Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "push failed"
-
The moment when you're failing the university, you desperately wish to drop out of it and your parents push you to inhuman amounts of things to get you to finish the bloody thing when not even a bachelor's degree will ever help you in anything and it seriously wasted 5 years of "studying" about things in food technology that were there in the USSR. I think you failed to notice that 26 years have gone after that. More years than my age is, basically, and the tech has moved forward so much I will never be able to utilise at least 80% of what I was "taught". Yeah, it's nice pretending you're somehow smarter than everyone else in your room when you have a degree like that, right?
I'm studying at a professional college right now and it's 11 AM to 5 PM five days of the week. How am I supposed to be able to combine a university that never helps one even fucking slightly if you have a job or something similar? And it also insists that it won't take away grades if you don't go there, but simultaneously it actually does that. I'm the type who cannot be made to do something in some cases even if there is no other way perceivable.
I just want to get a goddamn job that pays, but I need something that gives me salary of at least about 1000 USD equivalent to just be able to hopefully rent a small flat and have some money to spare.
Now I have to be going to the college. I might end up getting my PC taken away from me a THIRD time since me and my friends built it. And it's only been a bit more than a year since that :|
Did I tell you my age? 23.
And these people(my parents), think they can bitch, moan, take things away from me(the things that helped me all my life to not go insane from their actions), then scream at and even hit me if I don't act 100% the way they want me to.
AND THEY WILL SAY THEY WANT ME TO SUCCEED AND THAT THEY STAND FOR MY FREEDOM.
If there is some force that can help me out of this, I summon thee!
/endrant.
Sorry for that. I needed to have that out of my system.34 -
So, i tried to demonstrate my roommate how many people push their credentials to github by searching for "password remove" commits.
I decided to show him the file and noticed something interesting. A public IP, and mysql credentials.
I visit the IP and what do i see there, a directory listening with a python script, with injects the database into a webpage (???) and a log of all http requests. Lots of failed attacks aiming at the PHP CGI. Still wondering how they failed on a python server 🤔🤔🤔
Edit phpmyadmin to connect to the mysql database. Success.
Inserted a row telling him the his password is on github. Maybe i should also have told him how to actually remove it. 😅
Yes, root can login from %
This is how far i can get with my current abilities.
------------------------------
Scary how insecure this world is.4 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Dev: “Ughh..look at this –bleep- code! When I execute the service call, it returns null, but the service received a database error.”
Me: “Yea, that service was written during a time when the mentality was ‘Why return a service error if the client can’t do anything about it?’”
Dev: “I would say that’s a misunderstanding of that philosophy.”
Me: “I would say it’s a perfectly executed example of a deeply flawed philosophy.”
Dev: “No, the service should just return something that tells the client the operation failed.”
Me: “They did. It was supposed to return a valid result, and the developer indicated a null response means the operation failed. How you deal with the null response is up to you.”
Dev: “That is stupid. How am I supposed to know a null response means the operation failed?”
Me: “OK, how did you know the operation failed?”
Dev: “I had to look at the service error logs.”
Me: “Bingo.”
Dev: “This whole service is just a –bleep-ing mess. There are so many things that can go wrong and the only thing the service returns is null when the service raises an exception.”
Me: “OK, what should the service return?”
Dev: ”I don’t know. Error 500 would be nice.”
Me: “Would you know what to do with error 500?”
Dev: ”Yea, I would look at the error log”
Me: “Just like you did when the service returned null?”
<couple of seconds of silence>
Dev: “I don’t know, it’s a –bleep-ing mess.”
Me: “You’re in the code, change it.”
Dev: “Ooohhh no, not me. The whole thing will have to be re-written. It should have been done correctly the first time. If we had time to do code reviews, I would have caught this –bleep- before the service was deployed.”
Me: “Um, you did.”
<a shocked look from Dev>
Dev: “What…no, I’ve never seen this code.”
Me: “I sat next to Chuck when you were telling him he needed to change the service to return null if an exception was raised. I remember you telling him specifically to pop-up an error dialog ‘Service request failed’ to the user when the service returned null.”
Dev: “I don’t remember any of that.”
Me: “Well, Chuck did. He even put it in the check-in comments. See…”
<check in comments stated Dev’s code review and dictated the service return null on exceptions>
Dev: “Hmm…I guess I did. –bleep- are you a –bleep-ing elephant? You –bleep-ing remember everything.”
<what I wanted to say>
No, I don’t remember everything, but I remember all the drive-by <bleep>-ed up coding philosophies you tried to push to the interns and we’re now having all kinds of problems I spend waaaaay too much time fixing.
<what I said, and lied a little bit>
Me: “No, I was helping Nancy last week troubleshoot the client application last week with the pop-up error. Since the service returned a null, she didn’t know where to begin to look for the actual error.”
Dev: “Oh.”1 -
if people are curious of the PTSD baggage i'm carrying and why i rage so much at everything, see attached picture
granted, this was partly my fault, as i said, i was far too nice, and stayed for far too long
also note this job was AFTER a 2+ previous e-commerce job with ultimately failed project and little pay
UG i mean LOOK at this... i could go on and on for hours "push notifications must run" - yeah a casual bullet point that needs to be finished by end of day? hahahaha20 -
Long time ago, back in a day of Microsoft Office 95 and 97, I was contracted to integrate a simple API for a payment service provider.
They've sent me the spec, I read it, it was simple enough: 1. payment OK, 2. payment FAILED. Few hours later the test environment was up and happy crediting and debiting fake accounts. Then came the push to prod.
I worked with two other guys, we shut down the servers, made a backup, connected new provider. All looked perfectly fine. First customers were paying, first shops were sending their products... Until two days later it turned out the money isn't coming through even though all we are getting from the API is "1" after "1"! I shut it off. We had 7 conference calls, 2 meetings, 3 days of trying and failing. Finally, by a mere luck, I found out what's what.
You see, Microsoft, when you invent your own file format, it's really nice to make it consistent between versions... So that the punctuation made in Microsoft Word 97 that was supposed to start from "0" didn't start from "1" when you open the file in Microsoft Word 95.
Also, if you're a moron who edits documentation in Microsoft Word, at least export it to a fucking PDF before sending out. Please. -
When I was at university in my last semester of my bachelor's, I was doing a game programming paper and our last assignment was to group up and make a game. So I go with one of the guys I know and this other dude since his previous game was really neat. Then two randoms joined that from my first impressions of their games wasn't much at all (one guy made four buttons click and called it a game in Java when we had to make games in c++ and the other guy used an example game and semi modded it.
Anyways we get to brain storming, totally waste too much time getting organised because the guy that volunteered (4 buttons guy) was slow to getting things sorted. Eventually we get to making the game and 4 buttons guy hasn't learnt how to use git, I then end up spending 3 hours over Skype explaining to him how to do this. He eventually learns how to do things and then volunteers to do the AI for the game, after about a week (this assignment is only 5 weeks long) he hasn't shown any progress, we eventually get to our 3rd week milestone no progress from him and the modder, with only three classes left we ask them both to get stuff done before a set deadline (modder wanted to do monsters and help 4 buttons with AI) both agreed and deadline rolls up and no work is shown at all, modest shows up extremely late and shows little work.
4 buttons guy leaves us a Skype message the day of our 2nd to last class,, saying he dropped the paper...
Modder did do some work but he failed to read all the documentation I left him (the game was a 2d multiplayer crafting game, I worked so hard to make a 2d map system with a world camera) he failed to read everything and his monsters used local coordinates and were stuck on screen!
With about a week left and not too many group meetings left we meet up to try and get stuff done, modder does nothing to help, the multiplayer is working my friend has done the crafting and weapon system and the map stuff is working out well. We're missing AI and combat, with our last few hours left we push to get as much stuff done, I somehow get stuck doing monster art, AI is done by the other two and I try to getting some of the combat and building done.
In the end we completely commented all of modders work because well it made us look bad lol. He later went to complain to my free claiming I did it and was a douchebag for doing so. We had to submit our developer logs and the three of us wrote about how shitty it was to deal with these two.
We tried out best not to isolate ourselves from them and definitely tried to help but we were swamped with our other assignments and what we had to work on.
In the end leaving and not helping right when the deadline is close was what I call the most shittiest thing team mates can do, I think sticking together even if we were to fail was at least a lot better.3 -
"four million dollars"
TL;DR. Seriously, It's way too long.
That's all the management really cares about, apparently.
It all started when there were heated, war faced discussions with a major client this weekend (coonts, I tell ye) and it was decided that a stupid, out of context customisation POC had that was hacked together by the "customisation and delivery " (they know to do neither) team needed to be merged with the product (a hot, lumpy cluster fuck, made in a technology so old that even the great creators (namely Goo-fucking-gle) decided that it was their worst mistake ever and stopped supporting it (or even considering its existence at this point)).
Today morning, I my manager calls me and announces that I'm the lucky fuck who gets to do this shit.
Now being the defacto got admin to our team (after the last lead left, I was the only one with adequate experience), I suggested to my manager "boss, here's a light bulb. Why don't we just create a new branch for the fuckers and ask them to merge their shite with our shite and then all we'll have to do it build the mixed up shite to create an even smellier pile of shite and feed it to the customer".
"I agree with you mahaDev (when haven't you said that, coont), but the thing is <insert random manger talk here> so we're the ones who'll have to do it (again, when haven't you said that, coont)"
I said fine. Send me the details. He forwarded me a mail, which contained context not amounting to half a syllable of the word "context". I pinged the guy who developed the hack. He gave me nothing but a link to his code repo. I said give me details. He simply said "I've sent the repo details, what else do you require?"
1st motherfucker.
Dafuq? Dude, gimme some spice. Dafuq you done? Dafuq libraries you used? Dafuq APIs you used? Where Dafuq did you get this old ass checkout on which you've made these changes? AND DAFUQ IS THIS TOOL SUPPOSED TO DO AND HOW DOES IT AFFECT MY PRODUCT?
Anyway, since I didn't get a lot of info, I set about trying to just merge the code blindly and fix all conflicts, assuming that no new libraries/APIs have been used and the code is compatible with our master code base.
Enter delivery head. 2nd motherfucker.
This coont neither has technical knowledge nor the common sense to ask someone who knows his shit to help out with the technical stuff.
I find out that this was the half assed moron who agreed to a 3 day timeline (and our build takes around 13 hours to complete, end to end). Because fuck testing. They validated the their tool, we've tested our product. There's no way it can fail when we make a hybrid cocktail that will make the elephants foot look like a frikkin mojito!
Anywho, he comes by every half-mother fucking-hour and asks whether the build has been triggered.
Bitch. I have no clue what is going on and your people apparently don't have the time to give a fuck. How in the world do you expect me to finish this in 5 minutes?
Anyway, after I compile for the first time after merging, I see enough compilations to last a frikkin life time. I kid you not, I scrolled for a complete minute before reaching the last one.
Again, my assumption was that there are no library or dependency changes, neither did I know the fact that the dude implemented using completely different libraries altogether in some places.
Now I know it's my fault for not checking myself, but I was already having a bad day.
I then proceeded to have a little tantrum. In the middle of the floor, because I DIDN'T HAVE A CLUE WHAT CHANGES WERE MADE AND NOBODY CARED ENOUGH TO GIVE A FUCKING FUCK ABOUT THE DAMN FUCK.
Lo and behold, everyone's at my service now. I get all things clarified, takes around an hour and a half of my time (could have been done in 20 minutes had someone given me the complete info) to find out all I need to know and proceed to remove all compilation problems.
Hurrah. In my frustration, I forgot to push some changes, and because of some weird shit in our build framework, the build failed in Jenkins. Multiple times. Even though the exact same code was working on my local setup (cliche, I know).
In any case, it was sometime during sorting out this mess did I come to know that the reason why the 2nd motherfucker accepted the 3 day deadline was because the total bill being slapped to the customer is four fucking million USD.
Greed. Wow. The fucker just sacrificed everyone's day and night (his team and the next) for 4mil. And my manager and director agreed. Four fucking million dollars. I don't get to see a penny of it, I work for peanut shells, for 15 hours, you'll get bonuses and commissions, the fucking junior Dev earns more than me, but my manager says I'm the MVP of the team, all I get is a thanks and a bad rating for this hike cycle.
4mil usd, I learnt today, is enough to make you lick the smelly, hairy balls of a Neanderthal even though the money isn't truly yours.4 -
"I don't have any issues with that (OS, code push, software, etc), so I'm not sure why you are having issues." I love reading comments like that, as if that solves the issue. The fuck does it matter if you don't have issues, they are having issues you moron. For a place for developers you'd think they'd be able to think logically, maybe they're in the wrong line of business. Maybe that software had an error parsing some file because some bit got flipped when writing to the HDD because there's an issue with the drive and the ECC failed for some reason, who cares. There's an issue and you saying it works for you makes you sound like a fucking moron... There's an error/crash, it happens, that's software.4
-
First day of the academic year(CS):
(some uni official) - "And remember to become a good programmer you have to become an excellent mathematician first"
(Me): Oh shit.
Little did I know...
It is a second year now. And the only course I failed is the one that he lectured.
I had no fucking idea that people like this (mad)man exist.
Almost at every lecture he was introducing at leas one topic that was way beyond our program; as he thought they were interesting and "fun".
Many teachers at the University refered to him as a very 'ambitious' man. Then I didn't blame him he truly loved his profession and wanted to share as much knowledge as possible(I thought).
But two months ago he went to far. It was a second exam(for those who failed the first one). And believe me there were a few(60 out of 160 to be exact).
Only ~30 people showed up as the rest failed to many courses and would be kicked out of the uni anyway.
He was handing out the exams when I saw that whoever gets one slowly starts turning white.
I finally got my copy and immediately I realized that the tasks are from his favorite topics, the "fun" ones. 🤦
At this point I knew that it will be extremely hard to pass. But when I was reevaluating my life choices something draw my attention.
One of the tasks had a note below it: "Homework after the exam: It is a very interesting problem just assume x instead of y and try to solve it. PS: it is a lot of fun!"
At this point I lost it.😠 I don't care how much you love math, you should always assume that not everyone loves it as much as you do. So don't push it down the throat of people who clearly don't need a degree in this subject!
Now I'm preparing for the second semester with this guy. And I have a strong feeling that it will be hell of a ride... again.😐
BTW: Sorry that the rant is so long, it's the first one I wrote, and had to share it with someone 😀18 -
In case of emergency:
1. git commit
2. git push
3. Leave building
> Failed to push some refs. To prevent you from losing history, non-fast-forward updates were rejected. Merge remote changes before pushing again.
🤦2 -
Still on the primenumbers bender.
Had this idea that if there were subtle correlations between a sufficiently large set of identities and the digits of a prime number, the best way to find it would be to automate the search.
And thats just what I did.
I started with trace matrices.
I actually didn't expect much of it. I was hoping I'd at least get lucky with a few chance coincidences.
My first tests failed miserably. Eight percent here, 10% there. "I might as well just pick a number out of a hat!" I thought.
I scaled it way back and asked if it was possible to predict *just* the first digit of either of the prime factors.
That also failed. Prediction rates were low still. Like 0.08-0.15.
So I automated *that*.
After a couple days of on-and-off again semi-automated searching I stumbled on it.
[1144, 827, 326, 1184, -1, -1, -1, -1]
That little sequence is a series of identities representing different values derived from a randomly generated product.
Each slots into a trace matrice. The results of which predict the first digit of one of our factors, with a 83.2% accuracy even after 10k runs, and rising higher with the number of trials.
It's not much, but I was kind of proud of it.
I'm pushing for finding 90%+ now.
Some improvements include using a different sort of operation to generate results. Or logging all results and finding the digit within each result thats *most* likely to predict our targets, across all results. (right now I just take the digit in the ones column, which works but is an arbitrary decision on my part).
Theres also the fact that it's trivial to correctly guess the digit 25% of the time, simply by guessing 1, 3, 7, or 9, because all primes, except for 2, end in one of these four.
I have also yet to find a trace with a specific bias for predicting either the smaller of two unique factors *or* the larger. But I haven't really looked for one either.
I still need to write a generate that takes specific traces, and lets me mutate some of the values, to push them towards certain 'fitness' levels.
This would be useful not just for very high predictions, but to find traces with very *low* predictions.
Why? Because it would actually allow for the *elimination* of possible digits, much like sudoku, from a given place value in a predicted factor.
I don't know if any of this will even end up working past the first digit. But splitting the odds, between the two unique factors of a prime product, and getting 40+% chance of guessing correctly, isn't too bad I think for a total amateur.
Far cry from a couple years ago claiming I broke prime factorization. People still haven't forgiven me for that, lol.6 -
There is always that one guy.. who doesn't give a fuck about testing and thinks he's not responsible for them...
Le Guy: lemme just push ma new code maan
Jenkins: Unit Tests failed - pls fix
Le Guy to the one who cares about testing: hey fuck uu, ur stupid tests are failing... fix them its ur problem.
*sigh*7 -
I turned down another women who was absolutely, 100% flirting with me, because, from what I can gather, she was trying to get out of a relationship with her current boyfriend, a military veteran.
I outright ignored her and then when that failed, I made our work relationship 100% about that, work.
Even though I'm friendly with everyone else.
I'm an absolute shit, aren't I? I feel genuinely bad.
I'm not sure if I did it out of a misplaced sense of honor for a dude who obviously has some ptsd, or because I don't feel like I'm able to connect with anyone anymore.
I feel like I'm alone in this world. Not, like, sexually or anything, but more like I don't want to burden anyone with the shit I'm going through. Like a man on a mission on a sinking ship, and it would be wrong to let anyone else on board.
Like a one-man shit-show, all singing, all dancing, driven to one end, with one purpose. And it'd be wrong to let anyone get attached, or invite anyone else in.
Fuck I got so many irons in the fire. I have an ARG in the works, a full game, a social platform that the code and marketing plan is laid out and I'm saving money for, two more games already planned, plus spending an in-ordinate amount of time with my father and sister and mother as they deal with the loss of my sister, plus volunteering to help the homeless, plus working, plus studying.
I barely sleep.
It's just me. I'm like a cruise missile heading to one destination, to some final destination, I just don't know what. And I don't let anyone in, because then they might see how fucking crazy I am, and how crazy my life is, and how crazy my goals are. Thats not a humblebrag. Thats more of a "wholly shit, I'm so in over my head, I'm fucking drowning" type thing. But I'm not giving up, I'm just going deeper.
And it feels like drowning but somehow I'm okay with it. Like I've passed the crux of loneliness, and settled for going for it all, alone, shooting out of orbit, and saying "fuck it all' to everything and everyone. They say "if you got everything you wanted, everything you wished for, you'd wish you hadn't, which is why god isn't a genie". And lately I've been thinking god doesn't exist, or doesn't care, because he's left it all up to me, and I've fucked it up good and proper, and am on my way to either nothing, or everything I've ever wanted.
Is this what happiness feels like? Or suicide?
I don't know. I mean I really don't. I don't want to die. I think I could stop existing and be okay with it. Having achieved at least a modicum of understanding the universe, at least accomplished something small but meaningful.
Or maybe I'm delusional, driven mad with the full comprehension of human floundering against a meandering existence.
I don't fucking know.
I feel like I'm spinning my wheels, so much, that even two weeks feels like a fucking eternity. I don't sleep anymore. When I do, I escape into my dreams, where I can fly, or float, and the people in my dreams tell me I'm living in the matrix and I believe them..in my dreams. Feel it even.
And when I wake up, the feeling persists. Leaves me in wonderland, for hours after waking.
And I have visions, of going homeless, like some buddha, all the time, and then I say "wake up J, you're fucking crazy! You want to go be some couch surfing homeless bum living off other's good graces? get the fuck outa here! While others suffer, schlep it at whatever job they work, day in day out, toil. In this economy? In this inflation? What a dishonest way of thinking. What a dishonest way of dreaming."
And yet I daydream. Because its the only escape there is from all the world has become.
And I bring joy to others, earnestly, vicariously, because its the closest joy I can feel, when I've become numb.
It is this quasi-permanent sense of alienation that permeates my whole world, a sort of invisible force field that separates me from others, even as I reach out to understand them, to comfort them, to smooth the corners off their world, so that they don't become like I have, something not entirely human, but...other.
Often when we meditate, long and hard enough,
at the center that emerges, at the center of ourselves, we find an abyss, a whole universe, devoid of anything, a perfect silence, mirroring back the cosmos, and other people. Observing, silent, irreducible, implacable.
Sometimes I feel like I don't exist. Sometimes I think others don't exist.
Very often I feel like nothing is real. And that I am playing some sort of game. Not like a video game per se, but that there is a bigger pattern, a hidden pattern to it all, just out of reach, and I'm reaching for it but understanding eludes me.
Not that the universe has made me for some special purpose, but merely that the universe observes me specifically, for no special purpose, other than that it can, whatever trivialities may impede or push forward my life.
As if the universe were bored.24 -
Fuck, wanted a year long streak on github but failed at 40 days.
I did code but just had no part finished so didn't commit.
I even have an alarm for committing ffs. I just snoozed it and was like I do it when I finished x. Forgot track of time like always with coding and found out four hours later.
Fuck. Back to one. I just start over, it shouldn't be that hard.
I should change my commit behavior to push if compiles instead of push after complete feature. So, I change the definition of achievement easier to achieve6 -
Me: I have very perfect reason why I did not come to work to day .
Client: Please state your reason .
Me: its silly I don't wanna talk about it.
Client: please do
Me: my index fingers are hurting
Client: why
Me: what do you mean why I was tying to git push heroku master
But every time some json dependency failed -
-$ gulp test
*30 seconds later*
SUCCESS
[oh wait, for got something... Typety type... Fixed. I don't need to rerun gulp test, right?]
-$ git push
*email from CircleCI: BUILD FAILED*
😊🔫 -
This is PART 2/2 of a series of rants over the course of a software engineering course years ago.
We were four team members, two had never failed a class, I’ll refer to them as MT and FT, male and female top students, respectively, and an older student with some real world experience who I’ll refer to as SR.
Rant 6: After the previous drama MT built the groundwork for the project without allowing us to intervene for a week. When he finally disclosed his code he gave us tasks and I was stuck unable to run the new project, due to the friction with MT I asked SR for help which took a couple of days. MT accused us of not wanting to work and claimed he’d just do everything himself. I continued working on the task improving MT’s code and committed the work, which surprised MT and told me I didn’t have to do it. He ended up complimenting my code and complained less about me as a result.
Rant 7: MT kept giving SR flak for not working and took him out of the repo, which I promptly forked just in case he tried anything scummy. SR was indeed working on certain things, but he wasn’t listening to MT’s demands, there was no team coordination. I had to act as a proxy and push some of SR’s changes myself while informing him of the state of things.
Rant 8: When MT finally added SR back and some of the tasks were cleared up, FT didn’t cooperate. She seemed to have zero initiative and always relied on MT to tell her what to do, which didn’t include coordinating with SR to get the front-end templates running. I tried getting them in a group chat but it didn’t work, she just ignored him.
I learned a few things from that.
1. No matter how smart or experienced someone may seem, sometimes people are just petty or take things too personally.
2. Top students are sometimes too focused on their grades and disregard depth of knowledge and work quality.
3. A bad team at college can somehow make something acceptable if everyone works on things that add some kind of value.1 -
When Do You Stop Taking Responsibility?
Let me clarify by describing four scenarios in which you are tasked with some software development. It could be a large or small task. The fourth scenario is the one I'm interested in. The first three are just for contrast.
1. You either decide how to implement the requirements, or you're given directions or constraints you agree with. (If you hadn't been given those specific directions you probably would have done the same thing anyway.) **You feel accountable for the outcome**, such as whether it works correctly or is delivered on time. And, of course, the team feels collectively accountable. (We could call this the "happy path.")
2. You would prefer to do the work one way, but you're instructed to do it a different way, either by a manager, team lead, or team consensus. You disagree with the approach, but you're not a stubborn know-it-all. You understand that their way is valid, or you don't fully understand it but you trust that someone else does. You're probably going to learn something. **You feel accountable for the outcome** in a normal, non-blaming sort of way.
3. You're instructed to do something so horribly wrong that it's guaranteed to fail badly. You're in a position to refuse or push back, and you do.
4. You're given instructions that you know are bad, you raise your objections, and then you follow them anyway. It could be a really awful technical approach, use of copy-pasted code, the wrong tools, wrong library, no unit testing, or anything similar. The negative consequences you expect could include technical failure, technical debt, or significant delays. **You do not feel accountable for the outcome.** If it doesn't work, takes too long, or the users hate it, you expect the individual(s) who gave you instructions to take full responsibility. It's not that you want to point fingers, but you will if it comes to that.
---
That fourth scenario could provoke all sorts of reactions. I'm interested in it for what you might call research purposes.
The final outcome is irrelevant. If it failed, whether someone else ultimately took responsibility or you were blamed is irrelevant. That it is the opposite of team accountability is obvious and also irrelevant.
Here is the question (finally!)
Have you experienced scenario number four, in which you develop software (big as an application, small as a class or method) in a way you believe to be so incorrect that it will have consequences, because someone required you to do so, and you complied *with the expectation that they, not you, would be accountable for the outcome?*
Emphasis is not on the outcome or who was held accountable, but on whether you *felt* accountable when you developed the software.
If you just want to answer yes or no, or "yes, several times," that's great. If you'd like to describe the scenario with any amount of detail, that's great too. If it's something you'd rather not share publicly you can contact me privately - my profile name at gmail.com.
The point is not judgment. I'll go first. My answer is yes, I have experienced scenario #4. For example, I've been told to copy/paste/edit code which I know will be incomprehensible, unmaintainable, buggy, and give future developers nightmares. I've had to build features I know users will hate. Sometimes I've been wrong. I usually raised objections or shared concerns with the team. Sometimes the environment made that impractical. If the problems persisted I looked for other work. But the point is that sometimes I did what I was told, and I felt that if it went horribly wrong I could say, "Yes, I understand, but this was not my decision." *I did not feel accountable.*.
I plan on writing more about this, but I'd like to start by gathering some perspective and understanding beyond just my own experience.
Thanks5 -
If someone has more tenure than you, they dont push 'stack busting changes', your code simply failed to account for the future. 😂
(This is why my former employer is my former employer) -
Little addition on my rant about the enter and leave instructions being better than push mov sub for stackframes:
I had that debate with a friend of mine, who tried the same code ... and failed to get enter to be as fast. Infact, for him, enter was twice as slow, on his older computer even 3times as slow.
Mhh... pretty bad. basically blows up my whole point.
I tried the code on my computer... Can't reproduce the error.
Weird.
"Which CPU are you on?"
>"I'm on Intel"
Both of his computers are on intel. I use an amd ryzeni1600. Now this might be a bit of a fast conclusion, but I think that its safe to say that intel should atleast do better for SOME parts of their CPUs.9 -
"my greatest fear in life is my best not being good enough."
Currently, I am building my second business around blockchain.
I am stacking on using the popularity of cryptocurrency and it's novelty to push the product universal.
My limitation (what I think):
1. My environment - unfortunately I live in a third world country
2. Naivety: I have never scaled a business, failed in my first attempt(this is my second).
3. Lack of fund: my budget is pretty low, and no I dont have a family support to raise any for marekting and promoting the business, so I am let with option of scaling it organically ( what "organically" means is spamming social media, forum's comments section to grow customers
4. Really the only option present: most folks here wont know what it means to be in a state of "survival", failing will cause you suffering.
5. Poor network: My friends, or the people around dont understand, cant comprehen what this means.
Cons:
1. I get to know what it means to carry your idea to the world again, this I hope will improve my knowledge base on business and make me less naive.
2. Portfolio boost: "wow!" that should be people's reaction when I tell them about the project.
3. If I succed, I hope the incentive will take me out of this shit hole.
4. I really want to get out of this shit hole - this should work!2 -
See I'm a curious case.
Back when I graduated high school my father and I started a startup. We build an Android app revolving around personal safety. It was cool. Had news coverage. It flopped.
In the process off the two months time it took me to build the fucker I had to "Learn" Java and the Android SDK enough to push this app out.
I burned myself out and on top of that I felt like I did not really learn the language. So now years later I want to Learn C# for myself for game Development with unity. However I also want to learn Web Development Properly. Which I have tinkered with on and off since the old days of Xhtml when I built a website for my senior project in HS.
I still feel burned out. Anyone else with a similar feel. I know it's silly being burned after one failed project. But it does not help either that I rushed through learning Java did not retain fuck all and now I feel like I can't learn anything new because mental blockage. Even reading this sounds stupid.
Might also be new shiny object syndrome. Between C# and JS. Lol.6 -
Help needed.
My Internet service provider shut GitHub and now it's inaccessible. I can see all Repo's and clone them via VPN but can't push data. Any help regarding how to push data through a VPN or other way would be really helpful.
Thanks.8 -
I just commented a test so the PR passes and the feature reaches next release; I can't fix it (Damn react testing library tests)
but after that, the linter failed for the same PR, so I just fixed it and did a git push -f
I guess once you cross the line you cannot come back
feel my pain1