!geek girlfriend

Me and my partner are in the car driving. We drive by a young girl who is on her scooter. I look at my gf and ask,

Me: do you sometimes have some weird thoughts in mind (and nothing relating to sex her just so you know).

Her: well what do you mean?

Me: well i se that person scootering on the sidewalk and i imagine screaming at her like a lunatic “GET THE FUCK OFF THE ROAD PUNK” (which the little girl clearly isn't).

She laughs.

Her: yeah，i do too but it's more scientific， like sometimes i wonder how many times some one would flip. In the air if i hit them with the car or how long would it take some one to reach the ground if i pushed them off the balcony.

....

Me: silence...

Skin goes white

Her: looks at me with a big smile!!!

Im not sure if this is good or bad ;)

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

I'm fairly certain my boss'.....boss (didn't want to count them.. it's high up the chain, and slightly lateral) thinks I'm incredibly weird. I have too many sports injuries to be fully functional and they all flare up while I'm sitting at my desk. To offset this, I stand up or walk around while on the phone, and occasionally stretch.

These stretches are for hip and it band, usually, which are a bit more involved, so of course he ONLY fucking walks into the damn office while I'm stretching. (Image search for hip stretch).

To top it off, I have an unfortunate colored ointment for the pain in my elbow that i was applying today while stretching, and im scared to know what he was thinking before he realized what was actually going on. Imagine hip stretching (this one with leg on desk) while rubbing milky sort of clear ointment into skin...

Sir, if you're reading this, I promise I'm not actually that weird at work, you just have shitty timing.

Once a weird co-worker gave me a condom..since I'm a weird guy too, I accepted it just to have a peculiar stuff in my wallet...I'm a guy, no girlfriend, he's a guy too...im straight tbh...him..i dunno

Have you encountered projects that were beyond saving?

Been freelancing for a client via agency for the past year. In the beginning the deal was to maintain identity verification sdk for android maybe 10-15 hours a month or so. Their flow consisted of around 25-30 screens, so I took it thinking it was easy. Boy I was wrong.

Codebase was and still is a complete spaghetti, backend weird and overcomplicated and impossible to talk with someone in backend. Had to reverse engineer their complicated flows many times just to make a small change on the app. There also are lots of issues with capturing/sending camera recordings especially on older devices. The fact that Im the only dev maintaining this doesnt help either.

First few months it was just maintenance, later some small features and soon it become a 40 hour a month gig. I was able to deal with it but then management changed, they started micromanaging me heavily and now they want me to do 60-70 hours a month. Also they asked to implement some unnecessarily complicated features and to be honest without refactoring most of the codebase I cant even begin to think of how to implement them.

Also workload in my main job increased. Started sacrificing my evenings, weekends and basically my wellbeing to work on their product. Tried to relax but then I realized Im just spending my freetime thinking about their project all of the time. Best part is that last few updates fucked up the whole flow and I dont even understand where the problem is anymore: backend, 3rd party integration issues or something else that I did.

Last friday told them that my availability changed and Im quitting. Told them that Im gonna provide support till the end of the month but no big features. Just spent a full shift in my main job and another full shift working on their product, trying to untagle their spaghetti.. Im totally lost and burned out. Meanwhile stupid manager is asking why "simple" stuff according to him is taking too long.

I should receive my last payment from agency this week, also asked them to send it to me earlier but no answer so far. At this point Im so burned out that I dont care anymore about the last payment, even if client complains that everything is broken and doesnt want to pay me. Project is beyond fucked and that SDK as well as their backend is a ticking time bomb. Im done.

I don't know if I'm being pranked or not, but I work with my boss and he has the strangest way of doing things.
- Only use PHP
- Keep error_reporting off (for development), Site cannot function if they are on.
- 20,000 lines of functions in a single file, 50% of which was unused, mostly repeated code that could have been reduced massively.
- Zero Code Comments
- Inconsistent variable names, function names, file names -- I was literally project searching for months to find things.
- There is nothing close to a normalized SQL Database, column ID names can't even stay consistent.
- Every query is done with a mysqli wrapper to use legacy mysql functions.
- Most used function is to escape stirngs
- Type-hinting is too strict for the code.
- Most files packed with Inline CSS, JavaScript and PHP - we don't want to use an external file otherwise we'd have to open two of them.
- Do not use a package manger composer because he doesn't have it installed.. Though I told him it's easy on any platform and I'll explain it.
- He downloads a few composer packages he likes and drag/drop them into random folder.
- Uses $_GET to set values and pass them around like a message contianer.
- One file is 6000 lines which is a giant if statement with somewhere close to 7 levels deep of recursion.
- Never removes his old code that bloats things.
- Has functions from a decade ago he would like to save to use some day. Just regular, plain old, PHP functions.
- Always wants to build things from scratch, and re-using a lot of his code that is honestly a weird way of doing almost everything.
- Using CodeIntel, Mess Detectors, Error Detectors is not good or useful.
- Would not deploy to production through any tool I setup, though I was told to. Instead he wrote bash scripts that still make me nervous.
- Often tells me to make something modern/great (reinventing a wheel) and then ends up saying, "I think I'd do it this way... Referes to his code 5 years ago".
- Using isset() breaks things.
- Tens of thousands of undefined variables exist because arrays are creates like $this[][][] = 5;
- Understanding the naming of functions required me to write several documents.
- I had to use #region tags to find places in the code quicker since a router was about 2000 lines of if else statements.
- I used Todo Bookmark extensions in VSCode to mark and flag everything that's a bug.
- Gets upset if I add anything to .gitignore; I tried to tell him it ignores files we don't want, he is though it deleted them for a while.
- He would rather explain every line of code in a mammoth project that follows no human known patterns, includes files that overwrite global scope variables and wants has me do the documentation.
- Open to ideas but when I bring them up such as - This is what most standards suggest, here's a literal example of exactly what you want but easier - He will passively decide against it and end up working on tedious things not very necessary for project release dates.
- On another project I try to write code but he wants to go over every single nook and cranny and stay on the phone the entire day as I watch his screen and Im trying to code.

I would like us all to do well but I do not consider him a programmer but a script-whippersnapper. I find myself trying to to debate the most basic of things (you shouldnt 777 every file), and I need all kinds of evidence before he will do something about it. We need "security" and all kinds of buzz words but I'm scared to death of this code. After several months its a nice place to work but I am convinced I'm being pranked or my boss has very little idea what he's doing. I've worked in a lot of disasters but nothing like this.

We are building an API, I could use something open source to help with anything from validations, routing, ACL but he ends up reinventing the wheel. I have never worked so slow, hindered and baffled at how I am supposed to build anything - nothing is stable, tested, and rarely logical. I suggested many things but he would rather have small talk and reason his way into using things he made.

I could fhave this project 50% done i a Node API i two weeks, pretty fast in a PHP or Python one, but we for reasons I have no idea would rather go slow and literally "build a framework". Two knuckleheads are going to build a PHP REST framework and compete with tested, tried and true open source tools by tens of millions?

I just wanted to rant because this drives me crazy. I have so much stress my neck and shoulder seems like a nerve is pinched. I don't understand what any of this means. I've never met someone who was wrong about so many things but believed they were right. I just don't know what to say so often on call I just say, 'uhh..'. It's like nothing anyone or any authority says matters, I don't know why he asks anything he's going to do things one way, a hard way, only that he can decipher. He's an owner, he's not worried about job security.

So ok here it is, as asked in the comments.

Setting: customer (huge electronics chain) wants a huge migration from custom software to SAP erp, hybris commere for b2b and ... azure cloud
Timeframe: ~10 months….

My colleague and me had the glorious task to make the evaluation result of the B2B approval process (like you can only buy up till € 1000, then someone has to approve) available in the cart view, not just the end of the checkout. Well I though, easy, we have the results, just put them in the cart … hmm :-\
The whole thing is that the the storefront - called accelerator (although it should rather be called decelerator) is a 10-year old (looking) buggy interface, that promises to the customers, that it solves all their problems and just needs some minor customization. Fact is, it’s an abomination, which makes us spend 2 months in every project to „ripp it apart“ and fix/repair/rebuild major functionality (which changes every 6 months because of „updates“.

After a week of reading the scarce (aka non-existing) docs and decompiling and debugging hybris code, we found out (besides dozends of bugs) that this is not going to be easy. The domain model is fucked up - both CartModel and OrderModel extend AbstractOrderModel. Though we only need functionality that is in the AbstractOrderModel, the hybris guys decided (for an unknown reason) to use OrderModel in every single fucking method (about 30 nested calls ….). So what shall we do, we don’t have an order yet, only a cart. Fuck lets fake an order, push it through use the results and dismiss the order … good idea!? BAD IDEA (don’t ask …). So after a week or two we changed our strategy: create duplicate interface for nearly all (spring) services with changed method signatures that override the hybris beans and allow to use CartModels (which is possible, because within the super methods, they actually „cast" it to AbstractOrderModel *facepalm*).
After about 2 months (2 people full time) we have a working „prototype“. It works with the default-sample-accelerator data. Unfortunately the customer wanted to have it’s own dateset in the system (what a shock). Well you guess it … everything collapsed. The way the customer wanted to "have it working“ was just incompatible with the way hybris wants it (yeah yeah SAP, hybris is sooo customizable …). Well we basically had to rewrite everything again.
Just in case your wondering … the requirements were clear in the beginning (stick to the standard! [configuration/functinonality]). Well, then the customer found out that this is shit … and well …

So some months later, next big thing. I was appointed technical sublead (is that a word)/sub pm for the topics‚delivery service‘ (cart, delivery time calculation, u name it) and customerregistration - a reward for my great work with the b2b approval process???

Customer's office: 20+ people, mostly SAP related, a few c# guys, and drumrole .... the main (external) overall superhero ‚im the greates and ur shit‘ architect.
Aberage age 45+, me - the ‚hybris guy’ (he really just called me that all the time), age 32.
He powerpoints his „ tables" and other weird out of this world stuff on the wall, talks and talks. Everyone is in awe (or fear?). Everything he says is just bullshit and I see it in the eyes of the others. Finally the hybris guy interrups him, as he explains the overall architecture (which is just wrong) and points out how it should be (according to my docs which very more up to date. From now on he didn't just "not like" me anymore. (good first day)
I remember the looks of the other guys - they were releaved that someone pointed that out - saved the weeks of useless work ...

Instead of talking the customer's tongue he just spoke gibberish SAP … arg (common in SAP land as I had to learn the hard way).
Outcome of about (useless) 5 meetings later: we are going to blow out data from informatica to sap to azure to datahub to hybris ... hmpf needless to say its fucking super slow.
But who cares, I‘ll get my own rest endpoint that‘ll do all I need.

First try: error 500, 2. try: 20 seconds later, error message in html, content type json, a few days later the c# guy manages to deliver a kinda working still slow service, only the results are wrong, customer blames the hybris team, hmm we r just using their fucking results ...
The sap guys (customer service) just don't seem to be able to activate/configure the OOTB odata service, so I was told)
Several email rounds, meetings later, about 2 months, still no working hybris integration (all my emails with detailed checklists for every participent and deadlines were unanswered/ignored or answered with unrelated stuff). Customer pissed at us (god knows why, I tried, I really did!). So I decide to fly up there to handle it all by myself

I get so fucking awkward and autistic when i sit at work 8h a day and just work... I cant fucking communicate with people. I behave like the most extreme "nice guy" beta shithead and its hard to fight it.

Went to put coffee in the sink now and a girl was washing the dishes. In the same time another girl was coming into the kitchen. I stopped and wanted to wait for her to wash them. The girl walking in looked at me weird. I was turning around pretening like im searching something. She asked hey do u need something. I then turned a 360 in place (oh my fucking God) walked towards the sink 1 step and then 1 step back as if i forgot to walk. Then i replied i just wanted to wash the coffee. And then i awkwardly put the coffee in sink for the girl to clean my coffee too

So fucking embarrassing!

Only when i work from home at my pace within my environment ALONE (im the biggest introvert) is when i dont become autistic. I can communicate. Im an alpha chad

Im listening to 8D music (sound vibrations in 8 dimensions) and it is weird as fuck

Feels like i am in a giant and small room in the same time, at place A while being at place B in the same time because the vibrations cycle around you to create an illusion of offset spatial divergence

!rant

I need pancakes

on a evening

I'm weird help I can't debug code and I crave for pastry aaaaaaa

So my MacBook's trackpad was behaving weird since this morning. Touch was working fine but for clicks I had to press down hard. Annoyed me all day. Then suddenly now it's fixed itself. So now I'm happy about it but im like, why, how. :/

How to deal with situations when in work people are overstepping personal boundaries too much?

My situation is that 2 months ago I started working in a very small startup and it currently consist of 3 ceos(main ceo, marketing ceo, product manager) and 3 employees (backend, android and ios).

What I currently dread is tea breaks. There is one at monday before work which lasts for 1 hour. And there is another one at Friday after lunch which lasts 1 hour again. I hate these Friday talks about "what are your plans for the weekend" which then triggers a circlejerk of ppl trying to impress each other about what they are going to do on their weekends. Same happens on mondays they circlejerk about how their weekend was amazing.

My situation is that I came to this country just to get skills and make shit ton of money when Im at it. Besides my fulltime work, I also am freelancing part time in my previous gig and also Im managing 2 other hobbie projects. I like to keep myself occupied during weekends so they usually consist of shopping/pc repairs/gym/working on my hobbie projects.

So basically when I tell them what I've done over the weekend the ceo's don't seem to be impressed so they start suggesting me to do something else. I completely loose any motivation of sharing my personal life when they start telling me what to do with my life.

I don't feel like exploring the city or meeting new people since maximum Im going to stay in this country is 6-9 more months. Then I'm probably going back to my own country.

Anyways even overall, I started dreading this companies culture. The politeness is so fake. For example there is an employee which has worked 3 years for them and the ceos haven't even increased his salary. I joined 2 months ago and I get paid more than him! They dont value loyalty at all since immigrants can be replaced easily. Another example: 2 weeks ago it was my birthday and no one from ceos even shook my hand, for them it was normal to just say happy bd during a standup.

So fking weird. I feel like I'm seeing redflags every day and not sure how long more I can stay here.

Isn't it weird that the name James is not Jame but James? Because I would assume James would be the plural of Jame because what if there are two people with the name James in the room... Would we say
"There are two Jameses/James's/ jamessis"...
Also if it's James's wouldnt that be for nouns etc like James's bag....
Sorry this has been bothering me for two days.
I asked this in office and people thought I had lost the plot so I AM AWARE IM CRAZY.

Joined a new startup as a remote dev, feeling a bit micromanaged. So this week I joined an established startup as a senior mobile dev where I work remotely.

Previous two devs got fired and two new guys got hired (me as a senior dev and another senior dev as a teamlead, also third senior dev will join next week).

Situation is that codebase is really crappy (they invested 4 years developing the android app which hasn't even been released yet). It seems that previous devs were piggybacking on old architecture and didn't bother to update anything, looking at their GIT output I could tell that they were working at 20-30% capacity and just accepting each other MR's usually with no comments meaning no actual code reviews. So codebase already is outdated and has lots of technical debt. Anyways, I like the challenges so a crappy codebase is not really a problem.

Problem is that management seems to be shitting bricks now and because they got burned by devs who treated this as a freelance gig (Im talking taking 8-10 weeks pto in a given year, lots of questionable sick leaves and skipping half of the meetings) now after management fired them it seems that they are changing their strategy into micro managament and want to roll this app out into production in the next 3 months or so lol. I started seeing redflags, for example:

1. Saw VP's slack announcement where he is urging devs to push code everyday. I'm a senior dev and I push code only when I'm ready and I have at least a proof of concept that's working. Not a big fan of pushing draft work daily that is in in progress and have to deal with nitpicky comments on stuff that is not ready yet. This was never a problem in 4-5 other jobs I worked in over the years.

2. Senior dev who's assigned as the teamlead on my team has been working for 1 month and I can already see that he hates the codebase, doesn't plan on coding too much himself and seems like he plans on just sitting in meetings and micromanaging me and other dev who will join soon. For example everyday he is asking me on how I am doing and I have to report this to him + in a separate daily meeting with him and product. Feels weird.

3. Same senior dev/teamlead had a child born yesterday. While his wife was in hospital the guy rushed home to join all work meetings and to work on the project. Even today he seems to be working. That screams to me like a major redflag, how will he be able to balance his teamlead position and his family life? Why management didn't tell him to just take a few days off? He told me himself he is a senior dev who helped other devs out, but never was in an actual lead position. I'm starting to doubt if he will be able to handle this properly and set proper boundaries so that management wouldn't impact mental health.

Right now this is only my 1st week. They didn't even have a proper backend documentation. Not a problem. I installed their iOS app which is released and intercepted the traffic so I know how backend works so I can implement it in android app now.

My point is that I'm not a child who needs hand holding. I already took on 2 tickets and gonna push an MR with fixes. This is my first week guys. In more corporate companies people sit 2 months just reading documentation and are not expected to be useful for first few months. All I want is for management to fuckoff and let me do my thing. I already join daily standup, respond to my teamlead daily and I ping people if I need something. I take on responsibility and I deliver.

How to handle this situation? I think maybe I came off as too humble in the interview or something, but basically I feel like I'm being treated like a junior or something. I think I need to deliver a few times and establish some firm boundaries here.

In all workplaces where I worked I was trusted and given freedom. I feel like if they continue treating me like a junior/mid workhorse who needs to be micromanaged I will just start interviewing for other places soon.

Hey guys and girls, quick question.
Im currently writing my own collection-framework in Go.
It has a Collection-Interface, that looks like this:
Clear()
Size() int
ToSlice() []interface{}
Add(...interface{}) error
Remove(...interface{}) error
Contains(...interface{}) (bool, error)

The library should also contains stuff like stacks and queues, so datastructures, that dont fit that interface perfectly.

So should i write a weird implementation of the interface for them, like Remove for stacks (high pitched internal screaming), or should i just say fuck it, and dont implement the Collection-Interface for these specific types ?

tl:dr
i fucking hate that professor for whom i have to work on laboratory project right now.

reason#1
the project is using a stack full with java. JavaScript. react and some weird facebook api of which i have no clue about. not to mention the server side of this application which uses tomcat (ok its java after all) and sql.

well that wouldn't be not so bad if...

reason#2
we wouldn't have to fucking debug his mistakes he put into the fucking prepared code AND his fucking useless instructions how to set up the project for eclipse the first time. not to mention his fucking requirements which make no sense

oh yeah im a student. i can always go and ask him for help if i need any...

reason#3
i have another 70% mandatory course at the same time and that fucker refuses to upload hos sheets in moodle and answer even one fucking question via mail. not to mention no support if I am there unless i have eclipse setup. even through the projects should be build using gradle...

reason#4
oh. and have i mentioned that this course is only about design patterns? uts not like we could see several of them in a java only application. no we literally have to learn java itself. gradle. nodejs JavaScript Extended for react which i have no clue about at the moment... and yes i especially mentioned gradle and nodejs beccause we have to set shit up and not only use a script.

reason#5
and all that wont even give us a grade. no ita simply a pass or fail part of the module which the course is part of.

have i also mentioned that the whole shit should be done in 20 hours according to the schedule

How do you handle work colleague who is becomming too chummy? Got this one guy who is my age at work (we are in late 20's), we've been working for the past 5 months in the same team. At first I was in a bad place so kinda overshared my personal life with him so did he. Went out for drinks and etc.

Problem is that its becoming weird in the office now. I am trying to fix my habits like quitting drinking and quitting smoking and all I get from him is pressure about why Im not going out and etc. He doesnt even really know me, just assumes that if Im not hanging out with him I just sit in my home on a couch. And in the end what if I do? What kind of guilt tripping is this?

Also I feel that he as a senior is kinda undermining me. I am not a senior but definetly also not a junior anymore, and he treats me as a junior while he has at least half of knowledge gaps as me. He has been working remotely for some time now and I noticed even how dynamics in the office changed. I see other devs coming up to me for advice and I see that I am actually competent enough to help them. If my big ego senior was here, he would be sucking all of the attention out of the room and I would be in his shadow yet again. Its just weird.

Just watched Zombieland 2 in the cinema and the dumb blonde girl in the movie was so fucking sweet and adorable and NOT TO EVEN MENTION HOW HOT SHE WAS, but i fucking fell in love with her PERSONALITY, i know its an act but i also know there are people who exist with that personality, this is very weird to me because i fall in love by the looks, rarely by the behavior but i this time i love her because of her personality lol what the fuck is this

I didnt know it was possible to fall in love with someones personality like i dont even have the urge to fuck her just to love her for personality lmao

Aight im talking about this like we are exclusive but it was just a dumb but chill movie

Day 3, still stuck with the same weird error message, Im using Ionic and I think I'll switch to React Native...

Fk you Google!

My Samsung note 10 screen went dead near a week ago... it's a secondary line so waiting for parts wasn't the end of the world.

Ofc the screen (curved and incl a fingerprint reader thatd be a major pain to not replace) was integrated to the whole front half... back panel glued, battery, glued immensely and with all other parts out, about 6mm space only at the bottom to get a tool in to pry it out.

New screen (off brand) ~200... all genuine parts amazon refurb ~230... figured id have some extra hardware for idk what... i like hardware and can write drivers so why not.

Figured id save a bit of time and avoid other potentially damaged (water) components to just swap out the mobo unit that had my storage.

Put it back together, first checked that my sim was recognised since this carrier required extraneous info when registering the dev... worked fine... fingerprint worked fine, brave browser too...

Then i open chrome. It tells me im offline... weird cuz i was literally in a discord call. My wifi says connected to the internet (not that i wouldn't have known the second there was a network issue... i have all our servers here and a /28 block... ofc i have everything scripted and connected to alert any dev i have, anywhere i am, the moment something strange happens).

Apparently google doesnt like the new daughter board(i dislike the naming scheme... its weird to me)... so anything that is controlled by google aside from the google account that is linked to non-google reliant apps like this... just hangs as if loading and/or says im offline.

I know... itll only take me about the 5-10m it took to type this rant but ffs google... why dont you even have an error message as to what your issue is... or the simple ability to let me log in and be like 'yup it's me, here's your dumb 2fa and a 3rd via text cuz you're extra paranoid yet dont actually lock the account or dev in any way!'

I think it's a toss up if google actually knows that it's doing this or they just have some giant glitch that showed up a couple times in testing and was resolved via the methods of my great grama- "just smack it or kick it a few times while swearing at it in polish. Like reaaaally yelling. Always worked for me! If not, find a fall guy."

Ok, I'm actually raging at vuejs right now, and this is coming from my second year using it.

the fucking shit is weird.
functional components cannot use v-model.
functional components also cannot reference other components via components property, that child component needs either to be global or be injected (an ugly hack).

v-model behaves differently on checkboxes. checkboxes are fucking shit on vue. things update or do not update.

functional components with checkboxes? hahahahahaha.

vue 3 is taking an ungodly shitload of fucking amount of time.

fuck react, but im actually considering giving vue the middle finger as well.

started this product migration 2 months ago and regretting it, looking at svelte with curious eyes.

make some projects that keep me going so I can quit job and really focus on them without weird pressure from outside. If its not my day, it happenes. If I have **that** idea at 2AM Im not bothered to wake to job and just write it, than refactor it so it's more of "proper" thing and release new feature/thingy

I have so much ideas piled up and so little time ;-;

E: forgotten to add wk176 tag :/

my co-worker is do damn weird... he's invisible... maybe coz im not working
#wk32

Sometimes I really hate offshore desktop support... yes I know Visual Studio 15 was installed, and works. But now Python tools was uninstalled in a forced update that corrupted my VS and now I can't install PTVS(not that I need VS has the vim emulator that I can install at work, it's a whole mess of weird security policies.) fucking hate windows and visual studio. Fucking listen what Im telling you the issue is. I need your dumbass to uninstall this shit software so I can do a clean install since the shitty as software management system doesn't so shit when it say's "uninstalling".

On a side note, this fuckwit just tried to explain what the screenshot tool and how to use it... it's only pinned to my taskbar and menu for shits and gigs since I don't use it everyday to tell the stupid data entry analysts I deal with to fuck off.

Let me rant! I don’t usually do this but this is just frustrating and draining. Please tell me if im wrong. We have authentication that needs to be refactored. I was assigned on this issue. Im a junior btw. I also attached an image of my proposals. The issue of the old way of our signup process is that when validation fails they will keep on accepting the TaC (terms and conditions) and on our create method we have the validation and creating the user. Basically if User.create(user_params) create else throw invalid end. (Imma take a photo later and show it you)which needs to be refactored. So I created a proposal 1. On my first proposal I could create a middleware to check if the body is correct or valid if its valid show the TaCs and if they accept thats the moment the user is created. There is also additional delete user because DoE told me that we dont need middlewares we have before and after hooks! (I wanted to puke here clearly he doesn’t understand the request and response cycle and separation of concerns) anyway, so if middleware is not accepted then i have to delete the user if they dont accept the TaCs. Proposal 2. If they dont want me to touch the create method i could just show the TaCs and if they dont accept then redirect if they do then show form and do the sign process.

This whats weird (weird because he has a lot of experience and has master or phd) he proposes to create a method called validate (this method is in the same controller as the create, i think hes thinking about hooks) call it first and if it fails then response with error and dont save user, heres the a weird part again he wants me to manually check on each entity. Like User.find_by_email(bs@g.com) something like that and on my mind wtf. Isnt it the same as User.create(user_params) because this will return false if paras are invalid?? (I might be wrong here)

This is not the first time though He proposes solutions that are complex, inefficient, unmaintainable. And i think he doesnt understand ruby on rails or webdev in particular. This the first time i complained or I never complained because im thinking im just a junior and he hs more experience and has a higher degree. This is mot the case here though. I guess not all person who has a higher degree are right. To all self thought and bachelors im telling you not all people who went to prestige university and has a higher degree are correct and right all the time. Anyway ill continue later and do what he says. Let me know if im wrong please. Thanks

!Rant

I have this weird feeling today that i feel imcomplete, then for some reason i reinstalled dev rant, now im complete

So i recently inherited some legacy code.
Its actually not to bad. Just a few thousand locs which are mostly stretched across a handfull of functions lmao (800lines per function yay).

So the main thing i wana ask. Does someone here know of good techniques to gradually reimplement all of this.
Since im not gonna apply bandaids to this mess anymore than is needed.

Unfortunately this is a very important system and it only runs on production xD.

Idealy i would somehow be able to duplicate the tcp traffic to the reimplementation but that doesnt seem feasible.

Also what the individual modules classes and so on do wa snever documented and no one even knows how or why certain things even exist.

If anyone has any idea of what i can do. Apart from hoping to god i dont miss any weird quirky edge cases. Do let me know

Is it normal for US based companies to lowball EU based remote senior hires that much?

Just had this weird experience:

Applied to a US based company as a remote senior android dev.

Told them my rate was 55usd/hour.

Their internal recruiter who is based in Poland told me that their budget is max 45 usd/hour max for a senior role.

I was like ok maybe its worth a shot.

Passed the initial interview, did the technical interview, seemed like I did really great.

Today I receive an offer from that recruiter of 30 usd/hour. Feedback was that Im senior in some areas but in most of them Im a "really strong mid level" so they cant offer senior rate for me. Right now Im thinking of how to respond to that.

What is this? Seniors are expected to know everything 100 percent? Every senior I worked with usually specializes in 2-3 areas and looks up others as he goes. I guess shes trying to lowball me or something.

To be honest this is hilarious for me. If I wanted I could land a contracting gig with same 30usd/hour in my city 5 miles away from my home (Im based in Latvia, capital city Riga). But this is US based company so what the heck? Am I being gaslighted? Or is this rate the new normal?

Maybe Im being delusional here, should I manage my expectations or something?

Can you share your experiences with negotiating hourly rates as a senior dev and what rates you guys charge for EU/US B2B contracts?

So i bribed a fellow dev/friend who HATES php and Magento... to help me grind out a Magento site while im super behind on a bunch of crap that's mostly boring administrative bs (#ReluctantlyInCharge)

He knew I was coding in python several times over the past several months... yet, despite my near constant griping of formatting bs and high preference of basically anything that doesnt require readability-esq formatting... he apparently didnt get it.

I need to make a quick splash page with a timer on it (other cool elements that i dont think ive ever seen done but i figured why not... weird shit is totally on brand here... like scripting page elements to change and see if people catch on... in very basic ways)...

I know js plenty... but I'd likely have looked up the syntax, was lazy, he loves js (for the intended purpose... he does a lot of blockchain dev) so i asked if hed write me a quick timer line cuz... well im lazy.

He totally overcomplicated it and sends me a page he typed up incl html header. Timer was 3 short block/lines with semicolons... i laughed and wondered why he did all that instead of just the little js... he didnt know either. I told him as a courtesy id make sure to keep the js formatting as he wrote it instead of 1 line...

He sends me 2 examples of a js timer in 1 line... like 1semicolon... i had to show him what i actually meant... 3 'lines' with semicolons on 1 visual line...

He was stunned, then realised i must really hate python

why the fuck do interviews ask me about architecture and shit?

the role of a normal code monkey ur hiring for probably doesnt have the code monkey making the architecture decisions

i dont make the architecture decisions in my current role either

im happy to learn, and point out if i think things are weird when encountering specifications , but goddamn fuck off

So at my school, the first 10 minutes of school is like when we can do whatever we want. Earlier in the morning i had been making a nodejs password manager thing just so i could try some things out. It also used bash so i could make it like a cli. I was debugging because my database viewer said that the table was empty but for whatever reason it still worked when i put things in it. So i had the db viewer open and terminal open and the teacher comes along."Woah are you like hacking a server" he said. Everybody around me started staring at me. I told him no im not. A couple minutes later he comes around again. The db viewer was closed and i was just in terminal trying to see if some changes worked. He said "Is this like the matrix or something???". I remembered i had a cmatrix package thing installed. I ran it. W O A H everybody around we was like. Luckily most people knew that
1. It wasnt hacking
2. I dont do hacking
3. I was doing it as a joke.
Although he must of been thinking that i was like a hardcore hacker in his class. Was weird and funny.

Guys I need your help.
Im a guy used to java development, so used to nice assisting IDEs.
Turns out my boss has a very complex and not very organized server written in Dlang which im supposed to add a semi-complex functionality in.
So far I have a Linux-Mint VM running a docker container able to build the system. Now I'm really not used to editing code without an IDE and all IDEs I tried on windows or Linux dont seem to work (maybe due to minimal knowledge in Linux and D).
Furthest I got was to get Visual Studio set up with Visual D, but it wasnt able to import the dub
project giving weird unsearchable errors.

Is there anyone out there able to get me started with an IDE? The server is on a github-repository, is a dub project and has a few dependencies.
I'm just totally lost.

I feel like I'm living in an unreal world at the moment. People here are actually eager to sometimes leave their job, but I just I had my last day here and the goodbye drinks, and Im actually sad to leave this company.

I was not forced out, but the TLDR is that this company has quite a substantial financial bump a few months back. I literally graduated yesterday, so back then I was like I needed a somewhat stable company to actually start my work life (although I worked for 2 years at this company during school). At the same time this company (which is financially going uphill again) made me a very generous offer to stay, which I did not deny nor accepted because I'm already committed to this new company I'm going to start at this Monday.

Really weird feelings, and I'm truly sad to leave. Especially after having one to one's with my close colleagues who genuinely praised me for my skills, from who I also know that in no way they are influenced by the boss of the company.

Man, I doubt any have been in a similar situation, but is there any advice which could make more confident I made the right decision that I stopped working here?

I have a question about modeling a UI to code

Lets say you have a UI finished

Now you need to model it to code

For simplicity ignore functionality just focus on designing the model classes

For further simplicity Imagine that the UI is grouped into material cards.

Lets say the UI of the User Profile Page looks like this:

1) HEADER
- user profile banner
- user profile image
- username
- first and last name
- total posts
- total likes
- button to add to favorites
- dropdown to report user
- button to share profile

2) BIO
- short description
- user birthday
- location

3) ANNOYNCEMENTS
- "X% off on Y"
- "going live at X:YZ"
- etc

4) GALLERY
- group of images posted on profile timeline

5) TIMELINE
- text/video/audio
- number of likes on post
- user profile image
- username
- user first and last name
- post date
- etc

---

Now im having a mixed feeling what is right thing to do. In my User model i have a date of birth field among other fields as well as profile image url to s3 bucket. This means that i already have half the information for HEADER card from User model, but now i would need to create a Profile model to fill in the remaining fields.

Especially for BIO card:
- short description (Profile model)
- user birthday (User model)
- location (Profile model)

Is this weird? Mixing data with 2 models on 1 page on 1 or multiple card sections?

This feels messy to me and as if im gonna hit a wall if i continue long enough like this. A better solution to me is to have a Profile model handle everything on the Profile page and be able to cover all cards and fields on each card. But this doesnt seem like a realistic or possible way to do it since specific fields are required for User model.

Am i overcomplicating and overthinking this shit?

Tell me is it normal to mix 2 or more different models to show data in 1 card on 1 page or how would you suggest doing it better?

The Youth

How is the youth?

Pretty good question we don´t really like to communicate to older people well actually most of us have a mental issue, I know it´s kind of sad but when life gives you lemons you use them to make girls cry and that our way of thinking “I´m gonna die anyways lrts do something epic” cuz we aren't afraid to talt to the president of the united states of America like this but we are to scared to order mcdonalts of our self. I mean it´s a aspect that everyone knows we don´t know that person could be a murder of maybe that´s a little to over the top but like we just don´t like it OK.

You may ask what dose she mean with mental health issues?

Well we all know the good old depression its just that we life in a world in that you have to be perfect and when you are´t than you are a disappointment your parents want you to be a doctor or lawyer or something like that because it´s a well payed job but your generation wants to be creative we need our space to crate need things and do something amazing but this world is just a weird place were everyone has to be perfect and follow a ideal. Your appearance dosen´t describes how you are not everyone that has tattoos is a criminal or dose drugs nobody talks about the real problems.

What are the real problems?

Let me tell you we life in a world were nobody talks abou suicide nobody want´s to hear about it let me tell a fact.

Every 40 seconds somebody dies because of suicide.

Suicide is like a terror act when you were close to that person you got completely destroyed if you were far away than you got hurt but not as bad as the persons who were close. But nobody talks about this because it´s not “normal” that makes the persons who need help not reach out because they think its´s not okay.Stop the silence and help :)
But how dose it feel to have depression?

Well you can describe it as this:

it´s as you would lock yourself in a room with just a window but that window dose not have a handle but a curtain that closes every day a little more until there is no light anymore and the first days after that happens you will be scared and lonely and it will hunt you down but depressed people have to life like this every day and it becomes a normal state of mind until they decide they aren´t worth living anymore and they try to kill themselves. It hurts to see all those people die but it is the truth and truth is´t always fun.

Why am I writing this?

Honestly im asking myself that but it just feels right to tell wahts in my mind because a lot of people feel like they are tongue tied and can´t say what they are thinking and feeling and don´t express themselves. And also in my head is a lot wrong but at least I feel like I am doing something while writing this. I am one of the generation Z and I am proud that our generation has all this strength to fight for LGBT+ community and the black life's and I am proud that we understood that all this community's have to be respected because all people are on this earth and we all have to survive somehow and it dose not matter what skin color you have or sexual orientation.

But these are just my thoughts I hope everyone is doing well druing these times.

And to everyone I am proud of you and I love you.

So last Friday I orders my new camera (Canon EOS 1300D) from Amazon with prime NEXT day delivery
It didn't turn up Saturday even tho I got told it would but I got £20 credit from them for their fuck up.
I was told it would be delivered early the next say (Sunday) and by 3pm it was still not there... Got another £5 from them for their fulse promises.
It arrived later that night at 6:30pm

So yesterday I ordered a tripod using my credit and next day delivery for today and im just wondering of it will arrive or not.

Weird thing is, The reason it was not delivered was because of "network problems"...

//not a rant
Ok so weird bug. Fellow C# people, help me out.

//already made it work so no I don't need to post it on SO

I write a Switch Case block based on the user's combo-box selection id.
if id 0, add everything to the mainpage grid
if 1, a foreach loop filtering out the ones with a certain attribute of the object as false and adding em to the grid on the mainpage
if 2, similar scenario as 1.
Countless times I had a null exception with the "count" variable being the number of items in the post which, wasn't null. there was no other variable that was being initialized from within the block, so I had no idea what was causing it.
Moving to an if-else statement doing the same thing, same issue.
In the end I created 2 empty lists before the switch case and filled them up and then another loop filling the mainpage grid with the now-filled list.
In the end im doing the same thing, with no issues, but I don't understand why adding it directly caused an error, what was null?
I wanna understand the working that might be causing this.. if anyone else came across this, would be glad to hear from you

I hardly run into weird bugs at work anymore, im scared that i might stopped progressing as a programmer.

How do you deal when you are overpromising and underdelivering due to really shitty unpredictable codebase? Im having 2-3 bad sprints in a row now.

For context: Im working on this point of sale app for the past 4 months and for the last 3 sprints I am strugglig with surprises and edgecases. I swear to god each time I want to implement something more complex, I have to create another 4-5 tickets just to fix the constraints or old bugs that prevent my feature implementation just so I could squeeze my feature in. That offsets my original given deadlines and its so fucking draining to explain myself to my teamlead about why feature has to be reverted why it was delayed again and so on.

So last time basically it went like this: Got assigned a feature, estimated 2 weeks to do it. I did the feature in time, got reviewed and approved by devs, got approved by QA and feature got merged to develop.

Then, during regression testing 3 blockers came up so I had to revert the feature from develop. Because QA took a very long time to test the feature and discover the blockers, now its like 3 days left until the end of the sprint. My teamlead instantly started shitting bricks, asked me to fix the blockers asap.

Now to deal with 3 blockers I had to reimplement the whole feature and create like 3 extra tickets to fix existing bugs. Feature refactor got moved to yet another sprint and 3 tickets turned into like 8 tickets. Most of them are done, I created them just to for papertrail purposes so that they would be aware of how complex this is.

It taking me already extra 2 weeks or so and I am almost done with it but Im going into really deep rabbithole here. I would ask for help but out of other 7 devs in the team only one is actually competent and helpful so I tried to avoid going to him and instead chose to do 16 hour days for 2 weeks in a row.

Guess what I cant sustain it anymore. I get it that its my fault maybe I should have asked for help sooner.

But its so fucking frustrating trying to do mental gymnastics over here while majority of my team is picking low hanging fruit tasks and sitting for 2 weeks on them but they manage to look good infront of everyone.

Meanwhile Im tryharding here and its no enough, I guess I still look incompetent infront of everyone because my 2 weeks task turned into 6 weeks and I was too stubborn to ask for help. Whats even worse now is that teamlead wants me to lead a new initiative what stresses me even more because I havent finished the current one yet. So basically Im tryharding so much and I will get even extra work on top. Fucking perfect.

My frustration comes from the point that I kinda overpromised and underdelivered. But the thing is, at this point its nearly impossible to predict how much a complex feature implementation might take. I can estimate that for example 2 weeks should be enough to implement a popup, but I cant forsee the weird edgecases that can be discovered only during development.

My frustration comes from devs just reviewing the code and not launching the app on their emulator to test it. Also what frustrates me is that we dont have enough QA resources so sometimes feature stands for extra 1-2 weeks just to be tested. So we run into a situation where long delays for testing causes late bug discovery that causes late refactors which causes late deliveries and for some reason I am the one who takes all the pressure and I have to puloff 16 hour workdays to get something done on time.

I am so fucking tired from last 2 sprints. Basically each day fucking explaining that I am still refactoring/fixing the blocker. I am so tired of feeling behind.

Now I know what you will say: always underpromise and overdeliver. But how? Explain to me how? Ok example. A feature thats add a new popup? Shouldnt take usually more than 2 weeks to do my part. What I cant promise is that devs will do a proper review, that QA wont take 2 extra weeks just to test the feature and I wont need another extra 2 weeks just to fix the blockers.

I see other scrum team devs picking low hanging fruit tasks and sitting for 2 weeks on them. Meanwhile Im doing mental gymnastics here and trying to implement something complex (which initially seemed like an easy task). For the last 2 weeks Im working until 4am.

Im fucking done. I need a break and I will start asking other devs for help. I dont care about saving my face anymore. I will start just spamming people if anything takes longer than a day to implement. Fuck it.

I am setting boundaries. 8 hours a day and In out. New blockers and 2 days left till end of the sprint? Sorry teamlead we will move fixes to another sprint.

It doesnt help that my teamlead is pressuring me and asking the same shit over and over. I dont want them to think that I am incompetent. I dont know how to deal with this shit. Im tired of explaining myself again and again. Should I just fucking pick low hanging fruit tasks but deliver them in a steady pace? Fucking hell.