text editors or any text editor that is not vim or emacs.
13. Users who don't stand for their principals
These bad things are bad. You must not use bad things. Because they are bad. Don't use bad things.97 -
Just flashed a clean marshmallow kdz on my phone, finally running smooth after months of me raging at my phone. Hopefully I will start getting devRant push notifications now!2
-
!(!(!(!(!(!(!(!rant)))))))
My new HTC smartphone hates me.
First it started to shut down all of the sudden yesterday night, when I was solving quadratic equations on my laptop.
I thought that it might be due to low battery. So I have restarted it. After putting itself into a bootloop for 4 start sequences, it was able to fully start to the page where it told me to enter the security pin to decrypt my files. I also had 30 attempts left. Like a ransomware.
I was like "tf I didn't set anything up".
So I decided to use my first attempt as I had 30 attempts left.
I entered the pin (I can swear that it's correct) and it told me that it has to wipe the /data partition.
I did that. I pressed that button. After waiting for 30 minutes I gave up and rebooted into the bootloader.
Bootloader -> Download Mode -> wipe /data (stock rom + stock recovery btw.)
Some error with "e: mount /cache failed[...]e: mount /data failed"
So, I tried using the adb sideload - no success.
Fastbooted into RUU Mode - HTC keeps rebooting itself into the RUU Mode - no success
Tried to flash the firmware and twrp recovery from Download mode - no success
Then I tried to flash all these things from the sd card - no success
Searched for revolutionary (I know this from my old HTC sensation device).
It wasn't big of any help.
Then someone on xda recommended htcDev (htc's <b>developer-friendly</b> lol site)
I followed every step. Everything seemed to be okay.
I got to the last step.
I needed to get my encrypted token by entering "fastboot oem get_identifier_token" to be able to submit it to HTC, and after they would send me an e-Mail with an .bin file that would let me unlock the bootloader to be able to flash my way through all this headache giving fucking piece of dog shit!
But since I can't back to the phone settings to select the bootloader activation box that would let me get my token... but nah.
FML
------------
Sent by using the devRant web app (:\)8 -
In school we got asked 4 our future jobs. I saif: im gonna get informatician, because im already really good at it... Look, i can evem build compilers... In the break, my friend: could u program a game, dude? Me: no, im not using a graphical environnement. If i wanted to i would have to learn unity or flash or some sort of game engine He: then, ur not an informatician, and u shouldnt get one either...
(hes a windows user)3 -
Operation PiBM 5150 XT is continuing this morning!
Raspberry Pi B+ 900mhz
Raspbian Pixel Linux
LG 21:9 2560x1080 monitor
HDMI cable
/boot/config.txt updated for 21:9 monitor
Nyko PS3 USB Compact Flash / SD Reader
4gb CF card as HDD in 5150
4.77mhz IBM 5150 in like new condition
CGA Graphics and Monitor
Late 2012 Macbook Pro
HyperTerm app
USB to DB/25 (RS-232) serial adapter
Devrant Sticker5 -
There are users that copy shortcut from their desktop somewhere to make a backup. We laugh at them. I just copied symlink to my flash drive and realized it only when I copied it back to different computer and target didn't existed.1
-
o2 business login. The whole interface is built in flash. Fucking Flash! Can't even login! No fallback. WTF!!! Useless piece of shit bastards.1
-
Joined a new project and started messing with the application...Greeted with a blank web page and a pop-up **please enable flash**2
-
Still can't stream videos absolutely smooth on Fedora. Tried Chromium, Firefox and every fckin' plug-in they keep asking for. Half the stuff either just keeps loading or buffering. And the moment I give up and switch to Windows, everything just works. Why are we not building better stuff on linux? *Sigh*11
-
Does anybody else's devRant flash open the closed then open again when they press the app icon on Android?11
-
Once upon a time, an IT major named adamyeti thought it was a good idea to work on projects directly off of a flash drive with no backup. Halfway through a large ASP.NET project, the drive failed. I fumbled through a free drive recovery tool, but all of the data was scrambled and corrupted.
I ended up having to start from scratch on the project, but I learned my lesson for sure.1 -
Using netbeans for Java at school is very annoying, I'm about to either go to tech department at school and be like ayyo could you install something like sublime/vscode or just bring in my own copy on a flash drive
Edit:I duck at spelling11 -
When I used Windows and I needed to flash a rom I had to download minimal adb and fastboot package to use adb and fastboot.
I am using Manjaro now so I thought there must be a minimal package. Searched on pacman and android-tools is already installed and it's just a 2mb package. I love linux 😁8 -
Attended a webinar today, about "modern javascript". Missed half of it due to technical difficulties, the main issue being that they used Flash for the webinar...Yes, Flash! What a very modern technology to use for a webinar with the word "modern" in it...Not!3
-
Ignore the code I know it's really basic but I didn't have my flash drive that has all my projects on it so enjoy the meme10
-
Why in the world are there still flash exploits occurring in 2018, these should have stopped occurring 10 years ago7
-
When the marketing exec rings to tell you that they are making a new site for the company...in Wix and that they need to use flash for the "animations".3
-
Major WTF moment today, leading to me nuking my phone and restarting (possibly with a ROM).
So here I am working, with my android smartphone in my pocket, screen on the inside. Get in the house, see my flash through the pocket. Hm, interesting. My phone seemingly unlocked itself (fingerprint locked), then went nuts.
It pulled down my quick settings and turned on the flash. It also opened up 5 different apps, minimized one (how?), opened up multi-window view and navigated through the open apps, and texted four people. Sent one gibberish message to one person, had pictures queued up to send to two others, and spammed the hell out of another. They were getting super pissed, just receiving message after message of shit.
How the fuck does this even happen?! I literally have settings enabled that don't let it turn on when it's in a dark place. I physically lock it every time I'm done. WTF. How am I supposed to trust it with important information if it can't even lock properly?
I've had this thing literally open right up without any password or anything before. And businesses rely on these being fucking secure. What the hell.
I'm nuking this thing tonight. Fuck.2 -
took me 20min to realize why windows wasn't recognising my flash drive:
it wasn't the usb stick I plugged in but the mouse's dongle... stupid me😜 -
Fucking hell with the new android Pie. Build OK but nooooooooo why would it even flash normally right ? NOOOOOOOOOOO you have to edit the fucking script to make it flash properly even. Then once its flashed then it reboots on start because why the fuck not right ? Not even bootanimation. Just reboot right after kernel screen. OK keymaster needs to be deleted from manifest as it seems.
FFS i now hope that it boots up now because i just spent 1 fucking day on this function and i dont want to spend more on it. AHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH.
But as i know it more rant will be coming very soon.
Fucking hell1 -
System Programmer Saga
I'm an old phone operating system programmer. We had to flash ROMs every time. You Android kids don't know how good you have it. Get off my lawn!3 -
it was my first job as an embedded engineer i was hired to write firmware for arm microcontroller that has ble radio. But the microcontroller we used didn't have FLASH it had a SRAM and an otp ( one time programmable) memory. In ble you can make a proximity beacon and When a phone passes by this beacon it will get a notification '<device_name> nearby'
. I thought it is funny if i keep device name 'MILF' (original name of device is FLIP ) so when somebody's phone is in proximity it will have a notification 'MILF nearby'. joke didn't work as nobody has their bluetooth switched on by default ,but i forgot to change it before programming otp memory.
i just buried that device and told everyone it is not working properly1 -
Does anybudy still use Adobe Animate/Flash for web animations?
They teach it at my school and at the moment I see no reason to use it. I'm probaly faster writing it by hand in CSS / JS, and it will run smoother that the animate files...6 -
!rant
when I first heard about "Ruby on Rails" I thought it to be a flash game from a miniclip like developer 😂(similar to this https://play.google.com/store/apps/...)2 -
I was flash developer once, it was great when macromedia was around, then adobe acquired them, now flash is gone.
Years are passing and most of industry is the same as always. Trying to drag you into this rat race of learning new amazing technologies, amazing projects that are actually doing same job as 50 years ago but using more memory and cpu cycles. Because all has it’s roots in algorithms from previous centuries.
So youngsters loose your best life time, be innovative by doing nothing more then copy paste from stackoverflow and duck typing shitty code.
Be a slave and sit in the amazing office, that has everything but not your real life that meanwhile is sucked by corporate squeezer till your last breath.
Be piece of shit that can be kicked around.
Watch youtube, facebook, instagram or whatever social network that shows you pictures that are fooling your mind that you’re someone special and you need this stuff.
Then be ready to suck some dicks to earn money and buy stuff you don’t need, live where you don’t want and do what you don’t like. You piece of shit.
Well that’s what disappoints me from my tech stack.
Now chill out, turn off your electronic gadgets, go out and enjoy real world.2 -
OK explaining how to flash fucking kernel and ROM to idiots that unlocked bootloader just because of fun and now they have bricks because they don't know how to flash kernel back.
Ohhhhhhhh fuuuuuuuuuckkkkkkkk.4 -
Xperia Flashtool? More like Xperia Fucktool. Why? BECAUSE THE FUCKING THING CAN'T FLASH MY PHONE. FIRST YOU SPIT INTO MY FACE WHEN NOT DETECTING A COMPLETELY FINE .FTF, THEN YOU SHIT ON MY HEAD BY SAYING THAT THE .SIN FILE IS INVALID, AND THEN YOU PISS INTO MY MOUTH BY JUST REBOOTING THE DEVICE! Old version works fine tho.4
-
Western Digital, please, for the love of all things holy and not entirely shit, stop making your external hard drives flash a fucking flashlight when they are in "sleep" mode (attached to a sleeping laptop for example). I would like to sleep you beerpissers!6
-
Literally swear I despise flash. So, had a small job to update a page that consisted of a list of members, clicking on a members name will populate an adjacent div with 3 or 4 contact names. Simple stuff on the face of it.
However, it turned out the previous developer had decided to use flash for this, meaning there is a horrible .swf plonked into the page.
I mean seriously, why can't things be simple? :(2 -
Nothing like good old Adobe flash on Windows 2000 to keep air lines on time... Oh wait, what? Their computer system crashed again? Oh well, never mind :(8
-
I just reallized I've done so much photo editing that I made a few tools for it in different apps.
So this morning in a flash of insight, I've made a single app that consolidates them all...
Basically it's just a window that opens all the others by referencing those projects... That was probably the fastest I've ever written an app... other than Hello World.
I can't tell if i am lazy, efficient, or organized... (i couldnt put this in the tag because of the commas)1 -
I'm more of an artist than a developer, myself. One time I went to a camp when I was younger to learn how to create flash games. Even as a kid I wanted to make the game look good, so I animated all my characters from scratch and began teaching the others how to make cover art for the games and how to work Flash. Still making art nowadays. :P
-
My dad bought a book on introduction to Macromedia Flash.
I came for the animations, stayed for the coding. -
Built a beautiful new fancy html5 page for a big event.
PM still wants to use the old flash video player.
Why the fuck ? Just no ...2 -
Linux mint is being a little shit. I can't safely eject my flash drive without "emptying the trash?!!!!" I don't remember if previous versions were more stable. This isn't the first time dumb shit stopped working. Should I install an old version or jump distros?12
-
How the fuck does 860 mb take 20 min to copy? Did my internal SSD revert to IDE mode? Dafuq, Google? I know you're slowing down my machine on purpose so I can just feel how amazing your company is and be in awe that your files take so long to copy that they must be that good.
You must know I'm about to flash your Gapps shit off my phone.5 -
Windows XP,
3D Pinball, MS Paint (the old one), Sim City 2000 and 4, NFS Most Wanted, Underground, HP2, Hamster ball, Worms Armageddon, FireFox (sub 10 versions), Adobe flash games, HQ YouTube (that never worked), HTML4, no JS crapware, 007 sound system - dreamscape, 10 year olds doing tutorials.....
And best of all a single MBit of internet speed.
Do I need to say more?3 -
Created Linux instalation flashdrive on my notebook like thousand times before. Simple dd if=img of=/dev/sdb . Tried installing system from it but somehow doesn't work. And the it hit me. I have both magmetic drive and SSD in my laptop! So insted of flashdrive, I have bootable beging of my SSD where my encrypted lvm used to be :-( Luckilly I lost just EFI, boot, swap, rootfs, few git repositories and ccache.6
-
/** Project that I'm receiving: Pseudo Explanation */
var frontEnd = "Flash";
var backEnd = ".Net";
console.log("Buffering lots of rants...");2 -
I took a bit of a break from devRant because I was way too disgruntled at my current position. Flash forward and I am now a manager at the same company.
Note to new devs:
Make waves, make tons of waves. Get the attention of your superior’s superiors by making things better. Never rely on your superior relaying information, they only have their job security in mind. -
It completely changed the course of my life!
I started learning to code because I was curious how mobile apps works. I blew through my self guided learning and needed more. Flash forward two years and I am working as a web developer! My projects are challenging but I've been learning insanely fast and I can't wait to see where I am two years from now. -
Updating Oxygen OS....
1. WARNING: You will lose root.... OK
2. Fastboot TWRP
3, Install TWRP
4. Flash Magisk
5. Restart
6. Reinstall xposed from Magisk Installer
7. Restart
10. Re-enable Gravitybox in xposed
11. Restart
All done... did i do something wrong?7 -
ABAP - a language that is frozen in the 60s
PHP - an inconsistent language
Flashplayer - do i need to say more?
Internet Explorer - ↑5 -
With school starting in a few days, I'm reminded that half our class failed Grade 11 Computer Science, not because it was hard, but because they wanted to play flash games instead of actually learning2
-
HRM student: Hey, can I borrow your flash drive?
IT student: Sorry mate, I don't have that now. I left it at home.
HRM student: Seriously? How could you left if at home? You shouldn't have taken IT course. Lol
IT student: Oh I see, so where is your
Cooking Utensils
Graters & Peelers
Kitchen Shears
Mandolines & Slicers
Salt & Pepper Mills
Food Mills
Colanders & Strainers
Measuring Cups & Spoons and more? I guess you better drop all your subjects now.2 -
Gamemaker studio 2's 2019 roadmap just got released.. Still no Linux IDE (FFS) but it only took them how many years to realise that not every developer is a malicious cunt and give us the ability to disable to sandbox file system?!
I swear they add and change stuff that is so trivial instead of focusing on the engines major problems and absent features, eg. Can't use SVG graphics, the need to be exported in flash (SWF) because you know, makes sense?17 -
When you are trying to root your Android phone and accidentaly flash the wrong zip file.
https://youtube.com/watch/... -
Come again? What year is this Best Buy?
This has to be a bug in the POS.
Every flash drive is marked up here almost 150-200%!2 -
I ordered a new, speedy, 128gb patriot flash drive last week. I was so excited! I was going to partition it into a fat32 partition, and a bootable Ubuntu with persistence. Now I have the drive and that seems like something I might fuck up, and I don't know why I needed this so badly. I remembered the 10+ 8gb drives I have laying around. I have a problem.3
-
This is an anti-rant...
I had a problematic arch-dwm setup which i've been struggling with for a looong time, and when i thought i still needed quite some time to solve all issues, yesterday i somehow managed to hit the right solutions for each problem in a single evening. My setup is now in its most stable and usable state ever, and rsynced to a flash drive. I am no longer forced to use windows for my daily needs.
Praise be to holy gnu and holy tux! Do you think maybe i should sacrifice some electronics for the souls of st. ritchie, st. thompson, st. stallman and st. torvalds?2 -
When your trying to flash a rom to your phone but its 11:04 and you have an important exam tomorrow 😲3
-
!Rant
I bought a Samsung Galaxy S7 Edge from my cousin for $450. I then proceeded to root it and everything was fine for a week or so before my phone went into an infinite boot loop after an OTA update.
In the process of trying to fix it, I accidentally flashed a bootloader, unaware that Samsung has the bootloader locked. As a result, I had a completely bricked phone.
I mean legit bricked. No buttons with work and the screen remained shut and I couldn't flash anything over it again to try to repair it. I couldn't even put the phone into recovery mode. I now had the world's most expensive paperweight.
However, I managed to convince Samsung to repair it for me for free! I told them that the phone just stopped responding after an OTA update from them, which isn't so far from the truth.
I only ever had to flash things on the phone to begin with because of their update. Honestly, I wouldn't has had to deal with this problem, and neither would Samsung, if they just didn't lock the damn bootloader! Why are these companies taking away are independent control of our own devices?
Moral of the story: DON'T flash over a locked bootloader EVER or you will end up with a completely brick device, with no solution other than to open it up and replace the motherboard entirely.11 -
Is there some basic guide to privacy for (android) phones?
Like where you flash some secure ROM, get timely updates , no gapps or privacy threatening app, use secure services and alternatives mainstream ones, and use foss s/w.. And something like fdroid instead of playstore store or something..
Ignore the badly framed idea, but you get my point..6 -
I've had a mentor who talked less and taught more. Before becoming a front end developer, I was doing flash. So, when I started front end, I didn't have any idea even about the basic stuff.
But, whenever I get stuck he will give a keyword for me to search. So, I learned how to survive in New areas & technologies - By googling. -
There is a kid in my Computer Studies class that will not for any reason stop playing Bo Burnham songs. He also thinks it's funny to play every sound in our Flash library that the teacher gives us. kill Me now2
-
Finally managed to flash Linux on my 250GB SSD with Linux! (After breaking it several times...)
Now I have a question to people that have a Linux/Windows Dual-boot:
What do you use Linux for, and what do you use windows for?
Really unsure how I should use the disk... Had an 16GB USB for school until now. (Lost it tho)
I plan to use it for school as well but I'm kinda afraid of losing it. (Was expensive)
Therefore I tend to just use it at home.26 -
Today, I found "ClassNotFoundException" in my Java program.
After a long time to figure out the problem, I found that my flash drive which I run program has been removed by myself. Lol -
A client brought us a project once related to drones. Our team came up with a great solution for the problem and pitched it back to the client. After going back and forth and beating us up on the price, they ultimately got cold feet and stopped responding to us.
Flash forward several months and wouldn't you know it, NASA and Lockhead Martin have the same idea and file the patent. Could have been sitting pretty if the client just went through and filed our design first which would have barely cost anything.2 -
!rant The end of the world arrives. I have an 8GB Flash USB drive on my keychain. What hacker-ish/prepper stuff should I have already installed on it to take control and survive the apocalypse? Aaaaand...GO!19
-
When you finally have some servers racked and configured in VMware to build a lab environment for the team....
But to access VMware you need to run citrix receiver from a mac to launch Chrome on Windows to access the VMware ESX Web UI but only on the HTML5 version as Flash doesn't work....
Now to spin up virtual machines that you can only upload via ova images but not locally cos that tries to show you the Windows citrix local files....
Do I even dare ask if I can access this via API so I can actually provision this with Ansible like I want too?! -
KDE = Goku
Xfce = Flash
Cinnamon = Thor
GNOME = Captain America
Pantheon = Wonder Woman
Windows = Pilaf6 -
Around the time Apple was denouncing it, I joined a chatroom for Adobe flash game developers. I really loved the idea of making games too, so I tried to learn ActionScript3. That failed, because it was my first language and since I was broke, I couldn't afford flash pro, so I was using an open source ide with okay documentation, but no newbie coder tutorials. I didn't actually start learning to code till Codecademy came out, I learned js, then I learned visual basic and Java for online courses the local community college had available, and now I'm taking C, C++, Java, and Python in college while I use C# at work and JS during my free time. Sadly, in a jack of all trades, master of none :/1
-
>Raspberry Pi on 16GB SD card
>Plugs in 2 flash drives for space, one 8GB and one 32GB
>8GB is allocated entirely for swap
>32GB is separated into 3 partitions and /etc/fstab edited to mount them on /home, /opt and /usr
>Moves files to the proper partitions on stick
>Kernel panic on boot before keyboard is enabled, kernel panic data taller than screen
>No R/W FS for kernel to dump to
fuck my life4 -
After opening game files for Ragnarok Online and saw the quest files are human readable (lua or other scripting language). Had some Flash workshops to confirm my interest.
Later in college, I make games for every lecture projects (with my friends). Now our game studio is 7 years old.2 -
Just had a discussion with a support person, it seems I need or use safari or opera OS to be able to watch a recording of an open class I has.
The platform they jse works on with flash (fucking hate it), and it seems linux is not supported because I need to install flash.
I was just reporting a stupid bug, I am watching these on my phone and staying away from installing flash.
God dammit.1 -
When I was starting programming (learning Actionscript 3) loong time ago I for some reason didnt stubbornly write code into .as files... Instead I just attached code to timeline keyframes in Flash...6
-
"The sudden hunch, the creative leap of mind that 'sees' in a flash how to solve a problem in a simple way, is something quite different from general intelligence." - Martin Gardner
-
You know your day is gonna be bad when it's Monday and you are told to work on a badly written legacy flash application!
-
So recently I've been taught how to make Virtual Machines in school and I did made an Ubuntu vm because it was loaded on a disk my teacher gave to me. And I loved it, it was my first time with Linux and I was so impressed, so I put some more versions of Linux on a flash drive to copy and I'm going to try them all out! The other versions I'm going to try out are Mint, Fedora, Manjaro, and Kali!3
-
TFW you put your local changes on a flash drive, drive 35 km away and notice that you forgot the drive. So you go back to get the drive the next day, take it and hightail it back. Then, the next day, you copy your changes over and are about to start developing when...6
-
Need to attend devops webinar
Webinar link requires flash...
I guess I'll find something else to do then2 -
I wish I got started making Flash games before Flash became popularly hated and unsupported. It's technically not too late but it really is.2
-
When a friend told you that they have a problem and needs a Computer Science student's help ..
.. and it's about a broken flash drive.
I can't even fix my broken C code let alone fix a freaking flash drive.1 -
Dear devs from the past. Whoever of you thought iframe navigation, js-only frontend and flash were a good way to build a web UI -
well, it's not.
Regards, a person from the future who still can't properly use tabs with your app.1 -
A minute of silence..
...for the product managers who want the COOL 'Flash' app remain untouched in the code! -
Html5 vs Adobe flash. Html5 won
Html5 vs java Web embedded app. Html5 won
Therefore Html5 vs java 3 billion devices. Ans=?5 -
The most fun I've ever had coding was creating a hidden object game in school (with Flash/ActionScript3). I even had a dude do voiceovers, it was dope! I would love to learn more gaming development but no time. :(
-
I'm working in a company that still use Flash for softs/websites... On the other side, il be working on m'y free time on a cultural app3
-
Is someone else into photography and can recommend me some Opensource software for it. (fuck Adobe for Flash and not supporting Linux)14
-
Saw this wk100 tag all over devrant so here are my goals :
1. Drop my current job with a shitty boss (working with Flash in 2018)
2. Work with one of my teacher
3. Find a girlfriend
4. Riding my bycicle every day
5. Meditate every day6 -
How to learn Flash in 2 hours.
1. Take a job to amend some HTML5 banners.
2. Realize they were created in Flash/animate CC and exported to HTML5 Canvas
3. Have 'fun' learning a very innovative way to create banners...
Well to be honest as soon as I got the hang of it, it was not that bad, if you ignore the generated code. -
Best laptops for mobile devs? I personally love my Surface Pro 2 its been a little workhorse and does everything I need besides booting from a flash drive. But I wanna know the communities favorite laptop.10
-
Doing personal online shopping whilst waiting for code to compile (took about 10-15 min every time, just for the smallest code change).
This was a really slow Adobe Flex system which I hated. Actually glad I left because no sane company uses Flash, even in 2012. -
This asshole is out of his fucking mind if he thinks I am going to waste my Friday night waiting around to update a URL on the employee intranet.
News flash if it’s a tool people use everyday they have it bookmarked. No uses the fucking employee intranet because it’s old and it sucks.
You get a list of the users and email them telling them of the update if you are too dumb to figure out a redirect. -
So Vivo made a bezeless phone this time
But guess what its again gonna contain a fucking kazillion Megapixel Selfie camera with Mars Light Flash to make you look Unique paired with a shit mediatek Processor.
Also,
They have got stones from krypton and their next phone is gonna have krypton light flash just so the fuckin superman can't use that just because they partnered with marvel to get infinity stones so that they can use them in their later phones as a light for the selfie flash.
Guess what? Thanos preodered it ..
Well Played Vivo3 -
If only phone manufacturers will give us something like system installation disk/mini usb or smthing... Then there will be no stress about anything! You can root, flash, do everything you want and if something goes in wrong way, just reinstall your android with no problem like u did many times with your PC os. Dreams5
-
Flash back to when The old mouses had the trackballs in them, pulled the mouse apart and pulled the trackball out 🙃
Coming back to recent times, myself and a work mate printed off small troll faces and stuck them to the bottom of the laser mouses around the office huehue1 -
So a follow up on my post yesterday, I had a brain flash.
Basically it bypasses a webpage with JS that redirects the browser on mobile browsers so I can actually get to the download page for the anime.
Before I still had to paste the starting but now I just download the anime site to get all the latest updates.
The key was actually getting the information from the page. What I realized was I don't need Title or Episode #. All I need is the URL because it's in there (at least for now). The site probably should've used ids instead but :)2 -
When I was 11 or 12, and wrote my first webpage in php, designed with tables. Tables was the shit back then. none of that fancy flex box or bootstrap, and 50% of the internet was flash. T'was a good time to be alive.3
-
!dev related, kinda
Why did the devs think it was a good idea for the iPhone to have the flash go off as a notification, I feel like the person opposite me was having a strobe light show5 -
Hmm... Why does name look so familiar...
Ohhh mind flash... Looks at notepad file with my commonly used commands to confirm:
tar -xvzf ...3 -
Started playing around with HTML and CSS when I was about 8. Tried JavaScript but it never stuck. Started to learn a bit of Python when I was about 13 and enjoyed it, but never applied it to anything other than some maths. Used some basic ActionScript in Flash animations. Wrote some simple VBA in Excel. Learnt Matlab during my Engineering degree. Now I use Mathematica for my PhD work, Python for fun and useful bits of software for myself, and the occasional bit of PHP and whatever else I need at the time to get something working.
-
Needed a flash drive, went to the store and got a SanDisk cruzer blade and figured 16gb for a mix of personal files and the eventual installation of a different distro would be enough.
Got home and went to give some work to my new red friend, my laptop was running lubuntu, used it for like 2 weeks, didn't like it that much, figured I could experiment with mint, downloaded the iso, ran unetbootin and voilá, got a bootable usb drive.
Only that no. I didn't. Tinkered with it the entire fucking day and I couldn't make my laptop's bios recognize it, tried with every possible format that disk utility could format into, tried with 3 different distros and nothing.
Feeling determined to thrash out my current system, I went on a scavenge hunt, trying to find a flash drive anywhere in the house, after a couple hours tossing papers and a number of different things aside, I finally found a 10 years old Verbatim, loaded mint in unetbootin and finally, a bootable usb drive. So thanks Linux god!
By the way, I'm installing xfce mint, anyone have some tips on customizing it?4 -
Figured I'd play around with Linux for the first time. I followed instructions to create bootable flash drive. I then proceeded to lose an hour just trying to get Ubuntu to do something after booting from it. The welcome UI becomes unresponsive every time.16
-
When the program exactly fit on the MCU, using up every available byte of flash. It was just a small display unit, but it felt nice that I had chosen the smallest possible controller for the job.
-
I just fucked up real bad:
My phone was giving some error about not being able to install an update. Fair enough, i think to myself, so i try rebooting. Still nothing...
I then remember that i at some point OEM unlocked it for some testing, so i start up adb and see if i can connect during the update process. I can't. This is bad: I can't get into my home environment, nor can i connect with adb
Then i try booting into recovery, but instead of booting to ACTUAL recovery, it boots to some custom made "E-Recovery" made by huawei (my phone is a huawei p9 lite), which only gives me the option to download the update, which crashes, and no way of resetting. However, from here, i am finally able to connect to my internal storage via hisuite to make a backup
Next up: Bootloader
So i next load up the unlocked bootloader to try and manually flash the update. That works great, but it still wont boot normally. So i figure: it must think my device is in fact a different device. At this point i'm pretty fucked: Even though i have my data backed up, i can't manually download the update from huawei's site because i don't have the right keys, and i can't download an OTA because their site sucks and half of the downloads don't work, including the one i need. So now i'm stuck here with a bricked phone because EMUI doesn't know how to install an update.
I then did the stupidest thing i have done to date: i wanted to flash a custom recovery image over the "E-Recovery" in order to do some troubleshooting, but instead of writing
"fastboot (mydeviceid) flash recovery recovery.img"
I wrote
"fastboot (mydeviceid) flash boot recovery.img"
Meaning i flashed my BOOT partition with a custom recovery image that turned out to not be able to run. Great! Now i've totally fucked my boot sequence
I can't call their support line either, because as soon as they realize i've tried to restore it myself, and therefor had my OEM unlocked, they basically just hang up.7 -
I hate those microfucktards!!!!
I have a brand new usb flash with 125GB capacity and ~ 115GiB.
I wanted to install a bootable Windows 10 installation onto the flash and downloaded the fucking recommended windows 10 install tool from the ms fuckpage.
And? This dipshit of a "tool" created the windows installation and partitioned my flash into two partition's. One is 30GB and the other....
90 GB that is not assigned!!!! Fuck you.
I mean....why the hell does this stupid tool formats my flash to fat 32? And why there is no option to use exfat? I'd don't get it.8 -
I just remembered something about a professor from my college that a dynamic website means a Flash-based site. He teaches Networking subjects by the way.1
-
So, last 24 hours has been amazing, we were contacted by a one of biggest VC Firms and had a hangouts call with them, and last night we were able to got our app uploaded to TestFlight
3 weeks ago, i would not have thought that i was making a game for iphone using unity and Xcode beta(cause ARKit)
Everything happened in a flash 👨🏻💻 -
A few months into teaching myself programming (I started with ActionScript cause it was readily available on the school computers) I realized all these games that I play, and that millions of others play, I could make.
I then started remaking pokemon red in flash which I never finished. -
Switched to LG G5 from iPhone 7 Plus.
Lg's screen has burn in and took me about 10 hours to completely fuck it up, restore it, flash crDroid(Lineage os based, the only custom rom working fine so far) and workaround the faulty wifi chip giving null mac address by faking it.
Still love my new(old) phone more than the iPhone.2 -
Just wanted to clean up and update my old smartphone (Huawei Y300). Accidentally deleted the home screen and system.ui and can no longer open apps. TRWP (2.5.x) is too old to flash a new image. Need TRWP 2.6.3.3, but it is impossible to update it from within TRWP. Such a crap.11
-
Sometimes I really don't understand what is really bad.
My fucked life
or
The flash fucking the fucking complex timeline. -
I haven't touched Flash for at least six years, but people still endorse me for my Flash skills on LinkedIn. Because they wouldn't see a duck from a castle. Ignorant f*cks.
-
I'm a web developer that would like to do some game development. I focus on front end, and have done backend work (not a lot of databasing, though). I mainly use JavaScript and Python, with enough knowledge of Java, C#, and PHP to get by when I need to. I've also got a background in graphic design.
What aspects of game development might be a good fit for my skillset?
Where and how do I get started? I've looked at Phaser in the past, since it was inspired by Flixel, a Flash game library I used for a some simple projects in college.3 -
So the time has come for me to officially say "Fuck IE".
The potential client, one of the major hospital chain in the country, wants the site to work in Internet Explorer. Can't believe they are still clinging on stupid IE because Google Chrome is insecure 😂
There is no way all the charts and graphs we made would work in IE.
To top it off, the "bluffon" boss came up with idea of using flash to display this features on IE.
It's fucking 2017!!9 -
Ok, I'm fed up with this, just read something about android constantly monitoring your phone's location, now it's time to shut this up.
Would you please be so kind and share information on which alternative "privacy-first" OS I could use and how to flash my device? For all I know, it runs a custom HTC modified OS. I'm quite unfamiliar with all those things gravitating Android. Heard about Cyanogen mod but that's about it.
What about compatibility with apps downloaded through the play store? (thinking about Threema) I would also need compatibility with WhatsApp (yeah, sucks, I know, but hard to convince regular people)
Thank you all :)2 -
I logged in a Remote Server, where Bi-Directional was disabled.Didn't allowed copy-paste and needed to upload a new Web app release.
Hack: just inserted usb flash drive in my computer and remote server recognised that as external.
Deployment completed!4 -
Running Adobe Flash Builder IDE for creating Flex application really sucks..!
VS Code work better nowdays for many languages...!
Support for ActionScript is quite with extensions.5 -
4 years in high school (turbo Pascal, Java, c++, didn't learn much more than basics), summer course with Macromedia director, a few college courses/internship with html/css/flash.
But most of all, just working and learning as I go.2 -
To the developers that still use flash player for their games, fuck you.
My grandma wants to play some games and i can't fuckin make it work since your piece of shit games still use that piece of shit flash that in 2 years will be dropped fuckin scumbags. And now i'm trying to find a way either to explain to her how retarded you are or find a browser that supports this piece of shit.2 -
Ended up dong an internship for my school (not really internship, more along the lines of formal volunteering, but whatever) helping set up laptops for a statewide standardized assessment.
I made a program to log the machine's identifying info (Serial, MAC addresses, etc), renames it, joins it to the school's Active Directory, and takes notes on machines, which gets dumped into a csv file.
Made the classic rookie mistake of backing things up occasionally, but not often enough. Accidentally nuked the flash drive with the data on it, and spent a good while learning data recovery and how grep works.
Lesson Learned? Back up frequently and back up everything -
Asked a question on SO,
Why is my Microcontroller (Android things IOT) not getting detected in my Mac to flash an image?
Someone commented:
Mac doesn't provide enough power to it.
(Really, I can see a green light on the board)6 -
So I decide to do some online test at company X for an internship.
URL bar exposes names, id number, email etc, whatever you fill when they capture your details(these morons are probably using a get route to do it). Okay fine let me give it a try... Page loads flash content! WTF!??...Fine I do the test, so easy and fun. After completing the test and hit submit the whole flash shit just goes blank!!! Now I wasted my 3 hours for nothing!!! I'm so pissed rn I wanna write them an email. Ohhh I forgot to mention the page was very http with no s. How do I even trust they'll tech me anything???8 -
I like manjaro and hate architect...
On my Windows I created an empty space to write the linux there. Booted up the architect flash drive, completed some steps, now partitioning. EFI boot partition, swap, home, root I am going to set em' up.
> Automatic partitioning
Ehm, why not? It warns that it will create new partitions. I created free space in my SSD so its ok isn't it? Surely, it will detect that there is a big enough space to create partitions there. I've lost my Windows, projects, files, docs. Fuck them. Fuck them again. Who the fuck created that automatic partitioning?2 -
Copying something to a flash drive on a Linux system and then typing "sync", and then followed by more "sync; sync; sync" is the Linux equivalent of hitting the 'Refresh' button on a Windows machine after a transfer!
Bloody OCD! -
I was aspired to be a graphic designer back then when I was in primary school, playing with all the fancy Photoshop filters. Then I got sick of static images, move on to Flash (just before it died violently). I self learn the ActionScript by myself and fall in love with programming. Not the usual language to begin with, but it kinda form my basis in OOP concept.
I still have that thick ActionScript 3.0 bible with me. Keeping it so I can always remember the first time I broke my geeky virginity. -
Guys, i've searched long and hard for a custom Kindle fire 1st Gen ROM... Digging through the internet to find this shit is hard. The dropbox links on XDA for OtterKat aren't working.
I managed to flash Cyanogen to my other kindle (Fire HD 7) - which my dad wants back, even though he dosent use it. I'm left with this first gen, and i've been at it all day2 -
Experience with Plasma Mobile, part 2.
I was able to clone the official master repository and commit my hacks to it, but when I sent the pull request, the current active maintainer said that the master branch was actually severely out of date and to try the "halium-flash" branch.
So I did. I checked out the "halium-flash" branch and attempted to install Plasma Mobile. The bash file used to flash the phone still needed to be hacked around, though my previous commit was made irrelevant by the change. However, I did get it working on my phone.
So, here are my thoughts: It's most definitely not ready. The lock screen looks pretty and is well put together, and the "desktop" and icons for applications look very nice.
However, my phone does not have a physical "home" button, and Plasma Mobile to date does not have a digital "home" button. So, in order to close an application I have to literally reboot my phone.
As of yet there seems to not be any tactile feedback or visual feedback, which is odd when typing in the passcode to log into Plasma Mobile or trying to open an application.
Firefox crashes if you try to open it, and currently there are two choices of wallpaper. I haven't tried calling someone, but I'm fairly certain that Plasma Mobile does not support telephony on my phone type.
So, my verdict is still the same: I have great hopes for the Plasma Mobile project, but unless you are a developer who is interested in making it a better product, I would stay away for now.6 -
Are there any custom ROMs I can install on mx LG g-flex 2? It's getting real slow and the battery is shite and I'm sick (and stuck) of this LG skinned android.2
-
Me and my coworker shares internet cable because the it departement haven't plugged in all the cables at the other end. It's primitive... Like sharing a usb flash drive, but worse5
-
tldr; I failed a web class once, then practically taught people actionscript. Now i love JavaScript/Node.js because flash is icky.
-full story more or less-
I failed my first web design class in college due to not having enough time to actually study(I worked 2 jobs and took 6 classes like a moron). Anyway took a flash class prior to retaking my web class, I picked up on action script really quickly. As in I ended up helping other students better than the instructor was(she hadn't touched flash in like 5 years and was just an adjunct instructor). I got hooked with action script so I started teaching myself JavaScript, knocked the web class out like nothing after that and loved it. -
I got a new laptop .I tried to get linux onto a flash drive.didnt work.put me on grub screen.didnt know what to do.i asked the shop to install an ssd to put linux on it .so the ssd is installed and I cannot change it otherwise the warranty is voided.fml12
-
Three days out from a field trial, I receive a bug report and change request. A month ago I was told that testing had been completed and the feature set signed off.
Not only have all our manufacturers received their hardware images, not only have they fulfilled our orders but all units have been delivered to our customers!!
After pointing all of this out I hear that wonderful phrase all Devs know and love, "well how hard can it be?"
"Well how hard can it be to flash all of the hardware?"
That has been delivered to all of our customers?
In every state?
All over the whole country?
Just No!2 -
ways to mess with Datacenter staff:
make every server flash blue light for identification, turn on amber light, and display "Printer Error: 1D10T" -
A friend introduced me to mIRC and told me it's a good place to meet girls. I however ended up meeting people who showed me nice things you can do with HTML.
From that I learnt other stuff such as mIRC scripting, Flash action script, etc... -
Internship Title : Database building
Skill(s) required: Java, PHP, HTML, CSS, JavaScript, C#, Python, SQL, Bootstamp and Adobe Flash and CCNA
Yes, you read it correct, Bootstamp
WHHHHYYYYYY ???4 -
Of all the browsers required to complete mandatory classes online for the USMC you would think they would support a modern browser and no IE6 or flash heavy courses only...2
-
Working code?
Or fake compiler?
Fix a problem?
Or buy a new computer?
Bring a flash drive?
Or bring a hard drive?
Use water cooling?
Or use an ice cube on top a processor and memory?
Drink some coffee?
Or eat a healthy breakfast?
Do you make hardware?
Or software?
These are the problems programmers face from old people as employers or relatives trying to find something to relate to. -
My first project was a pacman game made with AS1 in flash 6, I learned a lot and it made me appreciate debuggers, proper programming languages and to love making games, however that game was unbeatable thanks to ghosts having the same speed as pacman and using path finding algorithm with no error margin so they always catch you!1
-
Installed ros and everything on NVidia board. Dd on to SD card and I have a bootable device.
Fiddle with boot config - fuck yeah.
I then just flash the new board.
Everything crashes FUCK. off and on again... Come on! phew
Ahhh but the flash should work, hmm choose another partition.
Everything is done YES I AM A HACKER. Unplug sd card, off and on again.
No response killed the bootloader, fuck me... -
It started around 10 years ago, my first programming lesson is creating a simple actionscript using macromedia flash mx. It's a script that takes 2 input and print out the sum. I still have the script today. 😁
-
Learned Actionscript in school as it was the language used to teach programming fundamentals to students...I actually enjoyed the syntax and the switch between flash and flash builder.
I feel like an idiot though because after I learned it I discovered no one uses Actionscript and I sort of disregarded what I learned and now I've forgotten how to use it and how to work within the environment :(4 -
I've just finshed a cours about service-oriented architecture in my uni and a lot of people are "complaining" about SOA becasue it's not used so much these days and it's a waste of time to learn it. What's your take on this? Do you use or have SOA in your company or use it in some way? Any rants about stuff you learned in school that were completely outdated? A friends friend finished uni about two years ago and they had a big course in Flash...2
-
When I use a stored procedure called AdminSetSettingGently I think about this:
http://albinoblacksheep.com/flash/... -
As a junior in a print communication agency, my boss wanted me to make their portfolio.
Their requirements were: a full animated flash website (in 2010...). Understand, they had been bought the Adobe license...
After several months of works and ton of alerts about flash death, the website has been deployed.
My boss did not understand why he could not visit the website with its iPhone...
The website had lived 2 months and will was replaced by a static "wix" alternative... So much work for nothing because the boss did not trust a junior dev.
Biggest lesson: Always begin with fast proof of concept to validate your hypotheses for you and for your boss ;) -
So I had an epiphany. I have always thought of linux as a big ugly slow monstrosity. It occurred to me the only time I had used Linux was on rPis and similar devices. Then I threw vanilla Ubuntu onto a flash drive and booted my workstation to it.
My next point what is the most seamless dual boot solution. 😁
Edit - typos8 -
Friend: "Can i borrow some flash drives?
Me : "Here you can get mine. "
Friend: -viruses, -scams, -key loggers -autoruns "No dude just forget that i was here " *gone* -
This is what happened. I had Linux on my machine. I wanted to show off. So I asked my friend to give me a flash drive with full of viruses which will kill HIS machine if plugged in. Wanted to show that Linux is superior. So he handed me a flash drive. And while he was watching, I plugged it into my machine, proudly. Alas, my machine was dead in half a second. I was like, WTF man. I asked him, "what runs on your machine?". He replied, "freaking Linux"
(this is not a true story) :p5 -
Screw you white flash of new chrometab, why must you blind me in the dead of the night?
Also why is there no real "force websites to dark mode" addon?
(currently using high contrast + uBlock-O CSS rewrite for daily sites)5 -
Build a website for a private business: Cool.
Do it without being aware that frameworks are a thing and you shouldn't swear every day for a month to fix percentage layouts: Cooler.
Hear the customer complain about how much he liked a competitor website built on flash technology: Coolest.
Now I'm an iOS developer. -
Here in Brazil we call flash drive's a "pendrive". Why? IDK. What do you call it in your country?20
-
I simply don't understand anyone who uses Adblock.
I have had a single virus in my entire computer life, and it was from a dodgy .exe on someone's flash drive, so I don't need it for that.
If a site is too ugly with ads, I leave. Otherwise, I deal with it because people need to eat.
If you use it most places, you are cancer to the web.
If you live, like I did for 18 years, with the <200kbs peaks or less, maybe I could understand, but for the rest of you, I have no respect.9 -
This feeling when you have 20+ devices which you use to develop and/or test have flash flood alert.1
-
this is something that's always bothered me, I figured this would be the perfect place to ask. so some projects have files you need for development but can't commit to VCS (for example, files containing AWS keys, certs, etc). I've always dealt with this by just storing them/backing them up on an intranet server not connected to the internet. does anyone have a solution easier than manually distributing these files to new developers via a flash drive?3
-
Over the weekend, I made the move to use a flash as a repository (don't need no wires to repo!). Felt that needing 12 MB to store less than 2 MB was a little bit high.
So I figured "simple fix, I'll just reformat the drive from 32Kb allocation to something less, like 4Kb".
After 30 seconds of a single copy/ paste, the transfer was complete. Checking the size... accidently clicked "4096 kilobytes" instead of "4096 bytes". -
Guys, what's the most popular cross-platform mobile app framework out there?
We recently ported our apps from Flash to Xamarin.Form..3 -
Hummm(flash back)... I was studying art and design when I've decided to become a web designer, but by the time it came to take my degree also took some frontend languages and them(big explosion and fireworks) it was like magic, I could design and give life to my creations!!! 6 years later still is magic(not the rainbow and unicorns type) ...you know dam well i am talking to you javascript(and your dam post apocalypse bugs)... 😁😁😁 still wouldn't imagine my self doing anything else!
-
I tried to explain to our Ruby system architect that rescuing Exception (which also catches NoMemoryError) is a bad idea. I'm then told we _want_ to catch it and log who the culprit is and flash an error to the user. There's still a palm print on my face.
-
Little questions that can act as a survey,
I have a dual is tablet running Windows and Android the hardware is a Intel atom with 2gb ram and 32gb flash. I'm thinking of offering one of my OS's up but I want a second opinion.
What to kill windows 10 or Android 4.4.4 -
The mind of The Flash. You know, able to think quickly and fast. Then I can solve a lot problems in a nick of time, or learn a new concept or language quickly.
Yeah, that'll help me a lot.1 -
What's generally considered the best (in terms of cost and compatibility) phone to flash a custom rom to? My current one is filled with bloatware that I can't uninstall and the bootloader is locked.5
-
Writing fun code for your esp module but wondering why it won't flash correctly. But there is a USB cable in your USB to serial and it goes behind your monitors and the esp shows you that's its powered.
10 minutes later you notice that it is plugged into your adapter instead of your computer........... -
Me n one of my mates want to make an educational website which'll require some logic. Brython looks good on cover, but has anyone got experience with it? We want it to run well on slow computers (without using Flash ofc). Any advice for framework, or would you suggest raw JS?