Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Get a devDuck
Rubber duck debugging has never been so cute! Get your favorite coding language devDuck
Buy Now
-
so i just got fired 🔥 🔥 🔥 because i wanted a 200 fucking dollars raise after 1 year of work and sacrifices and feeling like shit.
200$ because i live in the 3rd fucking world, working with a stupid motherfucking boss (you know the fat old tone deaf cunt), he's american, and he brings projects from the US from clients paying thousands of dollars, and he pays us 300$, and by the fucking way he used to pay us 100$ (we are 3 developers, a dick who does nothing but report our behavior, and a shit who does shit. we are a development company and we are the only developers and we got fired because he thought we didn't deserve the raise and that he sees no reason in giving us more money because we're already wasting the company's money and time).
So now the only people left there are the dick, the shit and the fatass boss who's in the states rn.
the funny thing is after we left by an hour or so we got calls from many other companies that we refused to work with because of our loyal-fucking-ty.
the motherfucker thinks we're conspiring against him, that we don't trust him, well of fucking course we don't, he lies about having a company in the US, well it's there but it's suspended (we looked it up), he says he's a microsoft, intel, adobe, dell, lenovo partner, and he's not.
well fuck i'm kind of happy that i left, i'm sitting with my friends in a cafe right now thinking about finishing our personal projects.
forgot something: the projects we were working on are unfinished, and there's not a single fucker to finish them, so he's ball deep in shit. hope this rant is relatable45 -
BOSS: That icon is not centered, move it slightly to the right
ME: You're wrong, I can garantee you it's centered (it was centered)
BOSS: Well, my eyes are telling me it's not, so move it to the right
ME: (faking increasing margin)
ME: Ok, now it's 10 px to the right, what do you think?
BOSS: it's a great result, now it's perfect! Cant you see the difference?
ME: Absolutely, you do are the real designer here...
BOSS: Ohhh, stop complaining, you'll learn one day...
ME: Yep.18 -
Our Adobe Illustrator teacher(he taught us a bit of Photoshop before), tasked us with entering a contest for a logo design. The company's name is synonymous to amber in my mother tongue, but instead of it doing something related to that they partnered with T.V. services etc and are doing things in the field. The limitation of the contest is that we have to use a specific color in the amber range(given with the CMYK and Pantone values), and if the design ends up a success, one gets nearly 500$.
I have an idea, but I don't know how I will be going about doing it. I'm not great at either design or drawing. My skills in drawing don't match up with my ideas...
I'll still try it.15 -
Github education: You get a bunch of cool free stuff if you are a student.
Intellij: You get all of their IDEs for free if you are a student.
Adobe: You get a discount but you still have to pay 20€ per month as a student.
This is why I love programming and the whole community around it.10 -
Try to open a new PDF. Adobe says it must restart. I click OK, figuring it just needs to restart the reader itself.
Reboots entire computer instead... For a PDF reader update...
Uninstall time!16 -
My experience with Adobe...
(I recently moved to Canada)
Me: I want to give you money. (Tries to pay with Canadian card)
Adobe: Sorry, you have a US account, you must use a US card.
Me: Okay, what are my options to pay with my Canadian card?
Adobe: We have to delete your US account and create a Canadian one.
Me: Okay... Why can't you just switch the country from US to Canada on my account?
Adobe: *bullcrap response*
Me: Okay, delete it and transfer everything.
*Kicks me out of the chat.
*I log back in. Try to reconnect to customer service chat.
Adobe: AdobeID unable to participate in chat.
*I'm 30 minutes into this ordeal
Me: (to myself) I could literally torrent this program in 5 minutes 🤔
Lesson: if a company wants people to not torrent their software make it easier for a willing fucking customer to buy your software!
Since the chat doesn't work anymore, I called customer service and am still on hold.... 😤😤😤
Why does the internet have borders?14 -
Dude comes for an interview for a mobile position - one of the first things he says is "Adobe is killing Flash, don't know why, big mistake."7
-
How to secure yourself from flash 0-day attacks:
1. Uninstall flash
2. Don't reinstall flash
3. Seriously, you don't need flash8 -
Many, many years ago, Apple had this software you could install which allowed you to take full control of someone else's machine. Well, my mate who was a designer worked in a different office downstairs. I was often in their fixing stupid shit problems. While he was out on lunch, i installed and configured the software on his mac. After lunch I went back upstairs and watched his every move on my mac. He was in adobe inDesign creating some design for a brochure. He was in a text box changing the heading, i seized the opportunity and took control typing in the text box "i am a useless cunt", pissing myself, I then selected the text and increased the size and made it bold... then the phone rang.4
-
I just love it when my coworkers talk (troll) about Google Ultron like it's the answer for everything in front of a new dev and he's getting more and more confused thinking "what's this awesome Google product I've never heard about"
And we just know that within the next 30 minutes he will have tears in his eyes of laughing after reading the story and probably also has it 'installed' (like some other devs) on his desktop (http://imgur.com/gallery/W9Pnh)
Have a good chuckle if you haven't read it before:
http://imgur.com/gallery/iJD8f
http://imgur.com/a/AOz0d
Don't forget to download your adobe reader guys.
7 -
Regular day at Adobe:
Intern: Sir, I have created this amazing functionality that will make user's life easy. Shall I push it for review?
Manager: Did you say it will make their life easy?
Intern: Yes Sir!
Manager: Can we fire this intern already?
Adobe, seriously man make up your goddamn mind. Why the fuck are you taking away useful features and making them hidden under hundreds of icons you have. This is so fraustrating 😡7 -
Modern web developer Stater pack
1.Mac with 100 stickers on it
2.Love linux but never used it
3.Border 0px
4.Border radius 2.7px
5.sketch+adobe23 -
Found this gem on GitHub:
// At this point, I'd like to take a moment to speak to you about the Adobe PSD format.
// PSD is not a good format. PSD is not even a bad format. Calling it such would be an
// insult to other bad formats, such as PCX or JPEG. No, PSD is an abysmal format. Having
// worked on this code for several weeks now, my hate for PSD has grown to a raging fire
// that burns with the fierce passion of a million suns.
// If there are two different ways of doing something, PSD will do both, in different
// places. It will then make up three more ways no sane human would think of, and do those
// too. PSD makes inconsistency an art form. Why, for instance, did it suddenly decide
// that *these* particular chunks should be aligned to four bytes, and that this alignement
// should *not* be included in the size? Other chunks in other places are either unaligned,
// or aligned with the alignment included in the size. Here, though, it is not included.
// Either one of these three behaviours would be fine. A sane format would pick one. PSD,
// of course, uses all three, and more.
// Trying to get data out of a PSD file is like trying to find something in the attic of
// your eccentric old uncle who died in a freak freshwater shark attack on his 58th
// birthday. That last detail may not be important for the purposes of the simile, but
// at this point I am spending a lot of time imagining amusing fates for the people
// responsible for this Rube Goldberg of a file format.
// Earlier, I tried to get a hold of the latest specs for the PSD file format. To do this,
// I had to apply to them for permission to apply to them to have them consider sending
// me this sacred tome. This would have involved faxing them a copy of some document or
// other, probably signed in blood. I can only imagine that they make this process so
// difficult because they are intensely ashamed of having created this abomination. I
// was naturally not gullible enough to go through with this procedure, but if I had done
// so, I would have printed out every single page of the spec, and set them all on fire.
// Were it within my power, I would gather every single copy of those specs, and launch
// them on a spaceship directly into the sun.
//
// PSD is not my favourite file format.
Ref : https://github.com/zepouet/...16 -
Thanks Adobe for the such clear icons, I really appreciate your use of descriptive symbols (one is for "view full page", the other is for "activate single page view").
8 -
199$ for game maker studio
Naaa i will just use godot thx
1000$ for 3dx max
Naa will just use blender 3d
899$ for Fl studio
We have lmms
Sublime text 70$
Vscode is better.. i will just use that
Adobe illustrator 19$ a month
Nice try we have Gravit Designer27 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
What is AI?
CS student: Artificial intelligence
Graphics Designer: Adobe Illustrator
Biology student: Anthro Insertion
Pervert: Anal Intercourse
Lesson: be careful with your abbreviations2 -
Protip: Never admit that you know how to use Photoshop and Illustrator. Guess who's drawing all the brainfarts of the PM this week...3
-
I got a spam email from Adobe. I tried to unsubscribe from all their lists. When I clicked submit it went to a 404. Good job, Adobe4
-
"You can't run Slack, Premiere, After Effects AND Photoshop at the same time with only 8 GB RAM!"
Me:
1 -
Hi this isnt actually a rant this is the girlfriend speaking (or typing hihi) i just wanna say how interesting this platform is. Bye 😊👋🏼27
-
The best part of being an university student?
- Microsoft Imagine
- Office 365 for free
- GitHub Student Developer Pack
- JetBrains Product Pack for Students
- Spotify for only €4.99/month (instead of €9.99)
- Discounts for tech products
And if you're lucky also Adobe CC and AutoCAD.
The worst part?
- The university11 -
Wish Adobe would take a similar approach like Microsoft and release their Applications for Linux.. so I could use Photoshop and Lightroom there and ditch OS X completely...10
-
When I opened my digital agency it was me and my wife as developers, I had no savings and I needed to get long contracts ASAP which luckily I did straight away.
Lovely client, had worked for them before as a consultant so i thought it would be a breeze. Let's just say the project should've been named "Naivete, Scope Creep and Anger: The revenge".
What happened is that when this project was poised to end I naively thought I would be able to close the job, so I started looking for a new full time consultancy gig and found one where I could work from home, and agreed a starting date.
Well, the previous job didn't end because of flaws in my contract the client exploited, leaving me locked in and working full time, for free, for basically as long as he wanted (I learned a lot the hard way at that time) and I had already started the new agreed job. This meant I was now working 2 full time shifts, 16 hours per day.
Then, two support contracts of 2 hours per day were activated, bringing my work load to 20 hours/day.
I did this for 4 months.
The first job was supposed to last one month, and I was locked into it, all others had no end in sight which is a good thing as a freelancer, but not when you are locked into a full time one already. I could've easily done one 8 hours shift and two 2 hours jobs per day, but adding another 8 hours on top of it was insanity.
So I was working 10 hours, and sleeping 2. I had no weekends, didn't know if it was day or night anymore, I was locked in my room, coding like a mad man, making the best out of a terrible situation, but I was mentally destroyed.
I was waking up at 10am, working until 8pm, sleeping 2 hours until 10pm, working until 8am, sleeping 2 hours until 10am, and so on. Kudos to my wife for dealing with account and project management and administration responsibilities while also helping me with small pieces of code along the way, couldn't have survived without the massive amount of understanding she offered.
In the end:
- I forcefully closed the messed up contract job and sent all the work done to another digital agency I met along the way, very competent people, as I still cared about the project.
- I missed a deadline on my other full time contract by 2 days, meaning they missed a presentation for Adobe, of all people, and I lost the job
- The other two support contracts were finished successfully, but as my replies were taking too long they decided not to work with us anymore.
So I lost 4 important clients in the span of 4 months. After that I took a break of one month, slept my troubles away, and looked for a single consultancy full time contract, finding it soon after, and decided I wouldn't have my own clients for a good while.
3 years since then, I still don't have the willpower or the resources to deal with clients of my own and I'm happily trudging along as a consultant, while still having middle of the night nightmare flashbacks to that time.2 -
It's a shame that Adobe doesn't support Linux for their creative suit. I know lots of artists and designers that don't use Linux regularly because of this, since Photoshop and illustrator are the de facto tools for their work. Adobe xd seems to be awesome, but I can't use on my pc due the lack of support -.-22
-
my company just paid adobe to use pirated copy of adobe software ,arrested one emp.
Multinational company -_-
listed company -_-
premium product -_-
why the hell they can't pay money to deserve one?
writing this rant on pirated windows.7 -
Requires windows 10 anniversary or later... So let use photo's that show it installing on vista...
Well done Adobe.
9 -
Sometimes I think back to all the funny shit that happened and how simple stuff fucks everyone
- tired Database engineer deleting (not dropping, literally rm -rf) the database files on the wrong server
- Microsoft delivering viruses through updates
- Pissed and stubborn dev deleting his one line library repo which does something like removing a char left side of string fucking an unmeasurable amount of other projects
- Adobe getting hacked and exposed for storing passwords in plain texts
- a doubled line causing a bug called heartbleed in a fuckton of webservers
- a Tutorial Company getting kicked from github because their repo got so big github staff had to maintain the repo manually
- and an old one: bad code crashed a space shuttle16 -
A person just bought a 3000€ workstation and asked me to install cracked versions of Office, AutoCAD, full Adobe suite and Rhino with plugins. And he's going to use them at work to make money.
So, since I have to, I installed 2-3 years old versions of each, in English (he only knows Italian) and blocked all the connections so he can't receive any update/fix or use web related functionalities. I also disabled all autostarting components and contextual menu / OS integrations (although this can be seen as a plus).
When he's calling me asking to "fix" things, I will simply say "sorry, it's the only way for the crack to work, if you want everything you'd better pay for a license or else go open source".
Why can't people understand the value of the complex software they use? Just because it's not a material thing doesn't mean it's not a steal43 -
"To use the clock you need Adobe Flash"
Really 1&1? You really need flash to show a fucking clock? Its not that hard to do this in javascript, or? Even if it is an analog clock :D There is even a tutorial of the "quality content page" w3schools about implementing this in javascript ... just whyyyyyyy? it 2018, not 2004.
(1&1 is an german ISP. This message occured in their webmailer using it without flash.)
6 -
The new figma plugins are actually insane lol, some examples:
- font scale, always struggled with having to apply the formula myself or finding the right one so it scales nicely
- image tracer, that plugin replaces adobe illustrator for me, since I only used it to convert pixels to vector images
- removebg, 99% of what I pulled photoshop up for
still have to test them some more, but so far it literally replaces all that adobe crap for me.
https://figma.com/c/plugin/...
https://figma.com/c/plugin/...
https://figma.com/c/plugin/...
7 -
I can get absolutely dead pissed by the fact that a FUCKING 1800 euro laptop can't do a fucking basic thing like connecting to a bloody WiFi ap?
so why, you wonder? oh no, the problem isn't the fucking hardware. IT'S THIS DEAD BEAT PIECE OF SHIT CALLED WINDOWS. mfw when it runs fine under Linux, BUT WE CANT HAVE NICE THINGS CAN WE ADOBE?!?8 -
My personal android app project started at android 1.5 and actually went to google play when android 4.2 was launched... With the look and feel of android 1.5...
Prior to that I spent about 2 years trying to make an Adobe Air app out of it.
I feel proud of my perseverance. -
Wohoo! Adobe kills flash in 2020 👍
"Adobe chose to end Flash because it believes coding technologies like HTML5, WebGL, and WebAssembly "
http://fortune.com/2017/07/...3 -
Adobe will end-of-life Flash by 2020, and all big Browsers are joining this by disabling Flash features slowly
Let's make a petition to end-of-life Electron, it is basically Flash for Desktops and it is A RESOURCE-HUNGRY LAZINESS-PROMOTING PIECE OF SHIT THAT SHOULD IMMEDIATELY BE REMOVED FROM THIS VERY PLAnet.. what do you think about that particular idea?
#StopElectron2017smhOkayAtLeastBy2020Please22 -
I always liked doing interesting things with adobe tools, but today I've found a video from 2013, where I am 14. I have no idea how I did it.
6 -
Just clean installed windows few days ago and my laptop is already mess again. Anyone else with same problem? 😂 I Suck at managing stuffs.
21 -
FRIENDLY REMINDER: Fucking save your goddamn work. Thanks.
- Your friendly neighborhood dumbass who just lost 14 hours of his life because his computer crashed.
P.S. Normally not a problem when working on code because I'm forced to save and commit with Git. Unfortunately I was balls deep in Adobe motherfucking illustrator working on wireframes, and didn't have doc recovery turned on.6 -
Next task list of an Adobe developer:
1. Fuck something up so that the user has to google for the simplest possible functionality.2 -
The manager and selfperceived omnipotent cult leader was the worst kind of businessman. Slimey and trecherous, zero sense of ethics, but felt holier than the pope because he "helped" his weakling herd of piteous employees.
These employees were smart kids, most of them in their late teens. All of them legally disabled. There was this kid who gobbled up ritalin like candy, a boy who had received his measles shots and turned socially awkward (/s), a chubby girl who could name all the hex colors of her chocolate stained shirt... you know, what we call skilled developers in the industry.
Fiftyfive of them.
They were awesome, awkward highschool dropouts, like I had been a decade earlier. They worked 50h a week. They had great humor, were passionate, devoured information about new technologies, and they built custom websites from scratch in no time. I had to lead this flock, and felt honored to work with them.
Then things started to smell funny.
I discovered all 55 of their workstations ran pirated software, from Windows to Adobe CS. I'm not without sin in that regard, but as a company it's just plain stupid.
Clients were treated like shit. I mean, we all feel like punching a client in the face sometimes, but I'm taking about unjustified debt collections paired with death threats.
Then I found out these kids were often disappearing for a few months, only to return months later.
I started digging, and discovered they were all working reintegration internships (because they were on below minimum wage disability payments), at almost zero cost to my employer.
After 6 months, my boss gave them a negative recommendation, they were all too "sick" to function in normal jobs.
Then they were rotated to a shadow company, doing the same work for another 6 months, and so on to a third company.
He broke these kids, talked them down, made them feel worthless. He threatened the ones who understood what was happening.
I ended up bringing the company down, with the CEO and two government officials jailed for fraud and corruption.
Some employees were quite mad about it, at least at first — I was the shepherd who abandoned his sheep. Luckily, most found better paid positions in no time.
Truly one of the most fucked up and difficult situations I've been in.6 -
https://blogs.adobe.com/conversatio...
Adobe Flash Player will officially die in 2020.
No more updates. If there'is a security bug, it remain.48 -
!Rant
Designer decide to have a meeting with stakeholders about UX/UI workflow for control panel of our new embedded system (no framework, no library, gui is bit per bit rendered on frame buffer).
A week later, still nothing on my table, not a mail, not a call. Meanwhile I wrote a framework, the control system, renderer, and messaging queues between tasks.
Wrote some widgets, a layout system and a view swtching mechanism, and a separate stack control to use a "back" button.
Now I am stuck for I do not know what should happen when clicking on various (non obvious) items on the touchscreen.
Fine, I'll ask the designer.
"Oh, I will write the workflow next week" (ETA time, 2 weeks. Seriously? You take a week to draw on Adobe Illustrator 20 screenshot with text and I have another week to write it from scratch in C?)
Ok, while you write it, just tell me what should happen when I click an active item.
"Well, we didn't talk about that. We just decided the colour of the icons on the screen..."
For fuck sake...8 -
After spending around 8+ hours on an Adobe After Effects project (which I obviously didn't save), at around 12 at night, it crashed.
I lost everything. Was heartbroken. Died inside. Nearly cried. Then I restarted the app and started from scratch.
The weird thing is I recreated the entire thing in around 1.5 hours. Not sure if I'm happy or sad with myself.4 -
When the design agency changes the whole fucking UI 1 week before release because they think the usability is not good enough.
FUCK YOU YOU FUCKING PLACENTA EATING LOBOTOMIZED ADOBE FRANKENSTEINS2 -
I once found a MongoDB cluster open to the internet with no authentication with nearly a terabyte of data that backed a CRM service whose customers included Microsoft and Adobe to name a few.7
-
If Adobe would just release their products on Linux I would literally have no reason to ever use Windows again...11
-
Boss: We should use Adobe ColdFusion for our next project
Me: Why?
Boss: Because it's the only programming language that can generate PDF. In our next project we will be generating a lot of PDF receipts on daily basis
Me: Oh no!2 -
The Cloud Of Bullshit
Every day I wake, and I think of my one true mission in life. To mock and ridicule paint huffing idiots. Something recently that drew my ire, like the hemorrhoids on my ass is this idea of 'the cloud', THE CLOUD and the buzzword lingo-bingo bullshit that providers use to hype and sell it.
For example, airtable is an amazing service. I love that I can insert just about anything into a row, create any of my own row datatypes, that it's flexible as all hell.
I love it.
And I hate that I'm essentially locked in to the cloud.
I fucking hate how if my internet goes down (thanks you pie eating inbred dipshits at comcast) I have no access.
If the company is bought, they'll shut down like all the rest , to be "relaunched at a later time" (or never).
I hate that if the company doesn't make enough money, or it's investors change their mind, woopsie, service is shut down.
I hate that the cloud is synonymous with massive data leaks and IOT-levels of stupidity in security practices.
Every time someone says "but its in the cloud! Isn't it amazing!"
I always think 1. YEAH IF IM AN INVESTOR I GET TO MILK LOW BROW FINGER PAINTING FUCKWITS EVERY MONTH like Adobe sucking the blood from infants who are still in college.
2. Why? So I can get locked into their platform, have them segment off previously free features (fucking youtube and the 'subscribe so you can continue playing audio with your screen off' bullshit), and then have fees increase month over month?
3. Why, so every four years during the presidential selection, if I piss off some fuckstick braindead lemming literally sucking his girlfriends BFs cock, they can potentially shut me out from my own data completely?
The Cloud is built on shit-colored hype sold to knob gobbling idiots, controlling idiots, profiting at the expense of idiots, and later fucking them for buyout payola. The Cloud is a Cloud of Bullshit shat out by huckster messiahs straight into the lapping mouths of fanatics worshiping slavishly like toilet drinking scum at the porcelain alter of a neon god, invisible, untouchable, and like a spigot, easily shut off without anyone noticing. And when it happens, I'll be there, shouting "WHERE IS YOUR CLOUD NOW?"
Native any day. 100% native or I don't fucking want it
None of this node.js-gone-native bullshit either with notetaking apps taking up hundreds of megabytes of ram, where everything is bootstrap or react, in a browser, in a window container, because people are so fucking incompetent we have to hold their hand WHILE they give themselves a reach around.
Native or nothing.
For my favorite notetaking app, I use Microsoft OneNote. "OH god, a heathen, quick, stick his body up on a stake!"
But hear me out. I'll be the first one in a crowd to kick bill gates in the nuts (not because I particularly hate microsoft, just because I think hes kind of a cunt).
So when I say onenote is good, I really fucking mean it. Sure they did some cunty things like 'dumbed down' the interface, and cut out some options. But you know what they can't do?
Shut down the damn service (short of a system update completely removing the whole app, which, frankly, wouldn't surprise me).
It's so god damn good it waxed my balls, cured my cancer, fixed my relationship with my father, found my long lost brother, and replaced ALL my irl notebooks.
It's so good that if it was cocaine I'd be hospitalized for overusing it.
So god damn good it didn't just replace all my notebooks, it even replaced and sped up my mockup process three to five times. Want layers?
Built in. Just drag an image on to the notebook to import instantly.
Want to rearrange layers? Right click select "send forward/back/bring to front/send to back".
Everything snaps to grid by default and is easily resizeable.
I had all the elements for a UI sliced and diced. Wanted to try a bunch of layouts. Was gonna take me two damn days.
Did it in three hours with the notebook features of onenote.
After I started using onenote, me and my bodypillow finally conceived even.
Sweet marries mammaries I just fucking jizzed. Thank you onenote.
P.s. It really did speed up my UI design, allows annotated images, highlighted text. Shit, it can even do kanban.
And all I can think is "good job microsoft making an awesome product for free, being dumb as fuck for not charging for it, and then not marketing it at ALL."
It was sheer fucking luck that I discovered it while was I was looking for vendor STD bloatware to blast off my new install.
OneNote: Worth a try even for the kick-gates-in-the-nuts fan club.
The cloud can suck my balls.20 -
! exactly dev
I'd ditched Windows and spent a while exploring the Linux ecosystem for content creation. And I have to say, it was not a nice experience.
As much as I respect the Linux mantra of "free as in freedom" and "you need to roll up your sleeves and figure out stuff on your own", it just isn't good enough for non-dev work. Sorry guys, but I need software that gets out of my way and at least does what it's supposed to do. I can't stand a horrible UI or delays and random crashes, which is exactly what happens with most things under Linux.
To replace my Windows workflow I used the following:
1. Windows -> elementaryOS (because Debian/Ubuntu repositories seem to have the best software support, and elementaryOS is the least horrible looking thing that supports that) and then Arch, because, well, Arch.
2. Blender + Maya -> Blender + Maya on Linux.
3. Reaper + FL Studio -> Ardour + LMMS.
4. Photoshop -> GIMP + Krita + Inkscape.
5. ZBrush -> nothing :(
As you can see, my use cases are pretty much all over the spectrum.
Firstly, installing and configuring stuff. A pleasure on Windows, an absolute pain on Linux. Everything just worked on Windows, I had to wrestle with library versions and patches and unstable audio layers (Linux audio just sucks, except for JACK) on Linux.
Out of these, Blender and Maya were the best experience. But even then, both would suffer from random crashes that just didn't happen on Windows.
Ardour is actually really nice when it works. Its use of JACK for routing makes it really really flexible, but it just isn't stable enough to depend on. LMMS is utter crap. I'm sorry, but I just hate the UI. Can't stand it.
GIMP, Krita, and Inkscape can't beat Photoshop, even when you consider them together. Adobe software workflow is just so much better and more intuitive.
Blender 3D sculpting is not bad, but it's nowhere as good as ZBrush.
Also, if you're a C++ dev like me, nothing beats Visual Studio 2017. Nothing. That IDE just blows everything else out of the water. Even VSCode. And it's not slow at all, it handled a fairly large project (PBRTv3) just fine on my Windows development VM. Yes, a VM.
So...I ditched Linux and went back to Windows, but I keep Linux as a VM for when I actually want to mess with Blender or Ardour. Or some dev stuff which Windows sucks at (which is becoming less frequent because of WSL).
Out of all the above, the only one I'd consider ready for production use would be Blender. Developers of open source software, please learn from Blender. Kickass UI and user friendly operation is extremely important, you can't make a random window with GTK buttons and text boxes and arcane config files and expect people to use it for serious work.
Also, Windows beats Linux hands down as an everyday OS. It's always been rock solid, if you take care of it properly (and that goes for any OS). Updates hardly take any time because I run it on a SSD. As for all the advertising and marketing bullshit, you can block a large amount of stuff. And for what can't be blocked, well, I just have to live with it, because the alternative is compromising on my creative output, which is too much for me.
I still run Linux on my server, though. And on my embedded devices (Pi, BeagleBone, etc.). It absolutely rocks there.
I realize that Linux software is not going to improve unless we do something about it, so I'll be contributing fixes and code (the joys of being a C++ dev, yay). Still, I feel that the platform and software as a whole is just not mature enough.18 -
!rant
My first design work (in Adobe XD)
Design has never been my strong point (implementation or design) but am very interested in designing interfaces.
Don't hold your horses. Criticize this. I want to know what you think about this.
17 -
Flash has made Java programs look desirable. And anyone keeping up with me knows I despise Java and C#, despite having written C# and currently working on deciphering a Java server to create documentation.
Before I begin, I want to make this clear: IT IS TWO THOUSAND AND FUCKING EIGHTEEN. 2018. WE HAVE BETTER TECH. JAVASCRIPT HAS TAKEN OVER THIS BITCH. So, firstly, FUCK FLASH. Seriously, that shit's a security liability. If you work for a company that uses it, find a new job and then fucking quit, or go mutany and get several devs to begin a JS-based implementation that has the same functionality. There is no excuse. "I'm fired?" That's not an excuse - if there is a way to stop the madness, then fucking hit the brakes on that shit or begin job hunting. Oh, and all you PMs who are reading this and have mandated or helped someone else to mandate work on an enterprise flash program, FUCK YOU. You are part of the problem.
The reason for this outburst seems unreasonable until you realize the hell I went through today. At my University, there is a basic entry-level psychology course I'm taking. Pearson, a company I already fucking hate for some of the ethically sketchy shit they pulled with PARCC as well as overreach in publishing to the point they produce state tests here in the US - has a product called "My PsychLab" and from here on out, I'm referring to it as MPL. MPL has an issue - it is entirely fucking Flash. Homework assignments, the textbook, FUCKING EVERYTHING. So, because of that, you need to waste time finding a browser that works. Now let me remind all of you that just because something SHOULD WORK does NOT mean that it actually does.
I'm sitting on my Antergos box a few days ago: Chromium and Firefox won't load Flash. I don't know why, and don't care to find out. NPAPI and whatnot are deprecated but should still run in a limited mode or some shit. No go on Antergos.
So, today I went to the lab in the desolated basement of an old building which is where it's usually empty except a student hired by the university to make sure nobody fucks things up. I decided - because y'all know I fuckin' hate this - to try Windows. No go in Chrome still - it loaded Flash but couldn't download the content. So I tried Firefox - which worked. My hopes were up, but not too long - because there was no way to input. The window had buttons and shit - but they were COMPLETELY UNRESPONSIVE.
So the homework is also Flash-based. It's all due by 1/31/18 - FOUR CHAPTERS AND THE ACCOMPANYING HOMEWORK - which I believe is Tuesday, and the University bookstore is closed both Saturday and Sunday. No way to get a physical copy of the book. And I have other classes - this isn't the only one.
Also, the copyright on the program was 2017 - so whoever modded or maintained that Flash code - FUCK YOU AND THE IRRESPONSIBLE SHIT YOUR TEAM PULLED. FUCK THE SUPERIORS MAKING DECISIONS AS WELL. Yeah, you guys have deadlines? So do the end users, and when you have to jump through hoops only to realize you're fucked? That's a failure of management and a failure of a product.
How many people are gonna hate me for this? Haters gonna hate, and I'm past the point of caring.7 -
Serious considering wiping the Windows 10 partition on my computer.
Only thing keeping me from doing it is the Adobe Suite. Damn it.
If only they made it for Linux, life would be such a blessing.
P.S. : GIMP is not a replacement.16 -
I just wanted to watch that video! who on EARTH still uses adobe flash player! seriously can anyone tell me?
8 -
Took me a few hours, but managed to finally run Adobe Photoshop CC 2018 on my old school Toshiba laptop running Arch Linux xD Still needs some work, but super happy I got it running :D
13 -
nvidia makes me sick, nvidia fucks with my kernel, nvidia earned a place in hell, nvidia is shit, nvidia runs like garbage stuffed in to my motherboard, nvidia is so expensive, nvidia made my work harder and that's not what computers are meant to, nvidia's website sucks, nvidia has no solutions if you're running on GNU/Linux, nvidia owes me money, time and tons of coffee, nvidia is so much a pain in my ass.
nvidia is now on my shitlist, just before apple, followed by adobe.17 -
A few weeks ago a client came to us asking for edits on their site. They had a developer in their office but they fired him a few days prior. After some looking at the piece of garbage they called a website I told my supervisors that it was built in Adobe Muse and from what I could find in a few quick searches it's shit and I didn't want to learn to use a shit tool. Apparently as a company we decided to hire a freelancer to handle this despite the fact that we didn't build the site and the client isn't paying for maintenance so I'm not sure why it's our fault.
Fast forward to today:
I've been in the office for 19 hours straight trying to learn how to use Muse and fix the client's site because somehow the freelancer managed to delete the mobile version of the site. When I ask my supervisors why I'm fixing and supporting a site we didn't build and don't have experience working in and the response is: we're presenting the client with a $50k proposal and we need all the good graces we can get.
Unless I'm gonna see some of the commission it doesn't really matter what we charge for the site, I make the same whether it's a free site or a $100k site.3 -
Received screen designs for a new website in Adobe Illustrator format with all the measurements in centimetres.3
-
Little news for fellow Linux users and Windows users who want to switch.
WINE 3.0 has been released recently and I haven't seen anyone mention it here so I thought I'd share. It features support for Direct3D 11.
https://winehq.org/news/2018011801
http://omgubuntu.co.uk/2018/01/...
Also, apparently, Photoshop CC 2018 works: https://imgur.com/a/k0HI07 -
This fucking Adobe piece of shite.
I get it, you probably make one of the best editing software available out there. But if you could stop rearranging all the icons and features in your UI, that would be fucking great so that I don't have to search on the internet for hours to find out a simple feature.3 -
!rant
I’m a backend - spaghetti - developer, and today i took the biggest mindfuck in my life when i found out that it’s possible to have functional mockups... at first glance i tought that i’ve only received a screenshot collection of what the designer did... guess what... i was able to click lè buttons and go trough the whole application flow.
Thanks Adobe for xD ...
I should get a freakin designer job.4 -
VsCode.
I have been on a journey with editors, all the way back to using edit.exe in Windows 95, to notepad, MS FrontPage, Adobe Dreamweaver, PHPDesigner, vim, nano, then out to Eclipse, Atom, Brackets, notepad++, back to Atom, then VsCode.
And by far, vsCode has given me the most productivity and customisation of them all to not care about what project I open, what language it's written in, or what frameworks are working behind it. I can switch with workspaces and everything is setup to go, yes it's a pain in the ass to setup, but it's a ducking dream to just open and jump in.
Now being able to use VsCode for Salesforce has dropped any requirement for me to keep eclipse around.1 -
I. HATE. DELL. WITH. MY. GUTS.
Their low tiers products are full black plastic overpriced fuckshit, if you press too much the cover you can actually destroy your display. Fuck shitty laptops and fuck this shitty laptop in particular. It's slow. It's so slooooooow. It's everflying fucking slow motion, being on the web is like being in the matrix while dodging bullets made of wordpress plugins. The only good thing I can say is that is living right now, it has been... Three years? I only picked it because of high discount and ubuntu preinstalled (that made me think: oh, maybe they have components that are linux compatible regardless of distros. It was not). I'm enjoying Manjaro, when I'll have the skillz i'm going full Arch.
I will start university this fall. It's going to be a math major. I absolutely need something better than this anyway. I am also freaking out because I don't know which genre of software they could want to make me install and if they're windows/mac only. In the meanwhile I do photography, video, design and as you may suppose Adobe is often my go-to; I also have to build a workstation at home. I am freaking out because WELL FUCK WINDOWS 10 AND ITS PRIVACY NIGHTMARE PERIOD.
Which laptop I buy?
How well does heavy software run in a Windows virtual machine (on the desktop, not the laptop)?11 -
I'm a dev and I like to rant
And who says it has to always be about Dev stuff ?
So!!! I ve spent 2 days as a junior dev and I feeel not well... 1) I am the worst dev in the company with no experience 2) brain-dead 3) feel like I wasted 2 days and learnt nothing, I guess in theory it's something but realistically I had no "it clicked" /pure genius /astounded myself / made major new brain connections moments
So what's going to happen now. ? When will I wake up? How do I wake up ?12 -
Joined a new project and started messing with the application...Greeted with a blank web page and a pop-up **please enable flash**2
-
Because in #Adobe's utopia world, #everyone is a local admin.. and is super computer literate and knows how to use the terminal to change permissions. Oh wait no, the fact is the world is filled with organisations whose users act like monkeys in a cage and absolutely cannot be trusted with admin rights.
And yes.. the 'repair' does nothing, of course!
Ughhh Adobe.. get your act together.
-
After installing an instance of Adobe's PWA Studio for Magento I am 100% convinced Magento is going to be a subscription service like Shopify and BigCommerce, Adobe's version anyways.
I need to bail and try to get my career trajectory going into a different direction. I am running out of time. I have 1 year tops to get into another area of development.
Or I guess become strictly a frontend dev.4 -
New company issued desktop is running win7 *criiiiiinge*
Solution: run linux on VirtualBox!
Efficiency++
Productivity++3 -
So I was planning on a single page website for my relatives hotel websitte and offered to make it for free ( as an offer for other huge project i was doing for same person )
But just got told that one of my uncle told to tell me that website design should like the website design of another hotel xyz.
For second, I thought that other would be very nice. So I checked it out.
Guess what! That other site looks like it hasn't updated since 2005! No HTTPS. No responsive design. Looks like fugly crap from 2005 to me. Has a huge Click to enable Adobe Flash banner on homepage.
I lost my hope in humanity and I quoted a price for making that. I guess I just gotta do a shit job and will get paid for it now 😂3 -
I was flash developer once, it was great when macromedia was around, then adobe acquired them, now flash is gone.
Years are passing and most of industry is the same as always. Trying to drag you into this rat race of learning new amazing technologies, amazing projects that are actually doing same job as 50 years ago but using more memory and cpu cycles. Because all has it’s roots in algorithms from previous centuries.
So youngsters loose your best life time, be innovative by doing nothing more then copy paste from stackoverflow and duck typing shitty code.
Be a slave and sit in the amazing office, that has everything but not your real life that meanwhile is sucked by corporate squeezer till your last breath.
Be piece of shit that can be kicked around.
Watch youtube, facebook, instagram or whatever social network that shows you pictures that are fooling your mind that you’re someone special and you need this stuff.
Then be ready to suck some dicks to earn money and buy stuff you don’t need, live where you don’t want and do what you don’t like. You piece of shit.
Well that’s what disappoints me from my tech stack.
Now chill out, turn off your electronic gadgets, go out and enjoy real world.2 -
I work 3 PM to 1 AM as a daily office job. Then go home and try to learn programming. Wake up next day at 8:30 AM for kind of another work until 1PM. Doesn't pay as much but I have to try. Then if I get free time do some freelance on UPWORK with whatever little graphic designing I know to help pay the bills.
And the fact that even my laptop is dying is a huge blow. Don't know when it might give up. Has 1st gen core i5 dual core, takes ages to load Adobe softwares. I have wanted to hulksmash this shit, but can't.
If I'm lucky, I get a stress free 6 hours of sleep a few days a month. And my depression doesn't help. More sleep should ease me a little, but I can't afford to waste any time. But this is life, isn't it.3 -
These ignorant comments about arch are starting to get on my nerves.
You ranted or asked help about something exclusive to windows and someone pointed out they don't have that problem in arch and now you're annoyed?
Well maybe it's for good.
Next comes a very rough analogy, but imagine if someone posts "hey guys, I did a kg of coke and feeling bad, how do I detox?"
It takes one honest asshole to be like "well what if you didn't do coke?".
Replace the coke with windows.
Windows is a (mostly) closed source operating system owned by a for profit company with a very shady legal and ethical history.
What on earth could possibly go wrong?
Oh you get bsod's?
The system takes hours to update whenever the hell it wants, forces reboot and you can't stop it?
oh you got hacked because it has thousands of vulnerabilities?
wannacry on outdated windows versions paralyzed the uk health system?
oh no one can truly scrutinize it because it's closed source?
yet you wonder why people are assholes when you mention it? This thing is fucking cancer, it's hundreds of steps backwards in terms of human progress.
and one of the causes for its widespread usage are the savage marketing tactics they practiced early on. just google that shit up.
but no, linux users are assholes out to get you.
and how do people react to these honest comments? "let's make a meme out of it. let's deligitimize linux, linux users and devs are a bunch of neckbeards, end of story, watch this video of rms eating skin off his foot on a live conference"
short minded idiots.
I'm not gonna deny the challenges or limitations linux represents for the end user.
It does take time to learn how to use it properly.
Nvidia sometimes works like shit.
Tweaking is almost universally required.
A huge amount of games, or Adobe/Office/X products are not compatible.
The docs can be very obscure sometimes (I for one hate a couple of manpages)
But you get a system that:
* Boots way faster
* Is way more stable
* Is way way way more secure.
* Is accountable, as in, no chance to being forced to get exploited by some evil marketing shit.
In other words, you're fucking free.
You can even create your own version of the system, with total control of it, even profit with it.
I'm not sure the average end user cares about this, but this is a developer forum, so I think in all honesty every developer owes open source OS' (linux, freebsd, etc) major respect for being free and not being corporate horseshit.
Doctors have a hippocratic oath? Well maybe devs should have some form of oath too, some sworn commitment that they will try to improve society.
I do have some sympathy for the people that are forced to use windows, even though they know ideally isn't the ideal moral choice.
As in, their job forces it, or they don't have time or energy to learn an alternative.
At the very least, if you don't know what you're talking about, just stfu and read.
But I don't have one bit of sympathy for the rest.
I didn't even talk about arch itself.
Holy fucking shit, these people that think arch is too complicated.
What in the actual fuck.
I know what the problem is, the arch install instructions aren't copy paste commands.
Or they medium tutorial they found is outdated.
So yeah, the majority of the dev community is either too dumb or has very strong ADD to CAREFULLY and PATIENTLY read through the instructions.
I'll be honest, I wouldn't expect a freshman to follow the arch install guide and not get confused several times.
But this is an intermediate level (not megaexpert like some retards out there imply).
Yet arch is just too much. That's like saying "omg building a small airplane is sooooo complicated". Yeah well it's a fucking aerial vehicle. It's going to be a bit tough. But it's nowhere near as difficult as building a 747.
So because some devs are too dumb and talk shit, they just set the bar too low.
Or "if you try to learn how to build a plane you'll grow an aviator neckbeard". I'll grow a fucking beard if I want too.
I'm so thankful for arch because it has a great compromise between control and ease of install and use.
When I have a fresh install I only get *just* what I fucking need, no extra bullshit, no extra programs I know nothing about or need running on boot time, and that's how I boot way faster that ubuntu (which is way faster than windows already).
Configuring nvidia optimus was a major pain in the ass? Sure was, but I got it work the way I wanted to after some time.
Upgrading is also easy as pie, so really scratching my brain here trying to understand the real difficult of using arch.22 -
Does anybudy still use Adobe Animate/Flash for web animations?
They teach it at my school and at the moment I see no reason to use it. I'm probaly faster writing it by hand in CSS / JS, and it will run smoother that the animate files...6 -
I am not gonna lie. I am really excited with the changes coming to Magento with the release of 2.3.0.
I think it will help with the huge problem in the Magento community with devs who are very incompetent but somehow keep getting significant income from clueless clients as Adobe has introduced many changes including deprecating the entire frontend, making it PWA, so react, vue, or any other framework can be used to create the frontend, all backend calls will be through the graph-ql api.
They introduced strict PHP typing, very advanced OO designs, and this deprecates 99% of all stack overflow answers and tutorials which makes me very happy.
Read the damn classes if you want to use them! Stack overflow is 99% wrong on how to implement solutions for Magento! which tells you how few devs out there actually understand Standard Practices for Magento 2.
Now, I just need to find a company that is on the leading edge of development so I can increase my skills faster than currently possible on my own.
I ironically have gotten positive responses from my resume blast yesterday and have initial interviews lined up the entire week at lunch. Was so not expecting this during holidays. But seems to be it is going to be a very good Christmas for me.
Which brings me to my prediction for Adobe's interest in an eCommerce platform such as Magento.
My prediction is they will make the backend a closed source subscription service and you will just create the frontend PWA style with api calls to their subscription service.4 -
In a recent venture, I had to use an office suite and a photo editing software regularly. As a Linux user, I tried using Libreoffice and gimp. But that was just a mess. My other project partners were using MS office. Format, image alignments, fonts.. everything was messed up. Same happened wih the gimp. I know Photoshop, learnt while studying. Gimp was just no match to that. I was forced to go back to Windows. And I was surprised that the latest MS office and Adobe Creative Cloud were excellent. MS office was smoother and faster than Libreoffice.
I love linux. I have tried all the major distros and I love all of them. But I would still say that Linux is not the best option for day to day non-dev tasks. Whatever Richard Stallman and the Open Source Community say, Linux lack good softwares, at least some good document, photo, audio and video editing softwares.8 -
Some designer told me: "I'm sending it in Adobe XD format. Do you use Adobe XD?"
I answered with a 😆
Maybe I need a pause?1 -
We don't have a designer yet in the team so we had to learn Adobe XD on the side to prototype our ideas. After months of getting the hang of it thinking this semi-free tool will work for us to save some money, Adobe decides to change their pricing plans starting in April 2020 and it will no longer be free. It feels like Adobe trapped us to get used to their platform and then secretly slap us with a price tag halfway. We can't blame them since we're all trying to put food on the table here. We started exploring Figma today and oh boy was it a gift from the gods! The features are so much better. They make our workflow faster!3
-
Nothing like good old Adobe flash on Windows 2000 to keep air lines on time... Oh wait, what? Their computer system crashed again? Oh well, never mind :(
8 -
We're both senior devs, I use nodeJS/Python. Stop forcing your Java *superiority* shit on me. I can write the API using either language. Also fuck your JVM. FUCK THAT SHIT4
-
Wow... Magento 2.3.0 Adobe is making cray cray changes, strict PHP typing, Interfaces and Chains, rewrote the stockItem interface today on my module because it is deprecated as of 2.3.0 and the changes are just.... wow.... Adobe gots some developers.
-
Okay so i graduated last year and got a job working for a place that sadly disappoints me in their web development practices. This place uses a dead technology(my opinion)called Cold Fusion by Adobe. They do not use any form of version control like Git and their sites are very shitty and the design and development is implemented very poorly honestly. It honestly makes me sad that i feel like im smarter than my department vp. That being said i do not feel challenged here and am looking to collaborate in some open source projects via Github preferably.I dont consider myself an expert in this field but i would say im about intermediate level in web development. Im pretty comfortable with HTML,CSS/SASS,PHP,JS/JQuery, and im pretty comfortable in the PHP framework Laravel. So if anyone is interested in collaborating or starting something up, id be so down for it. :)7
-
Adobe's ExtendScript toolkit is abyssmal. I find posts from 2008 referring to issues that have not changed even in CC2017. Do you think they are small issues I'm bitching about? I'll list 2. First, the toolkit only colours "var, return, for, foreach" and a bit more keywords and the strings, of course you can set up color schemes but those are limited and not colouring stuff. The second issue is auto-complete, it rarely kicks in and suggestions have 0 connection to what are you doing and are always the same. It doesn't recognize anything of what are you doing.
Probably in 2008 you had to program with the manual near you like writing assembler, now there's an improvement in 2017, they got a window named object browser or something like that that actually is a summarised portable manual that could've been easily transformed in auto-complete suggestions.
Adobe writes about this and I quote: "a complete integrated development environment". Although I will not write much scripts in it, I need to write a big one and thought about extracting that object data and putting it in a more capable javascript editor. LO and Behold what I discovered, the ExtendScript Toolkit that's supposed to edit Extended javascript and save it as jsx or jsxbin is almost completely (it has some dlls too) built using around 100 jsx files. It's the equivalent of building a js IDE to edit js.
Sorry for formatting, I'm on mobile, I tried.
-
Apple, next time you want to get me to upgrade my file system, please FUCKING TELL ME IT WONT LET ME INSTALL WINDOWS USING BOOTCAMP, 9 hours and I’ve only just found the file system that will let me run Adobe Cloud and Windows
-
Adobe labs released one new component, I played with it after two days. Went to an interview with huge company after two weeks for a developer position, the interviewers was from different departments, they asked about one technical challenge they have, then I suggest the new component as solution, they gave me small task to implement using the component, I delivered it next day... Then they hired me in R&D department. It was great days.
-
How often do we come across IT managers who don't plan their work properly?
I teach software development and programming at a vocational school. Our IT manager said that we got a certain budget influx and that he can procure new computers for our teaching facilities. I happily agreed and hinted that i would really like some new hardware with proper graphics cards so i could do a few small projects with Unreal engine, Unity3d or use adobe products without hardware lag. The new computers arrived about a week ago and then the "fun" started.
He had ordered some PCs with proper graphics cards and processing power and talked about putting them to up in my classroom, so wheres the "fun" i meantioned? He only ordered half a classroom worth of them - i guess the budget didn't allow for more. A week later i was supposed to move to a new room and was waiting for my new computers to be installed and yet the IT manager said that my computers would be moved along with me. I was appalled - what had happened to the new PCs he promised?
Turns out he had put em up in another building without notice, a teacher there wanted to do an extracurricular movie making activity (that included a bit of video editing at some point). That classroom is always in use so me getting more than 1-2 hours a week in there is nigh impossible.
In the end i got no new computers, hardware or software.... he didnt even bother to switch out the 2 "temporary" laptops i had in my classroom since 2 years ago due to a small shortage back then and even these have an old image that didnt include a third of the software i normally use.
PS. He had about another 2-3 classrooms worth of new PCs but those were promised to the other IT teachers back then....2 -
Since the last Windows Update broke my wife's laptop (the WiFi driver doesn't woro anymore) she's moving to Linux. I hope it goes well since she is a non-techi. I kinda am excited.
The biggest problem will be the lack of Adobe Illustrator. 😕14 -
New toy for frontend devs:
OpenType 1.8 Variable Fonts.
1 font file to rule them all. Manipulate on the fly fluidly the font weight via css and javascript.
http://blog.typekit.com/2016/09/...
1 -
To be honest I forgot completely about the ducks and was kind of disappointed to see them, don't understand me wrong, its a great addition to the shop (especially to support devrant more when buying them and I will probably do too) and trogus (wow it's pronounced t-rogus) deserves a lot of respect for going through the very hard process of developing it, getting somebody to do a decent quality result etc. but I was hoping for the new site that got hyped up some time ago or some update to the app that fixes design issues on phones that have 2k resolution and no statusbar and more. ("just open a github issue" - I don't have one right now and it didn't get much attention anyway, since I am in the niche of people with those kind of setups, most people it seems have phones that can even barely run the app lol). The login still pops up each time you visit the site (basically just click it away, but it's rather annoying to have it pop up), it's nowhere near to the original app (although the native app is written in some sort of wrapper anyway?) - especially what comes to options, customizing, deactivating things, posting into categories (newest feature), getting notifications etc
There is some community builds that try to recreate a better desktop experience, but sadly fail to do so (sorry to devrantron and others, but what the fuck were you thinking when you rounded only the top right and left corner?) - since they always have something that is just thrown out to "be there" or design fails (which devrant just lacks and looks good across the board), that makes me rather cautious if that program doesn't send my credentials to some african prince. ("just look at the sourcecode", yes I have better things to do, thanks)
I could just create my own build, having to reverse engineer the whole website and app (granted, most of it are just api calls), but I simply lack the time (so I understand why my mentioned problems aren't getting really any attention or can't be implemented that fast, yet still its somewhat bugging)
I have listened to the Q&A and I know you guys are working full time at for example adobe (amazing that you both have time to be putting it towards devrant), so its not as much of a rant, just wanted to get out my disappointment about the event I felt personally. Still nice to have seen you and talk with the community a bit (although the time I feel was picked more towards your US audience rather than EU?).3 -
I told my boss that Adobe ColdFusion will cost us 8k for Enterprise license. He said that he will look for the free license key (pirated) online tonight.
I feel sorry for the developers of Adobe ColdFusion.
Related Link:
https://devrant.com/rants/1515286/...3 -
My worst experience has actually been trying to fix someone else's code. One of my friends is in a graphic design class, and right now they have to do a basic site in DreamWeaver (a small nightmare on its own, I've found that the previews they show are never quite correct). I decided I'd at least pop in to help out a bit, cause they kinda have no clue what they're doing. They are graphic design students, NOT developers, and it's very easy to see that.
One of the first things I noticed was EXTREMELY unorganized code, but that's forgivable. But...I once saw probably 5 </body> tags in someone's code, a JavaScript function inside of the <body> tag, and a bunch of CSS statements in the <script> tag that they had one if the JS functions in.
I remember seeing this stuff, and I thought "what the actual fuck?". The dude was like "yeah it's unorganized as hell, I know"
...That's not the problem. CSS goes in either a <style> tag or a separate file (THEY HAD A SEPARATE CSS FILE). JAVASCRIPT GOES IN A <script> TAG OR A SEPARATE FILE
But, I get it. They're graphic design students. They can outdo me in probably everything in the Adobe suite (except DW as I learned). I once watched a girl in there do a project in Illustrator. I had no fucking clue what was going on. And when I was talking to her about it, she said "that's what I was thinking when we were watching you fix our code"
Kinda got a little sidetracked there. Basically, worst experience is non developers writing code for an assignment. -
My dad was using notepad to edit some HTML for his website. I downloaded Visual Studio Code and he likes it SO MUCH MORE. (I wonder why....).
Kinda happy I could help him with it. He is pretty good at coding but just hasn't done it in a while (not his trade) so he doesn't know all the new tools and such.4 -
So, I'm looking into something and end up on Stack Overflow. Someone posted the question:
"Does minified javascript improve performance?"
This question was old as shit, all they way from 07/25/09, and about an Adobe Air application. (Remember that? Me neither...) It had a great, accepted, and still accurate answer, posted the same day the question was asked. Now, fast forward 8 years and on 12/08/17 (A mere 7 months ago...) the following answer was posted. I don't know what they were thinking, but here it is, complete and unabridged, with my comments in square brackets:
"I'd like to post this as a separate answer as it somewhat contrasts the accepted one: [Somewhat contrasts? More like completely contradicts...]
Yes, it does make a performance difference as it reduces parsing time - and that's often the critical thing. For me, it was even just simply linear in the size and I could get it from 12s to 4s parse time by minifying from 3MB to 1MB. [First off, your parse time should NEVER be THE critical thing, but secondly, and more importantly, WHO THE FUCK HAS 1MB OF MINIFIED JS ON A PAGE!!!]
It's not a big app either, it just has a couple of reasonable dependencies. [THERE IS ABSOFUCKINGLUTELY NOTHING REASONABLE ABOUT ANYTHING HE JUST SAID! What dependancies is he using?! You could use minified and not even gzipped jQuery, AngularJS, Vue, Ember, React, AND Dojo libraries on the SAME PAGE, AND have 118k of application code, AND STILL NOT HAVE HIT 1MB QUITE YET!!!]
So the moral of the story here is: Yes, minifying is important for performance - and not because of bandwidth, but because of parsing. [Javascript should NEVER take longer to parse then to download, even on a low powered device...]"
So, yeah, I'm at a loss for what this guy was thinking, but the thought the people like this exist, and that my browser might one day be subjected to their horrific nightmare of code terrifies me...2 -
tldr: Fuck Adobe Premiere
What the flying fuck.
I have a school project together with a friend and decided to do a video. Not only do we now only have one fucking day left, because the teacher decided we dont need time or anything, but I have to learn video editing software, record clips and create the video withing one fucking day.
I've downloaded Premiere because I have a 7 day trial left and had Creative Cloud on my PC and WHAT THE FUCK kind of fucked up bullshit software is this human compiled piece of shit?! I needed to google how to add text and edit it because adding text gives you absolutely nothing, you get no possibility to edit the text in any way, except the content. After googling for 10 minutes because I have the newest version and they changed the text tool, I found out that you need to go to another tab... of which there is 7 and all have such telling names like: "Effects" and "Compose"...
I needed to go to "Effects" BECAUSE WHY THE FUCK NOT, TEXT SURE LOOKS LIKE AN EFFECT TO ME! Then I wanted to align it to the right so its on 50% of the screen. You fucking cant, I've tried and looked for an hour the only possibility you have is to align it to the center or just throw it somewhere. The snapping didn't even work correctly. So I tried to do something else because I was ready to punch a kitten.
A box. A box thats black. A box thats black and thats aligned to the... FUCK YOU, YOU CANT ALIGN THIS BOX.
I cant align a box...
They dont even give me the possibility to...
But I can align the text BOX, not even the FUCKING TEXT itself...
What
The
Fuck
This is the worst program I've EVER had to use. I'm fucking mad and this fucking project can FUCK ITSELF.19 -
"For front end developers that don't like Sketch". Say what!? Sketch is the best thing that's happened to front end designers in terms of design tools. Anyone who prefers Photoshop to Sketch is a sadomasochistic.1
-
Being drunk I keep thinking I can't get back the years I didn't spend programming when I was 16-20. What do now? Want to do Web but all I know is a micro part of everything. I can make a demo in old Unity. I have shitty basic skills in Java, Python, Pascal, JS + React. Also basic UX, Adobe design programs like AI, PS and ID. Nothing proper, and home projects just don't seem to cut it. Irl bards can't get no work4
-
Top Tip!
I just found out about http://figma.com a collaborative design tool, looks a bit like a mix of Sketch and Adobe XD, but with real collaborative features AND as far as I know it's FREE! :O and has both mac and Windows apps , AMAZING6 -
I regret downloading too many Photoshop brushes, gradients, actions, patterns & etc.
Purging files at the moment.1 -
As a teenager learning to code on a computer given by my parents
It hurts to see announcements like mobile development has some limitations on 32bit, or Github Desktop, Adobe XD and the new Unity only supports 64bit8 -
So in the context, I ragequitted my school at the end of the 4th year (out of 5, so no diploma). I was broken, poor (the only money I got was my parents), and mad as fuck.
I took a 2 month vacation during the summer where I did strictly nothing, then I sat down to my computer, opened Rubymine and started building my new website (current version actually, new one is in progress)
Right after that, I downloaded the trial version of Adobe InDesign and created a better / updated version of my old CV, and put it on LinkedIn, Viadeo, everywhere. At first, it didn't work much since all my experience was about underpaid internships, so I honestly had no work experience on the paper.
Then, while answering to a job offer, I put my CV on Monster, before I realized I should have done this from the beginning: next 3 mornings I had 5 phone calls, and 2 appointments per day for 2 weeks 😁😁
My current job was one of the firsts that called me, but made me wait a whole month (through appointments & shit) before answering me "Yes" one tuesday at 10 pm, on my way to take a shower. It's been 10 months now 😁2 -
Is it just me, or do Adobe products just get progressively harder to use? I'm thoroughly frustrated with trying to figure out how to do simple things like annotating screenshots in Photoshop, like I used to do several versions ago. All these damn options and non-intuitive names for things and crap scattered all over the UI. I just want to draw a friggin arrow and wrap red text in a nice box with a white background!!!1
-
Just boosted my Starling/Adobe AIR game engine's performance by 60%! active code time per frame @ 60fps reduced from 50% to 19%. Now I have more room for lighting effects :)
-
Html5 vs Adobe flash. Html5 won
Html5 vs java Web embedded app. Html5 won
Therefore Html5 vs java 3 billion devices. Ans=?5 -
Around the time Apple was denouncing it, I joined a chatroom for Adobe flash game developers. I really loved the idea of making games too, so I tried to learn ActionScript3. That failed, because it was my first language and since I was broke, I couldn't afford flash pro, so I was using an open source ide with okay documentation, but no newbie coder tutorials. I didn't actually start learning to code till Codecademy came out, I learned js, then I learned visual basic and Java for online courses the local community college had available, and now I'm taking C, C++, Java, and Python in college while I use C# at work and JS during my free time. Sadly, in a jack of all trades, master of none :/1
-
Got our snazzy new HP Elitebooks from IT. Nice lil laptops.
Guess how many apps they installed for us off the list of "Applications Devs Need" that was submitted with the original request that they asked us to provide.
Goddamn 0. 0 Apps installed. ”Instead here is admin access, install what you want.”
Being a PC guy I don't mind setting up a new environment but things like Office365 and Adobe CC could of been installed for me, I don't have the licence info offhand so now I gotta bug IT again and why ask for a list if your not going to install any of them?? Ugh. I don't have time to sit here while Adobe installs the whole suite....
/rant
What's the first thing you install on your new PC? I find I grab ConEMU first.6 -
Is someone else into photography and can recommend me some Opensource software for it. (fuck Adobe for Flash and not supporting Linux)14
-
I can't fucking read adobe *eks deh* ever as what they intended it to be, it always seems like the author of the comment / .. is a gen Z laughing out loud about something.6
-
Doing personal online shopping whilst waiting for code to compile (took about 10-15 min every time, just for the smallest code change).
This was a really slow Adobe Flex system which I hated. Actually glad I left because no sane company uses Flash, even in 2012. -
That moment when you're opening Adobe Illustrator and Photoshop as an Developer...
I really need an Designer and/or more Money for this shit.4 -
Random post:
I think this website has answers to all of your CSS woes. From ready-made templates to basic grid structures to tutorials. Templates and Lightroom presets are also available for Adobe Photoshop.
https://www.bypeople.com/
Hope this helps someone.2 -
You know something has gone wrong terribly when no MS Office program or Adobe reader starts while the debugger is waiting at a breakpoint.
I'm really curious which part of the kernel or system near userspace-components can cause such behaviour and where MS created pointless tunnels between independet software to let that happen. But I think I will never find out. -
I just tried to download Photoshop CC. On Linux. Just to give it a try in Wine 3.0 and see if it works.
Adobe rejected my humble request with "Your operating system is not supported."
Ok.
I switched my user-agent to Windows and voila, it tried to give me a dmg installer.
A. Fucking. Mac. Installer.
WHAT AM I SUPPOSED DO TO WITH THAT ADOBE YOU STUPID CUNT!12 -
Two months in my new job, no task assigned to me yet. Not even one. There's been a budget reallocation, and the team just got dissolved. Will probably be moved to a new team (or not?). Part of me enjoys the free time I'm getting (I get to work on my side projects) but it's kind of depressing that I can't prove to the company how much I love building things while at the same time helping the company. 😔4
-
Fuck Adobe Premier.... after 2 days of trying to get it to stabilize a video n prolly frying my CPU.... I'm moving to Plan B.... guess it should've been Plan A:
Upload Youtube so I can use their Video Editor... then download it back when it's done.6 -
I'm slowly migrating the primary e-commerce, highly outdated Joomla site at work to a licensed, out-of-the-box, designed for a printing company e-commerce system. The first step, in order to understand the system, is to migrate a business card generator to this platform. The original generator (which deserves its own rant) is for a very large and well-known client. In order to transfer to the new system, I have to recreate each business card in the specified format. However, the system requires PDFs made in Adobe Acrobat Pro. The original projects are from Adobe InDesign (which I do not have), so I have a lot of manual, very tedious work to do. Because the client is strict about their card designs, I need to remake them exactly. Well, exactly includes the font they used.
It's not as if we do not have the font at work. On no, we have copies alright. It's just that the InDesign projects, and the font, are on Macs. And the font is a PostScript file. The system requires OTF or TTF fonts. Which nobody has. So I spend my first week (last week) trying to get this paid font. I feel as if I was making a fiasco. We finally identify the exact font, even the weights, and purchase them. Today after lunch. Great! I can finally get these four cards finished. Timing is alright, I've had a busy morning trying to track down emergency issues that arose from deploying some code yesterday morning for a different system (my internship project from last year, actually).
I finish the cards. Not wanting to tackle the vertical cards or deal with the incorrect and inconsistent info on one card type right now (the client really doesn't need to know I'm remaking these and I don't need to tip them off), I start this other card from the same client. I get everything roughly in place. I even stay late to work on this to make up for lost time trying to get that font. I open the model PDF to check what font it uses, as it is different from the one we just bought, the one every other card from this client uses.
Helvetica.
I check my computer, don't have it. I check multiple co-worker's computers, even old ones. Nothing. The Macs have it... in PostScript format.
I should have started on the vertical cards. Oh, and my Acrobat Pro trial says it has "1 day left". I'm expecting it to be dead in the morning. Which means I can't get any work done until the lady gets in office and purchases me a license, which won't be until after 9:30 AM....1 -
I was waiting in a queue for Adobe support for over an hour, decided to go for a smoke. I come back, and a representative had entered the chat and closed it because I didn't reply within like 2 minutes ... FU
-
so, my friend was telling me, his ex texted him and asked, I'm quoting,
'How to install numpy and pandas in python?'
she wanted to try machine learning !!1 -
Fuck Magento 2 and it's useless documentation. Fuck it for deprecating straightforward stuff for the reason of being to complicated with the warning that the functionality will be removed and then replacing it with a way more complex solution, while internally just using the deprecated stuff and laughing external developers in their face.
Fuck Magento, fuck Adobe.
Just had to say that.... -
Install Adobe suit and your internet will be fucked off. The solution is to find all startup items of com.adobe.* and remove them. I don't understand why they put their files across all system. Adobe: please be normal and act normal. It's 21 century.2
-
Native Android Java/Kotlin I got covered but I need to go multi platform mobile. Your choice, why and why not?...
- React native
- Flutter
- Adobe Air
- phoneGap/Cordova
- Xamarin
- another?14 -
Recovering a Raid 1 EXT4 disk to a ZFS disk. Thank god for Adobe programs and their multi million file-based caching files.
recovery_time.add(4.hours) -
I haven't checked figma plugins much since their announcement, but holy shit scrolling through the list now is nuts, they have so much goodies, open source, things you had to pop into adobe illustrator first too.3
-
Adobe XD is the newest terrible child of the idea that you can design "user experience." What a waste of time. How many more middle-men do we need in this work flow?4
-
Running Adobe Flash Builder IDE for creating Flex application really sucks..!
VS Code work better nowdays for many languages...!
Support for ActionScript is quite with extensions.5 -
I find adobe website fucked up. They asking to many personal information just for downloading a fucking trial software. Dude WTF?2
-
Okay, I've been thinking on this all week.
Microsoft Office (All of it)
itunes
Adobe Creative Cloud (Only The Management Software / Installer)
Apple Mail -
I wonder what impact the launch of Affinity Publisher will have on Adobe, now that their core creative suite has been re-imagined by Affinity. Ive been using the beta and it pisses on inDesign. Good work Affinity !
-
Why is it so difficult to tell the people to not use the same passwords everywhere? I thought of a service which searches all leaked databases and predicts a password based on that as a warning for the user... Having the program told you that your password the user is likely to enter would be XY, because the adobe OR MySpace OR Dropbox passwords for the email OR username entered was that password could be a bit more aggressive but useful to let the users at least think of secure passwords.1
-
I hate it when designers just LOVE to use blend mode multiply everywhere, and the client is looking at the website in IE asking why it's not the same as design.
-
Adobe is going to close my account if I don't log in before 60 days have past. I will loose everything I have there. I am so scared!5
-
My company design floor plan and some photoshop work for clients.
One project was to resize the image to certain width and height and place it in the center of the photo with padding 40px around.
I wrote an extended script of Adobe to help the design department and process thousand of images within an hour.
My Boss was so impressed and have a meeting with me. He said: "You need to lead IT department and create a system that can detect the client's requirement and complete the drawing with Adobe Illustrator automatically".
Me: Thinking (Meh, I have no knowledge of Image Processing with my poor Mathematics, where can I die with his requirements?) -
One of top clients, a Designing firm started asking for non-programmer jobs like office templates.
Client sends in .indd and .ai files.
Me: Requests for psd version as I lack tools for .indd and .ai
Cient replied: "I am not used to being asked for png’s to be made when I provided you with an AI file for all logos. I do expect you guys to use a little bit of nouse / imagination and work out that you can create the png yourself from the a.i. file provided. This is something no other programmer asks me to do."
Me: U for real? Why would a developer like me have Adobe Indesign installed in my machine?
pfft.1 -
Worst one was in my first ever web developer job. It was a small company where everything was done in Adobe ColdFusion. Was there for 2.5 years before they went bankrupt and I got made redundant.
So when it came to look for another job, I was hoping to get another ColdFusion related job. But a lot of company's requirements were pretty bullshit. Junior position, but must have 5 years experience.
After 4 months of looking, eventually found another job but as a PHP developer. But since my PHP skills were beginner's level, I had to start from a new graduate level salary all over again. Felt like the past 2.5 years at my first job was a waste of time. -
Hi there everyone am Shreyas a CS student. Am a C# guy and learn the parts of language every day (recently learning Asp.net) and having a lot of intrest, knowledge and passion in buildling stuff in it with WPF, Xamarin. And also i do practice a lot in it everyday.
But recently I am getting a lot more intrest in UI/UX designing. Am finding myself watching more UI/UX designing (mostly in Adobe Xd and illustrator) videos on YT (dansky YouTube channel specifically) rather than C# which I used to watch in early days.
So what is your suggestion on it? Should I learn the UI/UX designing basics. Will it help me in future, if I become a developer on building applications for mobile and desktop in C#?
Am pretty confused with it? Should I learn it or not?2 -
So many changes over the past few months. Transitioning from a freelance logo / print / packaging designer. Going full stack web developer. Even switched from adobe CC to Sketch for my design needs. What a ride. Everything I come across is new territory. I’m like a newborn baby. The struggle.
-
Brackets: https://github.com/adobe/brackets
Ok this one have been bought by adobe but its source are still freely available and you dont have to pay a premium for the full feature.
I really love that editor because of the interface, i mean there is tons of editor and this one is not the lightweighter nor the fastest (in particular on opening). But it is still nice to write code with it and i dont feel like i am torturing myself every time i write a piece of js code.1 -
Adobe Cloud got my computer messed up and it couldn't even be uninstalled! I got so p-o I went to the registry and nuked anything containing the word "adobe" in it. Pheeew, what a relief! Like taking a real good dump! My computer both starts and runs faster now, and without popups requesting me to log in to Adobe Cloud.
-
Is anyone here using something like "moqups"? I found it just recently and love the idea of it all being in one place with its own project folders, but the thing that is throwing me off is the money to what you get ratio, since it would be nice to have something that combines trello+adobe xd+flowcharts and more across devices with near unlimited space.2
-
So this one is more for web devs out there, but is Adobe Experience Manager as popular in the enterprise works as my boss claims? I've never heard of it getting used much, and I don't hear about it in web development circles.2
-
Internship Title : Database building
Skill(s) required: Java, PHP, HTML, CSS, JavaScript, C#, Python, SQL, Bootstamp and Adobe Flash and CCNA
Yes, you read it correct, Bootstamp
WHHHHYYYYYY ???3 -
This is the first project that I remember. There were probably others before it, but nothing really stands out before this.
My buddy and I got an Independent Study together in high school. Our goal was to write a video game. We harbored no illusions that it was going to be the best game ever or anything, it was supposed to be a project that taught us enough to move on to something else later.
Our chosen tool for this endeavor was Flash 4.0, back before Adobe bought Flash. I don't know why we thought it would be a good idea to do this. I think it was because we could let Flash handle all the graphical stuff and we could focus on the behavioral side.
I don't really remember much about how the project turned out other than we both learned a lot about what not to do.
Luckily, the teacher overseeing our Independent Study felt that the lessons learned were more important than the product, so we got high marks. -
My way through front end started with a simple request of changing a blog CSS.. which I knew nothing of. Looking back it feels odd starting with CSS then HTML, JS and now first PHP; but oh well what ever works?
That was a couple of years ago and lately I've done couple of minor freelance projects and have helped students at my university with it (I studied network engineer because I doubted myself..).
I never felt that I knew enough of programming or front end.. that I wasn't really "good enough" to apply for a job even though I almost finish the frontend certificate at FCC, did the Android application schoolar via Google and have worked a lot with Adobe CC overall and help people with their front end issues from school, even with library's I haven't touched (mighty power of Google search and quick learning).
Now sit here as a stockmen in my lunch break being all excited for one thing based on a conclusion I took last week.. if I never try to follow my passion for it, I'll stay a stockmen.. so I applied for s frontend job and got a call in for an interview today. I still doubt myself but figure I must try.. I do not wish to stay where I have been the whole year but to move on and work as a front end Dev. If I get it.. than Santa came early and if not.. well.. keep on evolving and trying I guess. *Holding thumbs* -
As a junior in a print communication agency, my boss wanted me to make their portfolio.
Their requirements were: a full animated flash website (in 2010...). Understand, they had been bought the Adobe license...
After several months of works and ton of alerts about flash death, the website has been deployed.
My boss did not understand why he could not visit the website with its iPhone...
The website had lived 2 months and will was replaced by a static "wix" alternative... So much work for nothing because the boss did not trust a junior dev.
Biggest lesson: Always begin with fast proof of concept to validate your hypotheses for you and for your boss ;) -
Macromedia Authorware. Wasted 3 months of my life on a course assignment and classes for this. Shame really cuz I was hoping it would improve after Adobe took over.
-
Adobe "enterprise" cms... Want access to GPS location, links to external tracking sites, adverts portals... Soooo this is what Enterprise looks like by Adobe? How come they still have the legal right to "develop" software?1
-
The fact that affinity designer,photo is better than Adobe illustrator , Photoshop affinity is killing the game1
-
Ok so I had to make a revision on a PDF with JS that was being tested to fix some bugs, I hadn't touched it or Acrobat Reader for more than a month I think but I could work on it well back then.
I had to see the problem first so when I go and open it with Adobe Reader, it crashes. Weird. I can't get it to work.
Well I'm reinstalling it then.
After downloading the (now correct, I tried to use an old one I had and lost some time) installer, I tried to install it and it asked me to close Outlook and Excel. Weirder.
I do, and after finishing it said "you have a newer version, open it?". Super weird. Of course when I accepted it didn't work.
I uninstall my current installation and while uninstalling it asks me to close Chrome. Ok now I'm not ok with this shit.
Adobe wtf?
I needed to fix it in some minutes and it ended up taking hours.4 -
I am trying to fix my magento broken modules since last week still stuck ... The documentation sucks for Adobe Magento... 😪😪1
-
I hate that I need to have Adobe Creative Cloud and its accompanying bullshit on my computer to use Adobe XD for mockups... how it intrudes on my file explorer as a shared drive... how their idea of "free" is planting a seed on my system to leech off of me in the future... how it just crashed my explorer while updating... this is why I run Linux on my laptop, why I wouldn't use Windows at all if it weren't for gaming, and why I ALWAYS use open source alternatives when they are comparable in functionality and performance. In the same sense that people don't like big government, I don't like BIG SOFTWARE.2
-
I'd bring back ActionScript 3, make sure it is supported in all environments including iPhones, make swf files lighter in size, make adobe air a popular platform, basically I'd do everything to bring back AS3, even make it open sourced, so that Adobe doesn't make all the money.
-
When you work with a client who will only use Fireworks for graphics but you only have one dying old machine with a licensed copy and Adobe won't give you keys even though you bought them years ago (and can prove it!) and you can't buy new keys because they don't sell them and even if we had them we can't download it any more.
WTF Adobe!! It's a dead product! We don't want support or anything. Just give us the feckin' keys and the bloody installer!!4 -
What do you guys think of the Adobe's new "Photoshop" on voice technology?
It's innovative, but I understand it's benefit other than heavy potential misuse it can used for.
See the video: https://twitter.com/ziyatong/...
RIP voice over artists and impressionists, it looks like your job is gone.2 -
! Rant
Gimp and Inkscape vs Adobe
I don't want to make people angry, but maybe one day I'll be able to go back to numeric painting a little. So I was wondering what is the problem with Gimp, Inkscape and the others?13 -
Long standing PhotoShop bug in Wine FIXED! It's stated that it was for CS5, but I've heard one report that it's also fixed a CC version, but not sure if it was the latest CC or not. I don't miss much from Windows, but the Adobe workflow is one thing I do miss. Possibly the ONLY thing I miss at this point. https://bugs.winehq.org/show_bug.cg...
Has anyone got around to trying this yet? Maybe I can test tomorrow and report back!14 -
Stupid Adobe Experience Manager only works in IE11.
I develop on MacBook pro.
I setup remote desktop on a windows computer at office to remote in so I can work on my MacBook remotely and deploy (manually via copy and paste into a text area called “HTML code”).
Everything is setup for the weekend.
Boom, it restarted itself and went to sleep after a Windows update...1 -
I really like Linux but it makes me mad when apps I use, like Adobe XD, are available for everything but Linux.
I'm not even going to start with HBO not being able to load streams on Linux. I payed money to stare at a black screen.
I tried to use PlayOnLinux for Adobe Creative Cloud but XD doesn't even appear there.
I also hate dual booting because when I'm using Win or Linux for a bit I tend to make different desktops for different programs/IDEs/browsers and I like them to be open at all times for easy access when I want to do shit. Dual booting means having to open all this again
VMs are even worse in that they tend to be very slow and when I see choppiness when moving windows I immediately "nope" out of that shit
I can't put up with Windows's bs anymore, but not being able to use the software I need is even worse.
I don't know what to do4 -
In high school I had a digital media class, where we mostly learned Adobe design software and video editing and whatnot, but one project was to actually code using Programming (the software) and I loved it. Later that year I used a free project in the class to learn arduino per my teachers recommendation. Absolutely loved every second of that project, and have been coding ever since.
-
Does anybody here still use dreamweaver? I used to use it a lot back in the day when I started as a designer, but haven't used it in years, but I noticed the app in our companies adobe subscription plan and have installed it.
Given that we live in an age of VS Code, sublime text and so one, I'm just wondering does anyone still use DW and if so what is it good at?2 -
My first CS class is a basic introductory C++ course. Won't even be going into OOP.
So I want to use my own laptop for the course, but I have a Mac. Thought I could use Visual Studio for Mac for the class, but turns out Visual Studio for Mac is really only for Multiplatform development with C#. Ok, then, screw that. Just wasted 20GB and an evening installing that just to uninstall it.
I'm using JetBrain's CLion for now, but apparently we'll be doing some graphics work later this semester so I'm going to need to install Windows via Bootcamp and Visual Studio there... but my SSD is too small...
I currently have Windows/Bootcamp installed on a 1TB external hard disk but that is slow af. My SSD is only 250GB and I've already used half of it for various programs I need (Adobe crap plus Logic crap cuz I make videos and music).
My only option here is to buy a new SSD but only one manufacturer sells those (OWC), and a 1TB SSD is stupid expensive, $700 almost as much as I paid for this laptop used.
So, I guess I'm just kinda deciding right now whether upgrading storage is really worth it...6 -
//norant
I used to run linux with photoshop and illustrator on wine but I recently switched back to windows so I can run the adobe stuff natively and im using the new linux subsystem and honestly , it works pretty darn well.3 -
docusign signs sucks
adobe mobile sign app wount login from my app
google docs cant sign imported pdf's
wtf 😅 is everyone trying to stop me from working. i don't want to print sign and scan -
I know the video editing software LightWorks has its aficionados. I can see how it's powerful. I've been using it since at least version 12. But my gosh how it screws people over. In the latest version, when you import files into a project and then want to delete _just the reference_ to the files in the project, LightWorks says "Nope, imma delete the FILE, too!" So you can never just start over with an import. When you import a bunch of still photos in one shot, no matter how many, it imports them all as an unwatchably fast 1 second video sequence instead of as an individual file. Like...what? And they've dumbed down the interface so much that there's no toolbar. You have to right-click poke at everything to try to find where stuff is. And right clicking is NON-EXISTENT on a Mac. I had to use a pen tablet to achieve it. I'm too cheap to buy Adobe Premiere for the few times I have to edit video in a year, so I guess it's just ShotCut on Windows for the rest of my life.1
-
So my current company held a dev showcase last week. It was an event to show the different projects/tech stacks that different teams are working on/with. There's about 12-14 teams in our company. My team lead and I were brainstorming ideas on what to show on our booth. And I told him, I have an Intel RealSense developer kit that we can use. Anyway, fast forward to the day before the event, I was still developing our app/game for the booth. Just an emotion detector and you have to trick the app with your facial expressions. (Weird and fun, I know). The head honcho walked past the team lead and I and looked over the demo that I was playing around and he said that: "That's not work. You're wasting time again."
We were both irritated by his comments because he's one of the top dogs in the company and he surely knows about the event. Also, it's our way of showing to him that we're flexible in doing fun stuff instead of just enterprise and internal systems!
What a fucking kill joy! -
#adobexd got a new update as they do every month and i am totally loving it.
@adobe this month got a new update and these are the things you can see now in adobexd.
➡ Free plugins :- Yeah you can add plugins to your adobe xd now using which you can do a lot of stuff like pulling avatars , building icons , getting free ilustrations and much more .
For this go to the slide menu panel on the left.
On the bottom click on plugins icon
choose anyone and install .
Really great and handy feature .
➡Another one is that you can now use subscript and superscript for your text ,thats also cool feature as well.
Ok thats it
Let me know if you have any cool plugin you like from it . >>>>
2 -
I'm this👌🏻close to buying affinity designer.
As someone who rarely get time to experiment with designs, Ai is just too expensive. -
Adobe Illustrator worst program ever!, Need to get measurements from a webdesign and it takes for ever to load, missing images and fonts fuck this shit.
-
Hi all. I just wanted to ask you if the Bash in Windows is actually usable for web development? I used to work in Linux until recently I needed Adobe products so I had to install Windows.
I installed putty, git, svn, xampp and all, but it just feels like I just bloat the OS.1 -
Anybody fluent in Adobe Illustrator, with 30 minutes of spare time feeling unlikely generous today?
I need a tiny, tiny, tiny and simple shape/logo to be done, but my credit card is locked until next month due to previously put (by me) limit.
I can only pay in special thanks on the projects (open source) page.
Top Tags
Weekly Rant
View