Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "player"
-
Loved the first project at the university. Your game had to load a map from txt file and create a labirynth with a player inside. It shoud include a bird's eye view and FPS-like - all using only console characters. There were some bonus points - for example for animation or built-in map editor. (language was C)
29 -
Hacker uses windows media player to hack into police database....
//Happens only in Indian movies
PS : don't try it at home.
22 -
The year is 2025
vlcInstall.exe
"You already have videos, the trusted and safe media player for windows 10"
AtomInstaller.exe
"You already have vscode, the better and lighter editor for windows 10"
SteamInstaller.exe
"You already have Microsoft solitare, a fun, better game for windows 10"
*googles c++ tutorials*
"Try c#, safer and robust language for developers, oh and did we forget to mention use bing?"
*downloads arch iso*
"This file has been marked malicious by windows defender. Oh and we updated your bios to allow only windows bootloader. You're welcome."10 -
I just witnessed this interaction between my CTO and an intern. CTO was a good 30 feet away, so everyone heard:
CTO: *talking about some notepad or something* "I HAVE ONE IN MY DESK!"
Intern: **froze - afraid to go through his desk**
CTO: "TOP DRAWER!"
Intern: ..........
CTO: "GET IT, FUCKER!"
Intern: **blushing - gently opens drawer**
CTO: "KEEP GOING! PAST THE CANDY!"
Intern: "I ..."
CTO: "PAST THE WHISKEY!"
Intern: **softly** "I found it..."
CTO: "THAT WAS HARD!"
Intern: *starts walking back*
(player 3 enters the game) Director of Software: "BRING THE WHISKEY!"
Note: The intern was laughing, he is just a bit timid.
I truly love my job.16 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I make games, I don't do frontend fucking webdev; this isn't my fucking job and I don't fucking understand it. Fuck you, client with money. (Yes that is a CSS for beginners page, no I don't care. Screw you.)
15 -
Apparently this little music player has no transmitter, receiver, microphone nor camera, pity on you NSA!
12 -
If a teamviewer sessions counts as "screenshare", I've got a good one.
The company I'm working for also got an internal video player in the webfrontend of it's product. A customer called in, because the player "stays black", instead of playing his videos. It's a player for a media library of the customer, so it can be any content. A collegue did some trouble shooting, but since the customer was not very experienced in IT they arranged a teamviewer session. At the appointed time, my collegue called the customer and asked him to reproduce the issue, while watching via teamviewer.
When opening the media player, it stayed black indeed, so my collegue asked the customer to try another video. From my desk I heard my collegue say "Oh god, no" (phone muted) pretty loudy and he asked us to come to his place quickly. The customer decided, it would be a good idea to try the video player with gay porn. So we stood there around my collegues desk, watching a hairy man, getting his asshole licked by another an even hairier man for a few secs.
The customer stopped the playback, said "ok, maybe the other file was just broken.", thanked my collegue and the call was over.
We had a few similar cases.5 -
WHAT DO YOU MEAN INVALID CREDENTIALS.
I JUST LOGGED IN WITH THEM ON YOUR SHITTY FUCKING WEBSITE YOU FUCKING INCOMPETENT PIECE OF WANK.
FUCK YOU YOU ARE THE WORST FUCKING CREDENTIALS SYSTEM I'VE EVER FUCKING SEEN; AND I'VE USED YAHOO8 -
FUCKING PROJECT MANAGERS.
FOR THE LAST TIME, YOUR ALTERNATIVE IS UNUSABLE As explained the original proposal, and in comments THAT YOU FUCKING REPLIED TO AND AGREED WITH, the thing you want to use WILL NOT WORK. WHY ARE YOU SUGGESTING IT AGAIN?
FUCK YOU, YOU HAIRY-ARSED TWERP.
Also, dfox can we please have fucking anonymous rants!10 -
Just like basketball player need good shoes, programmer deserve a better keyboard.
Definitely not show off. Just wanna say I'm a big fun of Cherry MX mechanical keyboard.
17 -
EVERY FUCKING DAY ANOTHER RETARD ON MY DOORKNOB WHO HAS TO TELL ME ABOUT HIS GREAT IDEA.
I GIVE A SHIT ABOUT VOICE ENABLED MUSIC PLAYER APPS. SO THAT YOU CAN CHANGE SONGS WHILE TAKING A SHOWER
NO ONE WANTS A GPS TRACKER APP FOR THEIR FUCKING DOG AND HOW DO YOU EVEN REMOTLY THINK THAT YOUR FUCKING DOG HAS BUILD IN GPS ANYWAY
AND NO WE WILL NOT MAKE BILLIONS AND TAKE YOUR 10% SHARE UP YOUR ANUS. YOUR IDEA IS AS WORTHLESS AS YOUR EDUCATION WAS OBVIOUSLY.13 -
Installed new Ubuntu 17.10 on my Notebook and with that Terminus and an amazing music player called Harmony. It integrates all common streaming services e.g. SoundCloud, Spotify, YouTube and many more. And it has css theme and js coding support.
3 -
I swear 90% of people who apply for a dev job couldn't code to save their fucking lives.
Like wtf? You can't apply for a job as a commercial pilot, then turn up and announce you've never flown a plane before, so why is that accepted as being somewhat expected in development?
Fucking hell....9 -
Why are devs so fixated on other devs' IDE, OS, programming style and chair choices??
Imagine if every sports player would comment on the way the other walks, bats, the colour of their shoes!
Devs are a bit picky don't you think?12 -
VLC because it really is damn good. The only player which gives you a nice looking interface irrespective of the windowing system it runs upon - Gnome, KDE, XFCE, MS-Windows, Mac. And that 200% boost in audio is really helpful with files having very low audio.13
-
Skype, on my laptop, updated the other day. It was like: 'Oh hey we're downloading skype for windows 10!', and I was like 'oh yeah? cool! ... wait, I'm not on Windows 10 WAIT WHAT ARE YOU DOING NO WAIT NO STOP'
And now it doesn't work. Yay!3 -
Stay away from those LinkedIn recruiters who use words like: "Cutting edge technology" , "Geeks", "Top notch", "Team player" , "Esteemed organization" , "Ground breakers" , "Change the world" and any more of these shitty phrases!!4
-
Sweet mother of butts, I can't believe I forgot about the Windows XP media player. Seeing it again I can't believe it ever existed.
6 -
I am developer.
Discussing the design of our App, he asked me whether I have used tinder. I replied, "No, never had to..."
He laughed out hard and also told his colleague this joke.
I am a developer.
But... I am also a gamer, not a player 😎
I dont need tinder, I have Counter-Strike.8 -
If you don't let the company enslave you then you're not a team player.
Also, you're definitely NOT flexible!8 -
Okay, question;
Can I use ANY phone number in my game?
According to Wikipidia:
"Numbers between (555)-0100 & (555)-0199 are reserved for fictional use."
But.. I'm wanting to have a little phone pop up in my game that you can enter phone numbers into and text the corresponding player (and i hope to have more than 99 players) I would just have contact names, but I want players ti be able to dick around with other players.. Like, post their number to in-game telemarketers and such. What fo you think I should do?29 -
A friend just said that "Coding is 90% knowing the theory, and 10% knowing/googling the syntax for a particular language."
Do you agree?14 -
Is there a mp4 player on linux than can play in mini view like w10? VLC got a limit on how small the windows is allowed
15 -
fuck me X'D Complained to nowtv that their player wasn't working because apparently it finds 'screen sharing' software running on my mac. This was their response
18 -
Writing a tic-tac-toe player in Prolog. So much fun solving a problem with only rules and no loop control 😍2
-
Fucking bruteforce man. Was supposed to go sleep when got few messages from my gameserver players that their accounts have been hacked.
Checked their logs, all of their accounts have been accessed from Russia. Told them to change their passwords and they told me their previous passwords which were easy af to guess.
Digged deeper and found hundreds of thousands failed logins in the last few hours and all of them from different ips.
Since I cant modify gamefiles on client side, the solution for now was to disable in-game registration and force player registration through the website form with captcha and also where each players login name gets appended with a random suffix chosen by player from a random list..
Fuck you bruteforce scriptkiddies, good luck guessing accounts now. At least I can sleep now.18 -
Tried deploying a new nginx server today, wrote the site config manually.
"Alright, done! Let's restart the service and look in the browser how it looks"
# systemctl restart nginx
> Process exited with error code.
"Fuuuuck..."
# nginx
> Unexpected } on line 13.
# vim /etc/nginx/sites-enabled/thatconfig.conf
"Wait wtf.. there's nothing wrong with the curly braces.. they're all opening and closing as they should..."
*takes another closer look*
Line 12, missed a fucking semicolon 😑
Append semicolon, :wq, # systemctl restart nginx
Works like a charm 🙄 all because of a stupid semicolon.
Until now I thought that the semicolon jokes were just lame.. but damn you semicolon, you are indeed the superior hide and seek player 😅9 -
Started with planning to develop super Mario Bros. Using python.
Ended up with a music player which can play ogg (and mp3 files with 320 kbps bitrate) .
Why!?3 -
Windows is probably good now...
And Real Player probably isn't buffering anymore either.
Still don't want to try either.12 -
1. Set your podcast player to 0.5x speed
2. Listen to your favorite dev podcast
3. Imagine they're all drunk
4. Profit -
Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!
15 -
Finally fixed a major bug.....
FUCK YOU C# AND YOUR FUCKING CASE SENSITIVE BULLSHIT.
DAYS
THAT TOOK FUCKING DAYS AND AT NO POINT DUD VISUAL STUDIO BOTHER TO MENTION THAT FUCKING ERROR.
1 CHARACTER, ON ONE LINE, EFFECTIVELY BROKE THOUSANDS OF LINES OF CODE
fuck this, I quit. See you next time you contact the Microsoft live support chat!13 -
I had to create a c++ dungeon 2d game as University project.
The spec said "a terminal game made with char"
I and my team made a real game with anemies boss, and balanced stat in 15 days with Qt (we asked if can use external libraries)
We got 6/8 point for the project cuz we forgot to put protected/private the attribute of the player...3 -
Biggest? I want to create a full epic single player RPG that connects the players to the characters and leaves them with that empty feeling after they’ve finished it because the game was that damn good.3
-
Really unfortunate that we all just accept people being assholes because they're good at their job. I guess it's just the way the world is but personally I don't think you get a free pass to be rude just because you're a key player.
Life is short and whatever bullshit project for whatever dumbass company you work for is ultimately not that important in the grand scheme of things. Don't let your hyperinflated ego misguide you. Be nice to people.9 -
https://blogs.adobe.com/conversatio...
Adobe Flash Player will officially die in 2020.
No more updates. If there'is a security bug, it remain.30 -
Scenario 1
Friend 1:"Hey, you're good at computers right?"
Me:"Erm yup."
Friend 1:"Can you hack Instagram? I've lost my password."
Me:"Oh My God."
Scenario 2
Me looking at a friend's unity C# code
Me:"You know there's an enter key right? Why is your code horizontal not vertical?"
(Means that after a semi-colon he continues his code)
Friend 2:"I like to read my code in horizontal, that feels natural to me"
Me:"What ever, as long as it works. But why do you have so many if function inside another if function?"
Friend 2:"Cuz I want the player to do this while moving"
Me:".........."3 -
Confession: I have an original Zune mp3 player, and use it. It has outlasted 2 smart phones I used as music players.9
-
My new phone will (as a default feature) discover the devices that my housemate is using to stream content on the WiFi network - and let me control them.
Right now, I think he's getting ready for bed, but he left the player paused instead of turning it off.
Let the fun and hilarity ensue.
5 -
Hey! You there!
Are you sick of windows 10 sending you intrusive reminders about updates? Are you tired of random unscheduled restarts? Tired of feeling like you have no control over your own computer?
Take back control!
DO THE FUCKING UPDATE, YOU FUCKING INCOMPETENT, USELESS, LAZY, PIECE OF DRY WANK!
Seriously guys: pick a time convenient to you, and take 5 or 10 minutes (when you're likely spending hours at your computer), and do them. Not only will you get rid of the annoying notifications, but you'll also keep your pc safe and secure by keeping up with security patches. C'mon people, it's really not that difficult.
And can we please, for the love of all things holy, stop the circlejerking? You're developers, you are the computer proficient. The only things a PC will do are the things you tell it to do. Dig deep, dig into the registry, dig into the services manager, dig into the fucking settings cos a good number of the most common complaints can be fixed in the basic options menu. Tell your computer to stop doing the things you don't like and it will stop.
It's really not hard!16 -
So i made a "mini player" which is inspired by the windows 10 mini player! it turned out better than i expected
7 -
Well, my company hired a total amateur who can't do anything right on his own without copying code from me or the internet and I have to pretend he's helping in any capacity because otherwise I'm a "bad team player" and "should communicate more".
Helped me get over impostor syndrome, at least.7 -
I just wanted to watch that video! who on EARTH still uses adobe flash player! seriously can anyone tell me?
7 -
My lead developer has a tendency of saying "that movie fucking sucks" every time I mention a movie.
From Saturday to Sunday, I have seen ready player one a total of 6 times. If tomorrow I mention it and he says that it sucked I am gonna go ahead and Texas bitch slap him across the face with the power of Spielberg.
There is only so much trolling I can take my dudes. And I really fucking enjoyed the movie.
If you haven't seen it then please go ahead!!!20 -
I'm learning web development, and this is another small project that I made - a basic code player.
Used jQuery for the first time and realized how easy it makes things.
PS - I know it is pretty insignificant given that people here create much bigger things, but I'm proud of it!
PPS - Will post the previous small project I'd done. It was a browser based basic game.
17 -
3 feet away from the bin
* throws plastic bottle *
* hits edge of table *
* barely didn't go in *
Coworker: Thankfully you're not a basket ball player 🤣
😭😭😭2 -
Today we got a company announcement saying "Our time management tool got updated."
..still uses Flash Player.
For god's sake how is this even possible. Who did this?!2 -
I'm doing my own sci-fi D&D story and need some new weapons! So why not use programming names? 🤔
So far:
voidpointer
nullifier
destructor
finalizer
One player is also a dev and I want to trigger him as hard as I can 😈6 -
I'm sick to death of hiring people from other companies and explaining GitFlow and why its useful (what are you people doing?).
Then watching them doing it wrong, pointing out its easier to use something like sourcetree. Which leads to "... well see, the terminal is just more efficient, tools like sourcetree are bloated".
Ok fair enough, well heres the deal i'll make with you, while using your "efficient tool", stop breaking our workflow and i'm fine for you to keep using it. Otherwise, stop being a dick and be a team player.18 -
Haven't coded for a few days, returned to my github project to find one of my co-workers has gone through every single line in all of the scripts and added passive-agrresivd, sarcastic, comments about what they do.
Thanks.... I guess....5 -
We were participating in a competition once where our project was an accident detection sensor (it was a business competition). We took a broken mp3 player without cover and used it as the device while our laptop played sensor sounds.
We were the runner ups3 -
Working for a company where the coworkers working 24/7 and the boss (ceo) expect me to do the same, even working on weekends.
But when i mentioned I have life distinctly personal and working life. But no, boss wouldn’t care much about my life anyway.
I got call names for being a not team player, not committed much , a thief (“ I paid you money but you didn’t work 24/7”) and they even claimed I don’t have heart to work.
It affect my personal so much that I can’t be happy even on the weekends. I got perturbed sleeps. Keep thinking of working .
Obviously they played well on guilt tripping me.7 -
In order to reduce support costs, manager instructed his team to remove all logging/reporting of errors in the company’s CRM application.
Team’s support tickets went down 80%, manager received an award for his efforts, but mysteriously, DBA/support workload increased, bad/missing data,
increased support tickets in other areas of the business (shipping, etc. that relied on correct data from the CRM) and other side-affectual behavior.
Even after pointing this out this correlation, showing before/after code, no one believed the two were related and I was accused of not being a ‘team player’.
“You and the other teams need to learn from his example!”. As ‘punishment’ was I was moved to the team managing the CRM application.1 -
"We offer competitive salaries!"
Competitive as compared to what? The bottom 10% of salaries in this field? The top 10%?
I could say that I'm a competitive chess player when I'm competing against somebody who's never played chess before.4 -
"i need help my grandmother installed a fake flash player and it's installed norton and mcafee"
So... Nuke from orbit?15 -
!rant
I made internet radio player with raspberry pi. It uses IR remote controler and also play music from my collection. Pi is really usefull device. So happy.2 -
I just wanted to make with the Spotify API an online player. I sat 2 hours and still can't figure out how to center a fucking unordered list which is horizontal aligned
FUCK CSS7 -
This will be 4chan-r/greentext-ish in format. Also "me" is not me, PTH, it's referring to a game studio.
>Be me
>Be game studio
>Create event for weapon design
>Player base submit in a craptonna designs
>Holyfuck.jpg
>Create an internal service for voting
>Service doesn't check for vote except for a login
>MFW one submission has 6-digit votes
>MFW a lotta submission also start gain a lot of votes
>WTF.gif
>The vote count spiked
>Votebotting is here
>Ohshit.gif
>MFW I don't how to filter votes
>MFW I can't block rerouted traffics (VPNs, proxies, etc.)
>MFW the Discord server of the game gets vocal then Reddit.
>OhshitIfuckedup.mp43 -
#ad
If you like to hear music on YouTube, I can recommend you Headset (https://headsetapp.co), a nice little music player for the desktop, that streams directly off YouTube!
I've been using it for a year and it's really useful for while coding. Especially the ability to use the keyboard media keys!
Also there's a German translation since yesterday! (Done by me :D)10 -
Does anyone know of any good audio book sites besides audible? Free ones are good too, of course, but I don't mind paying for them.
Likewise for a good player, since books aren't music.13 -
Why the fuck do apps throw tantrums as soon the phone looses internet connectivity?
HBO stops steaming and closes the player as soon as wifi disconnects, discarding the buffered data.
For Quora, it replaces loaded answers with a UI asking you to reload the page. Now, what am I supposed to do in the lift? Stare awkwardly at the lift buttons?
At what point did we decided bad user experience and arbitrarily discarding cached data is the way forward?4 -
I spent hours figuring out why my html5 video autoplay didn't work on Android. I muted it like they said, I tried many different ways to play it, even with a 3rd party video player, nothing worked. It's actually because my Google Chrome was on data-saving mode. Motherfuck.2
-
1) Using ScreenRecord record a video deleting his work folder(fake one obviously).
2) create command line vlc player to play this video on startup with flags -f and --no-qt-fs-controller
Eg. vlc -f --no-qt-fs-controller file://<file path>
Enjoy the show 👿 -
So recently I needed to make a little Tic-tac-toe game with Node.JS for an university project. I previously learned Java and C# so Javascript as a non-compiled, script based language was something new for me.
Now during the programming process I reached the point where I needed to implement a function to change the player who's playing.
I was testing the game and... It seemed like the player was changed twice so it immediately switched back to the previous player.
Using a lot of console.log's I finally stumbled upon the error... (since Javascript or at least Visual Studio Code, I honestly don't know, doesn't have any kind of debugger or something).
Why the fuck does js allow to make allocations in if conditions?
I accidentally wrote one '=' instead of three '==='.
No error, no warning... Nothing.
Since then js and me are not friends anymore.8 -
I wish people would stop using Electron for everything. It's like running an instance of a bloated web browser every time I open an app. Running Slack and Spotify eats a ton of ram, a chat client and a music player. I'm resorting to just running these apps as pinned browser tabs.18
-
How to slack during work like a pro? (if you are a unity developer)
1- make a full screen youtube player inside Unity.
2- fill most of the screen with panels (debug, file browser... etc)
3- watch a video about overwatch or something.
enjoy!!
4 -
Client: my video player has two play buttons.
Me: ok that's weird let me check yes it does have two play buttons your right so turns out the client has taken a screenshot of another video player with the play button still on it and used that as their poster image hence two play buttons.
Finding it impossible to explain this to them arrrrggggghhh why why why1 -
A centralised "music on hold" system. Powered by a PHP web service, and a raspberry pi in each clients office(s) to handle the "player". Essentially a distributed DJ system.1
-
Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.
At least I'm getting payed7 -
Joined a new project and started messing with the application...Greeted with a blank web page and a pop-up **please enable flash**1
-
Aint a rant, but pulsar player has the best fucking implementation of the material design ive ever seen, everything is perfectly flat and still alive aaah
4 -
The first PC I was exposured too. At the begining I was just playing games, but then I learned about BASIC and was intrigued enough to start typing the sample source codes which was listed in popular sience magazines.But when I run a simple pong game which was written as 2 player game and decided to make my first AI to play against me which at my first attempt got so perfect that I got not chance to win and then slowed it's reactions so I can actually enjoy playing against it and win some times... well that's the moment I got really hooked.
4 -
Code your own damn stuff!
I am building a RFID and button controlled music player for kids.
I am using a couple of different modules for that. The one for the input was really laggy. I thought it was so laggy because of the network delay. I tinkered with it a week but it didn't improved. So I just coded my own module which was much easier to do than I thought.
It was a really rewarding to code something yourself in less than a day instead of trying to get something working for a week. -
Soon, Firefox will be the only viable browser. Google cracks down on adblockers with manifest v3, and all Chromium-based browsers are soon to follow, involuntarily so. Safari won't, but you can't make a Safari extension as easily.
Mozilla stated Firefox won't support manifest v3. This means adblockers will remain functional.
There is a fourth player though — Nyxt. They use WebKit, but they support Chromium-like extensions. Nyxt is built in Lisp and C. But Nyxt is an unorthodox browser to say the least.6 -
A checkout application where, in the confirmation screen, everything (amount, references, currency, quantity of items, etc.) was sent to the client as a form, and they submitted this form to confirm.
...but there was no verification on any of the above. So any of the above could be changed and it'd collect whatever funds, and order whatever items, with whatever references you gave it.
This wasn't a major player in the space, but was big enough that most people would likely have heard of at least some companies using it. It's still being actively used today, and I can near guarantee not all the flaws have been fixed.1 -
Just remembered an old dad story:
Around 30 years ago I started a game on my Commodore 64, I was about 15 at the time, and back then you had to load the games from cassette tapes.
So I started the cassette player and waited for the game to load, and when it was done I stopped the tape. My dad saw this and he asked :
- "Why did you stop the tape if you want to play the game?"
And I guess it is kind of natural for someone who used cassette tapes for listening to music, to say that :-) Still I laughed at my dad...3 -
!rant.
Can we just show some community appreciation for @tahnik, I literally see them on everything I post.
Thanks dude!3 -
! random story
Today i was cleaning my laptop and on right side of it i suddenly touched a button... !!!
!!!!SURPRISE !!!!
DVD player popped out.. and it's dusty as hell.. I was like what ?? How long this has been in laptop.. It's weird.. I never used it.. Why the heck we need it.. I didn't saw anybody holding dvd disc nowadays .. Man nobody uses those shit's anymore.. we have pen drives and External HDD's now. Why the heck manufacture's still keep these dvd player in Laptop's..
But it brought my childhood memories back though.. !!2 -
+++ Sudo team adopting Adobe's Flash player, uniting security with design +++
Could we please stop pretending, that the choice of language has no security impact:
https://sudo.ws/alerts/...25 -
Cat-warming solution when the power goes out
Problem: Your power goes out in the middle of winter. Your cat is cold and will not leave you alone. You are her only source of heat.
Step 1: Find battery-powered laptop.
Step 2: Power on laptop and turn off sleep/hibernation in the settings.
Step 3: Open up 5 instances of Minecraft and load a single-player world in each.
Step 4: Close laptop and flip it upside down
Step 5: Place cat on computer above the fan. Cat will begin to purr.
(Yes this works)2 -
Me: *adds a shiny new graph to our foos web app showing player ratings*
Fred: Can I please have a button to see just my scores?
Me: *adds "JUST FRED" button*
Fred: perfect, thanks4 -
Been watching The Lord of the Rings trilogy since yesterday for the third time in my life. I shed a tear at the end. That movie is as good today as it was 15 years ago. Awesome.
Now, to make this post relevant, im going to close VLC media player, open Android Studio and go on a Kotlin (which is becoming more and more like Gandalf the White) journey2 -
Handed over my first client's project today.
It was revamp for an internet radio site and also the first project that I used Bootstrap 4 in. On top of that, it was the first time I have to deal with PHP and its loops.
Despite audio player errors (somehow, they lost access to the streaming host and hence no audio source), I'm more or less satisfied with the final outcome.
But wait, why that stupid icon is not vertically centered? -
Built a beautiful new fancy html5 page for a big event.
PM still wants to use the old flash video player.
Why the fuck ? Just no ...2 -
Just have just installed VMWare Player for a school project but had to uninstall it because our teacher was unable to put the right version on our share.
Now my Notebooks keybord driver is that broken that a simple reinstall over the device Manager couldn’t fix it!
FUCK3 -
The process of making my paging MIDI player has ground to a halt IMMEDIATELY:
Format 1 MIDIs.
There are 3 MIDI types: Format 0, 1, and 2.
Format 0 is two chunks long. One track chunk and the header chunk. Can be played with literally one chunk_load() call in my player.
Format 2 is (n+1) chunks long, with n being defined in the header chunk (which makes up the +1.) Can be played with one chunk_load() call per chunk in my player.
Format 1... is (n+1) chunks long, same as Format 2, but instead of being played one chunk at a time in sequence, it requires you play all chunks
AT THE SAME FUCKING TIME.
65534 maximum chunks (first track chunk is global tempo events and has no notes), maximum notes per chunk of ((FFFFFFFFh byte max chunk data area length)/3 = 1,431,655,763d)/2 (as Note On and Note Off have to be done for every note for it to be a valid note, and each eats 3 bytes) = 715,827,881 notes (truncated from 715,827,881.5), 715,827,881 * 65534 (max number of tracks with notes) = a grand total of 46,911,064,353,454 absolute maximum notes. At 6 bytes per (valid) note, disregarding track headers and footers, that's 281,466,386,120,724 bytes of memory at absolute minimum, or 255.992 TERABYTES of note data alone.
All potentially having to be played
ALL
AT
ONCE.
This wouldn't be so bad I thought at the start... I wasn't planning on supporting them.
Except...
>= 90% of MIDIs are Format 1.
Yup. The one format seemingly deliberately built not to be paged of the three is BY FAR the most common, even in cases where Format 0 would be a better fit.
Guess this is why no other player pages out MIDIs: the files are most commonly built specifically to disallow it.
Format 1 and 2 differ in the following way: Format 1's chunks all have to hit the piano keys, so to speak, all at once. Format 2's chunks hit one-by-one, even though it can have the same staggering number of notes as Format 1. One is built for short, detailed MIDIs, one for long, sparse ones.
No one seems to be making long ones.6 -
You have 2 options:
a) Work together with a "C player" (low skills/ talents)
b) Work alone
How would you decide and why?9 -
Here’s a novel rant no one has ever seen before.
The iPhone keyboard is absolutely the worst input method ever created. Even primitive keyboards from the 80s are more usable.
I would use a madcatz controller to type instead of this garbage given the choice.
And you know what’s a good interface design? Making the music player controls on the lock screen disappear when Bluetooth connects36 -
YouTube is trying hard to shove their video suggestions into my face.
Video suggestions are on the watch page, inside the video player after playback, and even inside the embedded video player when paused.
Sorry, YouTube, I am not interested in your suggestions before I have even finished watching the current video!15 -
Playing 'old' Flash Player games is my new hobby, I think. Also I suggest "Fancy Pants Adventures" to ones that still play Flash games or like some nostalgia.
Respect to Flash developers, you guys are awesome.7 -
If Google hadn't kill Google Play Music, I don't think a single soul would voluntarily switch to it's YouTube Crap Music.
If you remember prior to 2011 the initial plan of Google was to take market away from Apple's iTunes. They initially shipped Amazon music with branded Android OS before the development of Play music.
As a long term user of Play music I'd say "killing the product" was a "bitch move"!
Because Play music is doing really great and you could tell from its reviews and moreover the destination product is quarterly-baked not even a viable replacement in the least sense.
There are more than a million and one problem with YouTube music, currently you would notice your playlist history gets clogged up with your videos when you visit the video web. It's more like the actual YouTube app hiding behind a curtain to mimick a music player. Which is so so stupid and annoying!
As a user all I want from a music player is to fucking listen to music not to watch fucking videos... which makes the app unnecessarily filled with stupid options you never really need.
I understand that monetisation is necessary but please show some fucking courtesy by doing shit with wisdom!
14 -
recently made a mp3 player out of my raspberry pi 3 b+, trying to add a 16x2 lcd to it and as usual, failing to suceed 😂
3 -
So I got this shitty car of mine and a shitty radio, the radio stopped working, so what Im going to do is pop out the old radio and make a raspberry pi radio and media player for it.
Any suggestions or tips before I get started?3 -
I've been coding for a year and I can't even do hello world in javascript. I've never touched it. Is that bad?11
-
Me:
-Lack of experience
-slow learner/fast learner
-not really a team player
-always keep a positive attitude
-but when I started doing smthing, I'll finish it.
-willing to learn
I wonder if anyone would still hire me to their company.. Let me know.. I fucking hate my workplace and the owner. You hire me for doing smthing else, and you always told me to do smthing else that is not even related to my job. I'm not your fucking ass cleaner. = = you shit on that thing, you clean it yourself. Fucking fucking fuck! -
Why do game studios force social/multiplayer in single player games?
Single player sandbox? How about we make it a multiplayer co-op?
Just fine 1 on 1 brawl? Hey how about you find a team and tag team? No? Too bad fuck you, no points to you for a whole fucking season.
Ugh.14 -
Epic fail. I use a sleep timer in my music player and it occasionally fails to stop and clear the actual timer. It even perpetuates through when I actually turn off my phone, which is rather quite impressive. This is what I find when I turn my phone back on after the weekend. I don't even know how it's possible to have still been going when my phone is off... 🤔
4 -
- wake up
- check the news
- find some interesting video to watch [listen] to
- go get some breakfast
- heat it up in the microwave
*BT headset* stops receiving audio
*video player* stops receiving data via wifi
- write a rant in dR
*phone* sorry, wifi conn jeopardised, can't post
aahhh, the beauty of wireless. If only hostapd had a flag bypass_microwave_noise=1 for bgn APs11 -
Ugh. Challenges. I need to create a 3D two player online game with the new HTML5 WebSockets, and I'm using a free 000webhost server which I barely have control over. Does anyone know how to connect two client connections together in PHP?8
-
It was back on 96~97, using Pascal on a 386 for sure. But the program itself was probably a calculator. We want to learn how to make a program that would stay running on background to copy itself for other files, like a virus. But we didn't intend to build one. It was just to learn how to do that.
My first visual came some time later, on Win 95, made in Delphi. It were a music player, something like winamp.
Good times! :)3 -
So Today is my resignation and most employees after my employer refuses to pay us our salary for nearly 3 months. I am glad that I quit, so I no longer have to do application to scam people (eg, an android of biaural music player that will cure Covid19 instantly with the subscription of 300MYR per test). Also, I am so guilty when the government warn us publicly on the programme I do not feel comfortable to create in the first place. Before this employer pays me to do an app with the same concept of a music player and will cure diabetes after the user listens to the binaural music. (380MYR per test).
Finally got a proper company with a proper Project which related to Deep Learning.
ah.......
https://nst.com.my/news/nation/...8 -
I will never ever see, play, or think about video games the same way again. Even playing all my childhood games is never the same.
I will now forever see the game from the inside out, imagining what code the devs might have written to achieve what is happening: sprites, audio, triggers, AI algos, etc. No longer is a player or character just a player or character; they're sprites, animations, classes and variables and method calls. o.o2 -
Hey dudes, who s in love with Soma.fm?
My favourite stream from famous DefCon chill zone:
http://somafm.com/player/...
Warning: Uncle Bob's speeches may appear in streaming time and hurt your feelings2 -
Watching someone at a conference trying to play a video in their presentation on Windows PowerPoint. It’s painful to see. No audio. They then ripped the video from YouTube. It still wouldn’t play even in Windows Media Player. They’re still fiddling with it while the speaker and audience trade dad jokes. If I hooked up my Mac it would immediately work. How do Windows users live like this?2
-
Game development is a nightmare when your first starting out because you tend to neglect on keeping a small book on event notes.
Such as which event triggers what, and what events to turn off when the player starts the game.
You tend to get events that either don't start when player is far into game because you forgot to turn the event trigger on for something much for earlier in the game.
Live and Learn2 -
Me: "I wanna mod Ikemen so it can have tag presets, a replay recording manager, a player card for online games, a gallery,..."
Windows: takes a whole day to update
Me: "I wanna mod Ikemen so it runs on Ubuntu" -
Anybody watches starcraft2 games??? You see Scarlett destroy SoS?
She should be in my daughters women role models. She just destroyed the best player in the world.
We need more chick gamers!!!!19 -
!rant
What direction would you guys like to see devRant going in. I personally like it as it is, a place where developers can rant, share jokes (but not memes), share their thoughts, etc etc. But I know some people want it to go in more of a SO direction, where it's just another serious questions board. What do you guys think?11 -
As a gun owner and an avid FPS player, and one day (when I get the time) a builder of such games, please may I set something straight?
8 -
So this is a fun bug. Oneplus 5 with android 7.1.1, happens when switching from a fullscreen video (Netflix) to devrant
5 -
Dear BOSE, how can you make a "smart" speaker so dumb and complicated? Why require to use an app that needs frequent updates and takes up so much storage space for ... what exactly?
Dear Spotify, why not add features to the web player if your app does not run on older devices? Which native feature would your app need that is missing on iOS 13?
Dear companies making money due to the fact that some real artists make real music that real people love to listen to, how come your apps and gadgets always make me nostalgic about actual records and make me tune in to an actual radio station at the end of the day? At least you keep showing us not to rely on digital technology and rather go visit actual live concerts to listen to live music in the real world more often!2 -
!Rant
What languages do you guys most commonly use?
Do any of you use C#? If you do, what's your job?12 -
Finally, I made my first android music player App. ☺️☺️
.
I don't know u guys like this or not but it have fully voice recognition functionality.
It means u can completely run this app by voice commands😋😋
https://play.google.com/store/apps/...14 -
!rant.
I must say I love learning new things!!! Took a quick detour to build a small custom music player, now it doesn't seem to be that quick as I am learning a new framework. Only about 11 pages of many more still to go, and the funny thing? The main part I need - how to play audio, is in the last section of the tutorials. -
I never understood why updating iTunes prevents Xcode from running?
Why Xcode needs to be closed to update a music player? Do both rely on same files for reading connected devices?6 -
Last night I spent 2 hours trying to explain probability to a drunk poker player.
He refused to accept that if Player A and Player B are flipping coins and player A wins 9 coin flips in a row, player B should still treat flip #10 as a 50/50 chance and bet accordingly.
This is basic logic, and when I tried to explain it in terms of computers and code he said "of course a computer would win but I'm saying that 51% against anyone I would win, I've been doing this for 20 years"
My brain hurts.2 -
Friend of mine wants to use his old blu ray player as a surround sound amp. Okay, sure it's supposed to have that functionality.
Struggle, struggle, struggle. Then I see on the back, a powered by Java sticker. Guess it's one of those 3 billion devices4 -
My dream project is a heavily story-driven game, with plenty of decision-making for the player and a lot of possible endings. With no money or time limits, I would make it with live action scenes. Just a great movie in which you have the final cut.
-
I'm going through my Udemy courses for the hell of it and see if I might even learn some things, started a course I knew would start of way too basic but Jesus Christ, 7 lectures for doing basic player movement and animation... Strap in boys, it's going to be a long ride
-
Being a programmer is more like being a football player, as you approach mid 30s your game dips really low.3
-
As you grow older, both professinally as a dev and as a team player, you realise that a complete rewrite is rarely the better answer to the problem at hand.
With that being said, I'm rewriting the glorified-mass-of-infernal-human-feces-with-corn-bits-masquerading-as-mere-shit out of a production service right now. Wish me luck.2 -
My machine is running on a 6gb ram with an Intel core i5 processor. How the fuck are my .mkv files still stuttering on VLC?!? 😣😣😣10
-
Auth0 and Okta merge.... Is Cognito the only other major player here? This merge now makes an Auth monopoly!6
-
So I'm writing a function in Unity3D that walks a rectangular grid. At one place in the code, I got the x+y coordinates backwards, which caused the function to infinitely loop between two coordinates.
Not seeing a way to kill the loop, I looked it up on Google. The suggestions I get are. . .
1. You need to kill the Unity3D task and lose your edits because the environment and the player run on the same thread.
2. You can pay ten bucks for an extension that lets you break out of infinite loops.
3. You should really avoid writing infinite loops. That's just bad form.
SERIOUSLY?
1 -
Games which have a save point or checkpoint system: FUCK YOU!
This is a technical limitation that was present in game consoles in the 90s.
There is no fucking need to implement save points in games made today!
It serves no purpose other than to generate frustration for the player and make the player redo the same section of the game again and again when he fails.
Oh how much fun it is to repeat 20 minutes of tedious shit as a punishment because I fell into your cheap trap and died!
And even if I don‘t fail, I want to be able to stop the game at any time and continue later where I left off. Is that too much to ask?
I don‘t want to be forced to progress in the game until you decide that NOW, after 20 minutes is the time that I am allowed to quit playing.
This is a fucking design decision. Don’t make your design suck to imitate the games from the past that did it for technical reasons!7 -
git
Linux
VLC media player
Inkscape
LibreOffice
Metalsmith js
100's of low-level NPM packages I don't know the name of2 -
My non-developer friend (who knows some very rudimentary basics about front-end web dev through me) asked ChatGPT to create a game with an arrow-key (left, right) movable player that shoots bullets.
He pasted the answer in a jsfiddle. The first iteration didn't work. It used DOM and CSS, so I told him he needed to instruct it to use HTML canvas. Lo and behold: https://jsfiddle.net/mehp8jay/16 -
If you ever feel like your code is useless, remember, someone made the “Jazz” equalizer preset on that cheap mp3 player you had in your childhood.
As if people ever chose something other than “Bass”.3 -
Headsup: if you're making a game, or want to, a good starting point is to ask a single question.
How do I want this game to feel?
A lot of people who make games get into it because they play and they say I wish this or that feature were different. Or they imagine new mechanics, or new story, or new aesthetics. These are all interesting approaches to explore.
If you're familiar with a lot of games, and why and how their designs work, starting with game
feel is great. It gives you a palette of ideas to riff on, without knowing exactly why it works, using your gut as you go. In fact a lot of designers who made great games used this approach, creating the basic form, and basically flew-blind, using the testing process to 'find the fun'.
But what if, instead of focusing on what emotions a game or mechanic evokes, we ask:
How does this system or mechanic alter the
*players behaviors*? What behaviors
*invoke* a given emotion?
And from there you can start to see the thread that connects emotion, and behavior.
In *Alien: Isolation*, the alien 'hunts' for the player, and is invulnerable. Besides its menacing look, and the dense atmosphere, its invincibility
has a powerful effect on the player. The player is prone to fear and running.
By looking at behavior first, w/ just this one game, and listing the emotions and behaviors
in pairs "Fear: Running", for example, you can start to work backwards to the systems and *conditions* that created that emotion.
In fact, by breaking designs down in this manner, it becomes easy to find parallels, and create
these emotions in games that are typically outside the given genre.
For example, if you wanted to make a game about vietnam (hold the overuse of 'fortunate son') how might we approach this?
One description might be: Play as a soldier or an insurgent during the harsh jungle warfare of vietnam. Set ambushes, scout through dense and snake infested underbrush. Identify enemy armaments to outfit your raids, and take the fight to them.
Mechanics might include
1. crawl through underbrush paths, with events to stab poisonous snacks, brush away spiders or centipedes, like the spiders in metro, hold your breathe as armed enemy units march by, etc.
2. learn to use enfilade and time your attacks.
3. run and gun chases. An ambush happens catching you off guard, you are immediately tossed behind cover, and an NPC says "we can stay and fight but we're out numbered, we should run." and the system plots out how the NPCs hem you in to direct you toward a series of
retreats and nearest cover (because its not supposed to be a battle, but a chase, so we want the player to run). Maybe it uses these NPC ambushes to occasionally push the player to interesting map objectives/locations, who knows.
4. The scouting system from State of Decay. you get a certain amount of time before you risk being 'spotted', and have to climb to the top of say, a building, or a tower, and prioritize which objects in the enemy camp to identity: trucks, anti-air, heavy guns, rockets, troop formations, carriers, comms stations, etc. And that determines what is available to 'call in' as support on the mission.
And all of this, b/c you're focusing on the player behaviors that you want, leads to the *emotions* or feelings you want the player to experience.
Point is, when you focus on the activities you want the player to *do* its a more reliable way of determining what the player will *feel*, the 'role' they'll take on, which is exactly what any good designer should want.
If we return back to Alien: Isolation, even though its a survival horror game, can we find parallels outside that genre? Well The Last of Us for one.
How so? Well TLOU is a survival third-person shooter, not a horror game, and it shows. Theres
not the omnipresent feeling of being overpowered. The player does use stealth, but mostly it's because it serves the player's main role: a hardened survivor whos a capable killer, struggling through a crapsack world. The similarity though comes in with the boss battles against the infected.
The enemy in these fights is almost unstoppable, they're a tank, and the devs have the player running from them just to survive. Many players cant help but feel a little panic as they run for their lives, especially with the superbly designed custom death scenes for joel. The point is, mechanics are more of a means to an end, and if games are paintings, and mechanics are the brushes, player behavior is the individual strokes and player emotion is the color. And by examining TLOU in this way, it becomes obvious that while its a third person survival shooter, the boss fights are *overtones* of Alien: Isolation.
And we can draw that comparison because like bach, who was deaf, and focused on the keys and not the sound, we're focused on player behavior and not strictly emotions.1 -
Being asked to do a passthrough shader for an adult content media player.
Them selling it as it being like the fucking newest invention.
Bitches. I was doing that back in 2018.
Still, good money for literally 60 minutes work...10 -
Should I spend my money on a monitor? Sitting 30cm from a TV for so long isn't healthy, but monitors are soooooooo expensive?
I don't want to use my secondary monitor as primary because it's relatively small. What do we think?6 -
BRO HONESLY I JUS WANNA PLAY WHACK YOUR BOSS BUT NOOOOOOOOOO I HAVE TO A STUPID ADOBE FLASH PLAYER...........WHOOOOO TF HASA3
-
I was trying out flutter because why the fuck not. I made a plan for an application the downloads an Osu!-beatmap file and extracts the infos relevant for an external music player (like background, the song file, title and so on)
So I designed a basic database scheme and decided to include the files into the database. 3 hours into development it hit me...
HOW THE FUCK IS THE EXTERNAL MUSIC PLAYER SUPPOSED TO GET THE AUDIO FILES WHEN THEY ARE IN MY DATABASE!
Guess I'll just have to replace the files with absolute paths instead. 😒 -
In this game I'm making for class my player was moving opposite of the control pressed... So I multiplied the movement values by negative 12
-
What the fuck is up with Facebook's video player. How the fuck does the biggest social media platform on the planet, fuck up something so important to it. The UX is garbage, autoplay is a cunt with it starting at maximum volume each fucking time. Fucking EllenTube is better than that fucking shit.7
-
I was in a meeting yesterday where a junior dev was pitching an idea for a mobile game. He starts explaining the rules of the game. Here's what he said "Each Players starts off with 5 BALLS 🏀 and when 1 players ball is hit said player loses 1 BALL…" His presentation was excessively laced with mentions of BALLS.
PS: Never pitch a BALLS idea unless you've got BALLS.5 -
Have to change out the audio player on a WordPress site for a podcast. Can't follow the code properly because wp forgets that standards are a thing. Code readability is shit as well. Fucking WordPress.6
-
My presentation looks unappealing (LaTex magic) and apparently due to Adobe stuff, videos on overleaf don't play.
So, I have the choice of moving to another format (google slides of M$ powerpoint) by tomorrow, or switch between the media player and the presentation slides.
Both look... More unappealing than my presentation. 😒🙄😤7 -
Stuff I need to finish:
PHP framework
Music player for android
Nginx module for crypting mp4 fragments
Personal blog engine
Unit and data converter service
Personal transactions application
Too much, just too much... -
Whaaaat? That used to be my default audio player for local music 😠. I'm not going to upload my mp3 file collection to YouTube to be able to listen to them at work...
23 -
1) Having a complex and inaccessible skill trade entitles me to be a condescending elitist.
2) Because I usually choose to waive that privilege and be a nice team player instead I am almost universally appreciated.
3) I get free coffee every day.
3b) No one teases me about my fancy mechanical keyboard.3 -
I bought a $1 Steam game called Square Brawl some 5 years ago. It's a minimalistic arena battle with forgiving physics, diverse and satisfying weapons and a geometric design based on squares.
It's among my favourite couch multiplayer games, but the programming is shit. The resolution is weird, the launcher is some default config screen that came with the game engine, with a controller it's tricky to avoid picking a second color by accident which spawns a ghost player that is jointly controlled by the AI and the player. Sometimes the game spawns 10 copies of everyone, all of which you control at the same time. Getting stuck inside walls is commonplace.
On an unrelated note, I'm making a minimalistic arena battle with forgiving physics, diverse and satisfying weapons and a geometric design based on squares. It's gonna be FOSS and web-based. I haven't settled on a name yet but I think Tetragon Tussle might be good.6 -
I'm working on a very-customized web player at work.
I filled my code with a plenty of comments, many to justify those functions / fixes.
For those comments, Safari is depicted as worse than Edge.
Is it even possible?
The next dev, which will take my code in his hands, must know how much we suffered to build it.4 -
My board game based on mandavoshka is almost done and if you like to test it via Testflight, please do.
https://testflight.apple.com/join/...
I know, a board game isn’t exactly very exciting but I wanted to do this for ages.
It‘s meant to be played on a tablet with up to four players sitting around the device.
So the controls are rotated to the side of the current player.
You can also select the computer to play for a player, but it doesn’t play very well.
The app icon and the background images are generated by chatgpt because I‘m shit at designing.
It was a real pain in the butt to make chatgpt generate repeatable (tiling) textures.
The app will be free but I added in app purchase to unlock the color picker for each player. It will be the cheapest price of 0.29 €.
I‘m doing it to get experience with iap, not to make money.
You can test the iap for free during the Testflight phase.
4 -
Anyone use Golang here for system programming? I recently learned go and it would be very helpful if someone would describe me the pitfalls in go while writing fast softwares. I am planning to write a music player for Linux in go.11
-
A truly scary multiplayer gothic horror action RPG set in a Victorian world with a Lovecraft inspired story (already got the story written as it so happens) with multiple mutually exclusive but tightly linked story lines. That is to say you can experience only one part of the unfolding story with the player having to communicate and interact with others in the game world to discover the full horror of the world.
The world would not have instances the world would be in a state that players find it in, based on what other players had done.
I have a lot of the game mechanics thought out, but time and money... If only it were limitless...3 -
!rant
Playing Battle Royal with friends, had to leave 2 of 4 teammates behind as the play area was shrinking and they couldn't be rescued. The 4th player ran me over with a game car just to get revenge for our other team mates.
With me alive we actually had a fighting chance to win the round. (8 kill streak and lots of ammo with a decent tactical position) ....but NOoo the fucker thought it more sweet to kill me rather than help me win the round!
Fuck this shit, I'm out!1 -
Dungeons and dragons, I am the dungeon master for two games and a player in one. Great laugh if you can get everyone in the same room with lots of booze 😁1
-
To the developers that still use flash player for their games, fuck you.
My grandma wants to play some games and i can't fuckin make it work since your piece of shit games still use that piece of shit flash that in 2 years will be dropped fuckin scumbags. And now i'm trying to find a way either to explain to her how retarded you are or find a browser that supports this piece of shit.2 -
Implementing an Audio File preview for Voice Records for one of our clients. The system we are reading names the files by IDs date length etc. And every value separated by #.
Why the hell you name a file like this: 12345#20171204#523.wav
We are implementing the tool with web technologies and this is not just ugly filenaming but also very url unfriendly. -
I made a gaming website and spent fuck load of time making it scalable. i am only player now. My life is a meme
2 -
Strange things happening in my phone since a couple of weeks.
Google now automatically starts.
Music Player automatically starts.
All of sudden camera app opens.
Tried permission, removed all apps that were not installed from playstore..
What's next now?10 -
Spotify, where are my Subscribed Podcasts? Why do mobile App, Web Player, native MacOS App, and native Linux app so diffrent in the UI and even in the wording used? Leaves me, your paying user, upset and confused.rant podcasts ux userfriendly podcast spotify uxfail userexperience designforreallife crossplatform spotifydoesnotcare3
-
is it so hard to screen capture only the relevant details necessary to reproduce a bug? i just watched a video where for 2:30 min, literally nothing happened. and half of rest of the time, they randomly click stuff, as if they've forgotten what they want to show. nobody can give me this lost lifetime back. and the testuff video player is so crappy that i can't even reasonably jump forward / backward or increase playing speed. i even prefer crappy, wiggly upright phone videos if they are on point and don't steal my time. SHOW ME THE BUG ALREADY2
-
!rant
Hello, World! (Couldn't help myself)
What are some of y'all's favorite books? I am finishing Ready Player One right now, and I am looking for some new reading material. Suggestions?11 -
When you're the star player of your team in your final term, but then you graduate and enter the real world and find out how much more you have left to learn...
-
Sports jerseys that you can change the name and number on with an app.
That's fucking insane dude. Instead of buying a jersey tot every player you want, you buy one.
(Idk anything other than the demo looks pretty fucking cool.)
https://bit.ly/2EbUAgw7 -
Came across a player called Root in Overwatch today, would that be you, @Root, by any chance? It's not exactly a common name.5
-
trying to rotate the character in Unreal Engine based on player input. It rotates around some sort of super weird point, so it looks like it's driving "backwards" while rotating, instead of rotating around the center of the mesh... sigh..
...
...
Solution: pass down the rotation value to the animation blueprint, rotate rootbone.
SUCK IT <.< See? it's not that hard, nor awkward. ffs.2 -
Ik i probably should have went to stack overflow but you guys seem so much more immediate. I'm building a simple tic tac toe game however whenever i hit a tile the second time the counter disappears i refuse to go on to the winning logic before getting this resolved help!!!!
gameState[tappedCounter] = activePlayer;
if (gameState[tappedCounter] == 2) {
//if tapped counter is unplayed
if (activePlayer == 0) {
((ImageView) view).setImageResource(R.drawable.knight);
activePlayer = 1;
//displays knight
//sets active player to player 2
} else if (activePlayer == 1) {
((ImageView) view).setImageResource(R.drawable.sam);
activePlayer = 0;
//displays sam as player 2 character
//sets active player back to player 1
}4 -
What are the different ways by which an Android can play an audio?
I was recently doing a research on Android audio. And i wanted to know which libraries are responsible for audio/video play.
As far as i know media player and exo player are the two libraries which can be used to play user variety of audio/video files, application's raw/asset files and online stream files. Are there any other sounds beside system sounds which i forgot or other libraries which are also used for media playing?
And also what about these system files? Can we access system ringtones and notifications/ alarm tunes in a normal, non-rooted phone? I remember that my previous phone's music player (android kitkat maybe) was able to pick some system ringtones. Is it still possible now(android lollipop nd above) ?
Although i guess music in Android assets or raw files of some other app won't be accessable to my app, unless i am having screen record permissions? -
Note to self: online single player games are addictive but they either never end or the ending sucks. Either way, they waste a whole lot of time and eventually I will get bored of it and realize how much time I've wasted and that there is not actual reward for "finishing" it....1
-
Trying to get my head round LDAP for , what will eventually be, a government project.
Security up the wazoo is difficult1 -
I'm getting 1960s vibes. Reddit has been blacked out since a couple of days because some entity wants to charge third party somethings lots of money. So, the abbatoirs are punishing the sheeple.
Can somebody explain this to me? My browser got hijacked by the af.xdock.co virus and reddit is my go to for solutions. Now I'm at the mercy of whomever is stomping their foot. I'm a very minor player on the stage of devrant, and I find more sense spoken on this site than anywhere else. Thank you7 -
The leader in a dev team should be the BEST DEVELOPER
Not the one with "leadership" or "strong ownership" skills and "team player" or "go getter" attitudes. This is euphemism for promoting someone just because you like them, or because of their charisma.
There are many other industries where charisma can play a role in leadership but software is not one of them. To build good software we need to be objective thinkers, not influencers.15 -
(Spoilers about Ready Player one here)
FUCK YEAH!
I watched Ready Player One in 4DX AND IT COSTED AN UNHOLY FUCKING AMOUNT OF MONEY!
yet it was THE BEST MOVIE Ive ever watched, AND I MEAN IT! IT WAS SO FUCKING GREAT! THE CGI THE ACTORS!
STEVEN DID AN EXCELLENT JOB!
and as a Trekkie I LOVED the scene of Hallidays death I mean his coffin WAS A FUCKING PHOTON TORPEDO! and in the Last scene you could see a bat'leth HOW HOW COOL WAS THAT!
And dont get me started on all the other References like the Holy Handgranade, Rubiks Cube, FUCKING BATMAN HELPING SOMEONE CLIMBING, Minecraft OASIS edition, Halo... I CANT ITS TOO MUCH!1 -
What kind of Satan builds a music player app that only plays an album by alphabetical order or by time duration of the songs? Some of us like to hear music by the order the artist chose...1
-
!rant
I created a desktop player based on youtube, here we don't have available spotify yet so I decided to create my own thing made with electron-vue, what do you think?
https://github.com/AndreiKnight/...4 -
I'm sure you've heard of PUBG - Player Underground Battle Game. My flatmates are obsessed with it. Is there any way I can stop outbound connection to PUBG server or Asian Game Server? I tried to intercept the traffic couldn't find anything.9
-
Wanted to make a script for batch downloading lyrics for the mp3s on my phone
✔️Read ID3 tags to get title and artist
✔️Scrap a lyrics website
✔️Add a USLT frame to store lyrics within
✔️Lyrics show up on Clementine/Amarok/Whatever
❌Lyrics show up on my phone stock music player
Why the ffffffuuuuuuck!!! As if the ID3 lyrics tag were documented enough, now my phone gets picky and can't find them...1 -
Just updated my app and wanted to share it with my developer community.
Do you ever felt the need to play your favorite video on Youtube while using devRant, Whatsapp or any other app?
Now this is possible with the Youtube Assistant built in Floating Player.
You can now watch your favorite youtube videos while using any other app with Floating Player.
Just copy any YouTube video url or click Share->Copy to Clipboard in YouTube app to play the video in a floating window.
Download Floating Player and enjoy your favorite youtube videos.
Floating Player: https://play.google.com/store/apps/...6 -
It’s all a blur but in 5th grade I was using a TRS-80 with a cassette player for storage at the library where my mom worked. Also an Apple IIe at school in the computer lab. My first personal computer was an IBM XT clone with an 8086 processor and dot matrix printer. I bought it after having fun with my cousin’s Commodore 64 and wanting one, but his uncle sold me on the IBM platform as something that I could upgrade over time. I was 13 when I first learned Assembler and BASIC. Big Blue Disk was my favorite subscription software with all the games and other shareware stuff that came every month in the mail.1
-
Start standing up for my health and my expertise more, dive deep into animation, get a job on the product side, find time for my neglected side projects, go on more walks, get with a hot dev girl who can act as my lead and can spank and beat me when my code is shitty, network more with other devs to build collective safety nets for each other, buy a house with a record player room and hockey garage, practice more love3
-
Sports made me a team player and overall determined person. It thought me that progress requires time and that appetite comes with the eating.
-
It's just really unexpected for me, but I'm about to uninstall mx player. Font catch loading take toooo long and there is no way to solve it. Goodbye MX, you were a good player and you are not any more.7
-
My favorite tools:
IDEs : Jetbrain's IDEs intelliJ, pyCharm, ...etc.
The only exception is Visual Studio for C++ ( for no reason but I haven't tried Clion yet)
Text editor: atom
GIT GUI: Gitkraken, or just a terminal
Music player: Spotify -
I was watching a YouTube video about c++ and the guy used player{1...n} in a game as an example for objects of a class Player.
That was A-ha for me 😅.
I never got that in grade school when teachers used fruits and animals as examples 😂.2 -
Indefinite wait at the doctor's office, and the lightweight game that requires an internet connection for its single-player mode for no reason other than that it can decides that LTE isn't good enough, it only wants Wifi, but won't tell you...
-
No one's made a MIDI player that pages out the MIDI into individual data chunks (which are how the file format is set up) and the Black MIDI community will never be the same once I drop my WIP paging player3
-
JESUS CHRIST GOOGLE YOU ARE A MULTIBILLION DOLLAR COMPANY HOW THE FUCK IS YOUR WEBSITE DESIGN SO SHIT?
goddamit with the amount of fucking whitespace on YouTube I could fit an entire fucking copy of the website in.4 -
When you used a whole Day to make a Ball kill a player, and All you had to do, was to allow collision while simulating physics.. Damn i stared myself blind on that shit!3
-
Just spent an hour salvaging some code from an app project I abandoned so I can reuse it in the future and add what I salvaged to a portfolio of small things I've made.
It was a simple multiple player name menu that generated player objects once the user was done entering names.
Loads of potential future uses.
No point letting it sit inside an abandoned project even if it is somewhat trivial to reproduce. -
Currently studying for a cert. All the information is through videos, which I like. However it's through flash player, so no possibility of speeding up the videos....2
-
I will start pursuing music as a career(I play drums) or maybe become start taking dota seriously and become a professional player2
-
Have lots of interviews ined up for next week(college placements), the major player being Amazon. Any help for preparation and passing written exams?
Thanks.2 -
I was once trying to create a video player since the format was not supported by the browsers today, so i started to download the video files from the server. Only to discover a bug in my code was trying to download a video file from the server. This was way to much for the server to handle and caused it to crash. People where running in the building to get the stream back up, i sat there silently and killing my browsers process. Since then i always test my request from local if they are okay before downloading a file from a server
-
But why can't you be both an outstanding engineer and a friendly-and-approachable team player? BUT WHY?!?2
-
So I might play a game and get all the characters today so I can beat everyone that's comes against me. I'm the best player in the world watch your back.
2 -
TLDR; Send help, need VR video player that works on all the platforms (not IE, that can burn in hell)
Okay, don't get me wrong; I love iOS and most of it's features like being able to connect to the same WIFI-networks without having to fill a password twice.
But holy shit; Fuck Safari.
They made it so hard to access the stupid motion thing which you can use for VR.
Why do I know this? Well of course I have been building an app for a client which needs to display 360 degree video, which would be best viewed by turning your phone instead of swiping across your screen.3 -
My one skill in life is wondering why my widgets aren't displaying.
note to self: Use "Get Player Controller", or all your UI will fucking break. -
So I wrote a while ago .ndjson shapes dataset player.
https://quickdraw.withgoogle.com/ this site contain peoples shitdrawings of particular object.
Grab dataset from here in .ndjson format logging into google account
https://console.cloud.google.com/st...
go to here
https://jsfiddle.net/ywmp6bju/
browse the file and press play when it's enabled.
Attached picture is a frog.
2 -
What's everyone's preferred music player and/or playlist generator? I use Google Play Music now, and am fairly pleased. Any other recommendations?4
-
Workin on Group Projects (consists of 3-5 people) while studying in College :
- there's always that one guy / woman who fulfills as a "solo player"
- the others :
act as the entertainer of the group,
the accomodators of food and/or place,
the report printer,
the "tester",
the "boss",
etc. you name it 😂...
comments below for some additions -
Spent half my day dealing with integrating an adobe captivate project with javascript into my companies "web player" for e-learning content... the lack of smartness of that program frustrates me beyond all comprehension. And because of it i had to stay late to Try and finish up a portion of the course that i had forgotten about... needless to say that i might have to go in this weekend...
-
!dev
Hey guys, I'm looking for a good pc game to buy (fps, single player and online multiplayer) and I'm considering pre-ordering battlefield 5 since it seems very promising, but it won't be out until 20/11 so if you know any good games please let me know, thanks!10 -
http://www.gravityforce20.com
Remember Gravity Force on Amiga? They've released an anniversary version for almost all platforms! Global highscore list 'n all. One of the best multi-player games ever, but not yet that many players online. Download to your phone or comp and join me for a dogfight or two!
2 -
A music player/library with a postgresql database and an HTML interface (a bit like cherrymusic). Written in Python, it started to be big.
-
Hi everyone! I'm making a LAN game in unity, and all of it is working well, however deaths aren't syncing. I'm using the ServerChangeScene function, yet however when one player dies, the scene isn't reloaded for both clients. I'm using UNet2
-
hi all
my friends and I are creating a game! I've had prior experience making games before, and my friend who does all of the modelling has some experience with Unity Snaps which we can use to make some buildings, but we've never really tried to make a team project before, until now!
we're making a top down urban warfare game and we're making quite good progress so far! we are done with configuring a server to host, player movement, and almost player shooting
I would post a link to the discord server but I'm not sure if I'm allowed to advertise and could not find the TOS. anyway yeah please tell me if I can post it3 -
Hi fellas, I am having problems to play widevine content in electron. I am trying to convert ember-app to electron app. Except widevine content everything works great, Version info are:
Shaka 2.02
Electron 1.4.13(Chromium 53)
Electron Packager 8.4.0
Widevine v1.4.8.903
I used http://electron.atom.io/docs/... docs. In order to check my player i load shaka-demo app.
I included widevine like this
``` app.commandLine.appendSwitch('widevine-cdm-path', path.join(__dirname, ./widevine/1.4.8.903/_platform_specific/linux_x64/libwidevinecdmadapter.so)); app.commandLine.appendSwitch('widevine-cdm-version', '1.4.8.903');
```
Also added plugins: true. When i load mainWindow.loadURL('https://shaka-player-demo.appspot.com/...'); to play widevine content it's disabled. I have tried navigator.plugins still can not play widevine content2 -
I had implemented an interval that was added when the viewport was active, and removed when inactive. This was to lessen the amount of ajax requests being done.
Though the little radio player was embedded at places, and thus the pictures didn't change at times.
I had to remove the inactivation of that interval. -
I'm using a Ubuntu based distro called elementary OS, I needing to virtualize windows but I don't know what to chose VMware Player or VirtualBox, any suggestions?🤷3
-
why do the sweet sounds of the Monotone Player (DOS 3ch playback over PC beeper, seen in the demoprod "8088MPH": https://youtu.be/yHXx3orN35Y) put me to sleep
i don't understand -
I was given a project to fix and improve a legacy unity VR project I was told was for the oculus rift Now the problems started almost immediately partly stemming from the fact I’ve never used unity before this project was handed to me as my long term TA assignment
And partly from the fact there was no oculus integration in the game at all. it was built for GoogleVr and most of the code the last person wrote consisted of massive sections (25-50 lines) of commented out code and no explanation of what the hell the non-commented parts are supposed to be doing
So long story short. I’m now in a basic unity course, six feet deep in documentation trying to read resources that go way over my head in understanding, and am rebuilding the project from basically scratch (took the assets and saved the c# scripts for reference) and have finally figured out how to at least get the player character constantly moving forward and stream in the WRLD3D environment like the last guy did. Now to get the player character to turn and change direction when the player turns their head with the oculus headset
By the way. WRLD3D is a really cool api thing in my opinion -
Flipping SMPlayer - I opened a video on other monitor (TV) and was trying to lower default volume (by keys) to not wake up family. But the SMPlayer decided to show some window about donations which blocked all hotkeys for a player. Good job, now that I probably woke my family I am sure I won't donate you.
-
as my first rant here I thought i'd start with one of my favorite relevant quotes:
"If only it weren't for the people, the goddamned people, always getting tangled up in the machinery. If it weren't for them, earth would be an engineer's paradise."
-Kurt Vonnegut, "Player Piano"1 -
// !rant
Anybody here knows Backblaze's B2 Cloud Storage?
I am thinking of using it to storage video from a web app that I am developing. The process is:
1 - Send video files (both) to storage w/ cli (Done ✔)
2 - Authorize the asynchronous download and shows it on the HTML5's player (reading the doc ✖).
Question:
Anybody experienced some workflow likes this before? I am trying save some time before break my head after read all CLI doc (only cli, I can't find any workflow of it)1 -
Feature Request:
We can now categorise rants we post, please let us filter rants in the feed by category.5 -
Anyone here remembers DemonStar, the space shooter? Back when my aunt lived in our home (i was around three or four years old then, i think), we used to play single player together. She would press arrow button and i would press Ctrl button.
-
Started playing Futsal 2 months ago. Had another game today. Realized that I suck at this and felt more of a better team player as a coder/project coordinator than a goalie/defender. Now I'm wondering if I should switch to a different sport or quit altogether.
-
Is there a web browser for Linux that supports hw accelerated video decode?
(Intel graphics)
There are so many bug reports for this, but all seem to be "won't fix"/ api is unstable or some other problem
I want to watch youtube without it destroying my battery.
(I know I can load the stream into a video player like VLC and watch it there, but that is not very practical...)1 -
Something interesting i learned today about the html5 video tag is that even if preload is set it's up to the player the render engine is using to fetch the index of the file first as with mp4 this is usually at the end of the file.
This means that for Blink and Gecko most likely fetch this first themselves. But for webkit it opens in quicktime on mobile devices which you cannot pass parameters to and flat out waits for the entire stream to start playing.1 -
making a self driving go kart controlled with a rpi, should i use python, java, dart, or something else? python seems like the obvious choice.
i plan on making it have google maps integrated, with netflix and music player, with a touchscreen.
i was thinking c++, but a gui with c++ didn't seem ideal.
what would you use?
also is an rpi too slow to make the go kart be *relatively* safe?question dart golang python testing fuck fuck fuck fuck fuck fuck fuck fuck fuck rpi java opencl raspberry pi self driving3 -
Luxary dilemma. I'm just finishing up my studies and got 2 job openings going on. They are about the same salary but very different companies. What should i think about for my future like CV and other stuff? What would benefit me the most knowledge wise. Or any other recomendations starting as a developer?
Opening 1:
Smaller company "10-15 people" that develops apps and plugins for CRM systems. C# fullstack.
Opening 2:
Big player in the car industry with 1000+ employees. Java backend. -
Playing NFS (it was the version which had the McClaren car), few other games and watching some movies (CD player) It wasn't my computer though. It was my cousin's and I used it while he was working. I think I broke it couple of times (windows 95) to get the BSOD.
I bought my own computer only when I started working. My family couldn't afford one before that. Luckily I had good friends in college who let me use theirs for course work. -
"For cricket fans in Bangladesh, staying informed about ongoing matches, scores, and team updates is essential. With the growing popularity of domestic leagues and international tournaments, having one reliable source of live information makes all the difference. That’s exactly what https://livecricket-bd.com/ provides — a complete hub for real-time cricket coverage in Bangladesh.
From the Bangladesh Premier League (BPL) to Test matches and international T20 showdowns, the site delivers detailed match previews, live scoreboards, player stats, and expert commentary. What makes it particularly useful is how it blends fast live updates with deep insights into team strategies and game predictions. Whether you’re tracking your favorite player or analyzing matchups for fantasy leagues or sports betting, this platform is designed to meet every cricket lover’s needs.
Cricket is more than a sport in Bangladesh — it’s a national passion. And with fans don’t just follow the game, they live it. The site ensures you never miss a moment, even when you're on the go."3 -
Hell, I always thought I was a team player, but is it a great week being the sole developer (all the other on vacation). So I didn't get interrupted all the time, read overblown PR. Still, even in their absence I spent about three days fixing their build issues and PR's, but I could sit down and read the code, some documentation to get a better understanding why it all sucks and what we should do with our pain in the ass build system.
It's really a blast, deleting some stupid code, removing superfluous dependencies and above all leaving snarky remarks in the commit messages and code comments. Just letting some steam off. Code is where my devrant is. -
Wanted to discuss about this AMP framework by Google. I have developed with it for my company and have been having mixed feelings about it.
On one end, it gives you the power of Google cache, declarative layout and all.
But still, it seems to be too restrictive and filled with bizarre rules that often could have been avoided if they just made guidelines for normal "web pages" to be better and not yet another framework to build "AMP pages".
One more (and probably the biggest) thing. AMP is Open Source... But can it be really considered Open if the biggest player in its development is a single corporation?4 -
!IthinkNotRent
Trying to write two player checkers/chess game with PHP
Any ideas about frameworks (maybe js frameworks) that will make my life easier
(No Nodejs plzzz)
Thanks!9 -
Why is there no music player for Linux with a clean, organized UI and only the basic features? (showing album covers, search, sorting by genre, artist etc)? All players so far are either buggy, look like shit, or have some cloud sync stuff .. I just want a simple mp3 player man D:12
-
i just bought a mac and i realized that itunes cost a lot of money.
so i made a music player and youtube downloader in it with php and node so i dont have to worry about music anymore.
thanks to dev rant user who post a youtube downloader with google play i forget who is it you gave me an inspiration to this XD1
















