Management : "How long you think it would take?"

Me : "now this is a rough estimate, but I think building the back-end and database alone could take 6-months minimum"

Management : "WHAT ARE YOU TALKING ABOUT? YOU ARE NOT SERIOUS"

me : "its a big proj..."

Management : "I thought it will be something like 10 days, already told the client it can be done"

me : "but we are not ready"

Management : "how are we not ready? we already have the virtual 3D shop, and we can use this ready-to-deploy eCommerce service as our data base "
... "you need to figure this out, this is not acceptable" he continued

* 2 Days Later -talking to my direct boss *
Boss : "since you don't know how to do it..."

me : "what ? I didn't say I can't do it, all I said it will take six months"

Boss : "yeah yeah, anyway there is this studio, a professional polish studio, we called them and they can do it, we will sign a contract with them, this will let you focus on the front-end. good?"

me : "well alright then"

Boss : "please write a doc, explaining everything needed from the backend"
-to me that was the end of it, took a long time to tell me they made the deal-

* 5 Months later *
- "Abdu, can you come here for a minute..."
- "yes boss?"
- "the document we asked you to do for the Polish studio, did you specify that we needed an integration with the API we are using for eCommerce?"

scared to death I answered : "why of course I did!"
I ran to my PC to check it out because I didn't know, I forgot because no one even comment on my doc. I check it out, and it was clearly explained... I got relaxed...

turns out they didn't even do what we asked them for. took them 5 months, and with no communication whatsoever. all their work was useless to us. complete dump waste.

----------------
never mentioned this until a year later... in a heat of moment when they were asking me to make an impossible task with no men and no time... I reminded them of this story... management didn't like it. but it was the truth. they didnt push this crazily this time

Long rant ahead, but it's worth it.

I used to work with a professor (let's call him Dr. X) and developed a backend + acted as sysadmin for our team's research project. Two semesters ago, they wanted to revamp the front end + do some data visualization, so a girl (let's call her W) joined the team and did all that. We wanted to merge the two sites and host on azure, but due to issues and impeding conferences that require our data to be online, we kept postponing. I graduate this semester and haven't worked with the team for a while, so they have a new guy in charge of the azure server (let's call him H), and yesterday my professor sends me (let's call me M), H and W an email telling us to coordinate to have the merge up on azure in 2-3 days, max. The following convo was what I had with H:

M: Hi, if you just give me access to azure I'll be able to set everything up myself, also I'll need a db set up, and just send me the connection string.
H: Hi, we won't have dbs because that is extra costs involved since we don't have dynamic content. Also I can't give you access, instead push everything on git and set up the site on a test azure server and I will take it from there.
M: There is proprietary data on the site...
H: Oh really? I don't know what's on it.
<and yet he knows we have no dynamic data>
M: Fine, I'll load the data some other way, but I have access to all the data anyway, just talk to Dr. X and you'll see you can give me access. Delete my access after if you want.
H: No, just do what I said: git then upload to test azure account.

Fine, he's a complete tool, but I like Dr. X, so I message W and tell her we have to merge, she tells me that it's not that easy to set it up on github as she's using wordpress. She sends me instructions on what to do, and, lo and behold, there's a db in her solution. Ok, I go back to talking to H:

M: W is using a db. Talk to her so we can figure out whether we need a database or not.
H: We can't use a database because we want to decrease costs.
M: Yes I know that, so talk to her because that probably means she has to re-do some stuff, which might take some time. Also there might be dynamic content in what she's doing.
H: This is your project, you talk to her.
<I'm starting to get mad right now>
M: I don't know what they had her do apart from how it interfaces with what I've done.
H: We still can't have databases.
M: Listen, I don't do wordpress, and I'm not gonna mess with it, you talk to her
H: I won't do any development
<So you won't do any dev, but you won't give me access to do it either?>
M: Man, the bottleneck isn't the merging right now, it's the fact that W needs a db
H: I know, so talk to her
M: THE RESTRICTION TO NOT HAVE DATABASES IS NOT MINE, IT'S YOURS, YOU TALK TO HER. I can't evaluate whether it's a reasonable enough reason or not since I don't know the requirements or what they're willing to spend.
H: It's your project.
M: Then give me fucking access to azure and I'll handle it, you know you'll have to set up wordpress again regardless whether we set it up the first time.
H: Man just do your job.

At this point I lost it. WHAT A FUCKING TOOL. He doesn't wanna do dev work, wants me to go through the trouble of setting up on a test subscription first, and doesn't want to give me access to azure. What's more, he did shit all and doesn't want to anything else. Well fuck you. I googled him, to see if he's anyone important, if he's done anything notable which is why he's being so God damn condescending. MY INTERNSHIP ALONE ECLIPSES HIS ENTIRE CV. Then what the fuck?

There's also this that happened sometime during our talk:

M: You'll have to take to Dr. Y so he'll change the DNS to point to the azure subscription instead of my server.
H: Yea don't worry, too early for that.
M: DNS propagation takes 24 hours...
H: Yea don't worry.

DNS propagation allows the entire web to know that your website is hosted on a different server so it can change where it's pointing to. We have to do this in 2-3 days. Why do work in parallel? Nah let's wait.

I went over his head and talked to the professor directly, and despite wanting to tell him that he was both drunk and high the day he hired that guy, I kept it professional. He hasn't replied yet, but this fucker's pompous attitude is just too much for me alone, so I had to share.

PS: I named his contact as Annoying Prick 4 minutes into our chat. Gonna rename him cz that seems tooooooo soft a name right now.

When you stare into git, git stares back.

It's fucking infinite.

Me 2 years ago:
"uh was it git fetch or git pull?"

Me 1 year ago:
"Look, I printed these 5 git commands on a laptop sticker, this is all I need for my workflow! branch, pull, commit, merge, push! Git is easy!"

Me now:
"Hold my beer, I'll just do git format-patch -k --stdout HEAD..feature -- script.js | git am -3 -k to steal that file from your branch, then git rebase master && git rebase -i HEAD~$(git rev-list --count master..HEAD) to clean up the commit messages, and a git branch --merged | grep -v "\*" | xargs -n 1 git branch -d to clean up the branches, oh lets see how many words you've added with git diff --word-diff=porcelain | grep -e '^+[^+]' | wc -w, hmm maybe I should alias some of this stuff..."

Do you have any git tricks/favorites which you use so often that you've aliased them?

Roughly 180 days, 5 months and 29 days, 4,320 hours, 259,200 minutes, I devoted myself to a client project. I missed family outings with my daughter and my wife. People started asking my wife if we had broken up. My daughter became accustomed to daddy not being around and playing with her. Sometimes only sleeping 4 hours, I would figure out solutions to problems in my sleep and force myself to wake and put them into action. My relationship with my wife became very fragile and unstable. I knew I had to change but I just needed a little bit more time to complete this client project.

Finally, the project was ending there was light at the end of the tunnel. I “git add –-all && git status” everything looked good. I then “git commit -m “v1.0 release candidate && git push beanstalk master”

I deployed the app to the staging server where I performed my deployment steps. Everything was good. I signed-up as a new user, I upload a bunch different files types with different sizes, completed my profile and logged out. I emailed the client to arrange a time to speak remotely.

“Hello” says the client “How are you” I replied. “Great, lets begin” urged the client. I recited the apps url out to the client. The client creates a new account and tries to upload a file. The app spews a bunch of error messages on the screen.

The client says

“Merlin – I do not think you really applied yourself to this project. The first test we do and it fails. If you do not have the time to do my project properly please just say so now, so I can find somebody else who can”

I FREAKED THE FUCKOUT on the client!!!!!!! and nearly hung up. My wife was right next to and she was absolutely gobsmacked. I sat back and thought to myself “These fuckers don’t get it”. All that suffering for nothing!

Thanks for reading my rant….

BTW: I did finish the project, the client was amazed on how the app worked and it is has become an indispensable tool for their employees.

Fucking intern.

While I was working next to her a couple weeks back, she spent half her time on social media, playing Candy Crush, or talking with her friend. She also left early almost every day.

I had given her a project to do (object crud + ui), and helped her through it. She made pretty abysmal progress in a week. I ended up finishing it for her by rewriting basically all of her code (every single line except some function names, lone `end` or `}` statements, a few var declarations, blank lines, plus a couple of comments she copied over from my code).

This week I gave her a super easy project to do. It amounts to copying four files (which I listed), rename a few things to be Y instead of X, and insert two lines of code (which I provided) to hook it up. Everything after that just works. It should have taken her ... okay, maybe a few hours because she's slow and new to the language. but it would have taken me five to ten minutes, plus five minutes of testing.

She has spent THREE FUCKING DAYS ON THIS AND SHE'S STILL NOT DONE. SHE'S BLOODY USELESS!

She has kept not pulling changes and complaining that things are broken. Despite me telling her every time I push changes that affect her work (on. my. branch. ergh!)

She keeps not reading or not understanding even the simplest of things. I feel like MojoJojo every time I talk to her because of how often I repeat myself and say the same things again and again.

Now she's extremely confused about migrations. She keeps trying to revert a drop_table migration that she just wrote so she can re-create the table differently. Instead of, you know, just reverting back to her migration that creates the table. it's one migration further.

Migrations are bloody simple. they're one-step changes to the database, run in order. if you want to make a change to something you did a few steps back, you roll back those migrations, edit your shit, and run them again. so bloody difficult!

`rails db:rollback && rails db:rollback`
Edit file
`rails db:migrate`
So. hard.

I explained this to her very simply, gave her the commands to copy/paste, ... and she still can't figure it out. She's fucking useless.

It took me ten minutes to walk her though it on a screen share. TEN FREAKING MINUTES.

She hasn't finished a damned fucking thing in three weeks. She's also taking interview calls while working on this, so I know she totally doesn't care.

... Just.
Fucking hell.

USELESS FUCKING PEOPLE!

[Thursday afternoon on a call...]

Client: Before we get started, can you create a sitescape outlining all of the pages and sections of the new website?

Me: Sure! I'll go through the website and shoot you a full layout in xls format as soon as possible, that way you can easily make notes on what you want added, modified or removed.

[Two hours later...]

Client: Hey, did you build that sitescape yet?

Me: Actually, I've been on back-to-back calls with other clients.

Client: So when are you going to get it done?

Me: Well, I have to go through the current website in it's entirety, which I'm guessing is about 1,000 pages. I have to determine which pages work fine on their own, which need to be combined for better presentation and which should be removed due to redundancy. That's something that is tedious and takes some time to complete. That, in combination with having an existing work queue that I need to fit you within and being at the end of the work week, we're looking at Tuesday morning to have it ready.

Client: "Existing work queue"? This is ridiculous. We're paying you good money to make our project your only priority. If we wanted to wait days for work, we would have saved money and paid for a cheaper service. You're already gouging us as it is! If we don't get the sitescape by end of day Friday, we're going with another company.

Me: I would tell you that I'm sorry for the inconvenience, but I'm not. I'm not going to feed you a line to make you happy. I'm also not going to work on my days off just to rush something out to you. You hired us because you wanted things done right, not quickly. Your current website is the result of not focusing on quality, but by how fast you can deliver it. We don't work that way. We only build quality products.

By rushing your project, not only do we alienate our current clients, affecting our reputation, but we build product of less than the highest quality. That will upset you because it isn't perfect, and it reflects poorly on us to use it in our portfolio.

If you want to hire someone to pump out this project to your unrealistic deadlines, be our guest. But you paid a 50% non-refundable deposit, so not only will you lose money, but your end product will suffer.

I'm going to let you sleep on this. If you decide tomorrow that another direction is the way to go, we wish you luck. But please understand that if we conclude our business, we will no longer make ourselves available for your needs.

Please find the attached contracts you have signed, acknowledging the non-refundable deposit, as well as the project timeline and scope, of which a "sitescape" was never originally mentioned or blocked out for time.

I hope that tomorrow we can move forward in a more professional manner.

[Next morning...]

Client: My apologies for yesterday. We're just very anxious to get this started.

-----

Don't let clients push you around. Make them sign a contract and enforce it whenever necessary.

toxic workplace; leaving

I haven't wanted to write this rant. I haven't even wanted to talk to anyone (save my gf, ofc). I've just been silently fuming.

I wrote a much longer rant going into far too much detail, but none of that is relevant, so I deleted it and wrote this shorter (believe it or not) version instead. And then added in more details because details.

------

On Tuesday, as every Tuesday, I had a conference call with the rest of the company. For various, mostly stupid reasons, the boss yelled at and insulted me for twenty minutes straight in front of everyone, telling me how i'm disorganized, forgetful, how can't manage my time, can't manage myself let alone others, how I don't have my priorities straight, etc. He told the sales team to get off the call, and then proceeded to yell and chew at me for another twenty minutes in front of the frontend contractor about basically the same things. The call was 53 minutes, and he spent 40 minutes of it telling me how terrible I've been. No exaggeration, no spin. The issues? I didn't respond to an email (it got lost in my ever-filling inbox), and I didn't push a very minor update last week (untested and straight to prod, ofc). (Side note: he's yelled at me for ~15 minutes before for being horribly disorganized and unable to keep up on Trello -- because I had a single card in the wrong column. One card, out of 60+ over two boards. Never mind that most have time estimates, project tags, details, linked to cards on his boards, columns for project/qa/released, labels for deferred, released to / rejected from qa, finished, in production, are ordered by priority, .... Yep. I'm totes disorganized.)

Anyway, I spent most of conference call writing "Go fuck yourself," "Choke on a cat and die asshole," "Shit code, low pay, and broken promises. what a prize position," etc. or flipping him off under the camera on our conference-turn-video-call (switched due to connection issues, because ofc video is more stable than audio-only in his mind).

I'm just.
so, so done.

I did nothing the rest of the day on Tuesday, and basically just played games on Wednesday. I did one small ticket -- a cert replacement since that was to expire the next day -- but the rest was just playing CrossCode. (fun game, fyi; totally recommend.)

Today? It's 3:30pm and I can't be bothered to do anything. I have an "urgent" project to finish by Monday, literally "to give [random third party sales guy] a small win". Total actual wording. I was to drop all other tasks (even the expiring cert lol) and give this guy his small win. fucking whatever. But the project deals with decent code -- it's a minor extension to the first project I did for the company (see my much earlier rants), back when I was actually applying myself and learning something (everything) new, enjoying myself, and architecting+writing my own code. So I might actually do the project, but It's been two days and I haven't even opened single file yet.

But yeah. This place is total and complete shit. Dealing with the asshole reminds me of dealing with my parents while growing up, and that's a subject I don't want to broach -- far too many toxic memories.

So, I'm quitting as soon as I find something new.
and with luck, this will be before assface hires my replacement-to-be, and who will hopefully quit as soon as s/he sees the abysmal codebase. With even more luck, the asshole king himself will get to watch his company die due to horrible mismanagement. (though ofc he'll never attribute it to himself. whatever.)

I just never want to see or think about him again.
(nor this fetid landfill of a codebase. bleh.)

With luck, this will be one of my last rants about this toxic waste dump and its king of the pile.
Fourty fucking minutes, what the fuck.

After months and months of unrealistic deadlines, pulling late night shifts coupled with an insane commute and two very small children at home I had a total burnout. Turned up to work one morning, and stared at the Java code I had been writing for the past couple of days and it might as well have been written in Martian. The more I stared, and the more I tried to keep things together internally the less I was able to make sense of anything - just a random jumble of characters on screen that were as intelligible as the green scrolling lines from The Matrix.

My office manager saw that I was obviously in some distress and took me into a meeting room to have a quick chat - and there I was, a grown man of 35 bawling my eyes out like a two year old. Not the most edifying moment of my life.

However, the company couldn't have been more supportive afterwards; one of my colleagues drove the 100 miles to get me home in my car and took a train back up to the office; my GP signed me off work for six months and treated me for severe depression; the office instituted stricter working policies - not on the developers, but the sales/PM teams that were handing down ridiculous timescales simply so they could get a sale.

For my part, I've learnt to push back and say "NO!" - work is not your life, it's an important part of your life, but my no means everything. Don't feel beholden to a company to meet unrealistic targets that you haven't agreed to. Talk.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

You know side projects? Well I took on one. An old customer asked to come and take over his latest startups companys tech. Why not, I tought. Idea is sound. Customer base is ripe and ready to pay.

I start digging and the Hardware part is awesome. The guys doing the soldering and imbedded are geniuses. I was impressed AF.

I commit and meet up with CEO. A guy with a vision and sales orientation/contacts. Nice! This shit is gonna sell. Production lines are also set.

Website? WTF is this shit. Owner made it. Gotta give him the credit. Dude doesn't do computers and still managed to online something. He is still better at sales so we agree that he's gonna stick with those and I'll handle the tech.

I bootstrap a new one in my own simplistic style and online it. I like it. The owner likes it. He made me to stick to a tacky logo. I love CSS and bootstrap. You can make shit look good quick.

But I still don't have access to the soul of the product. DBs millions rows of data and source for the app I still behind the guy that has been doing this for over a year.

He has been working on a new version for quite some time. He granted access to the new versions source, but back end and DB is still out of reach. Now for over month has passed and it's still no new version or access to data.

Source has no documentation and made in a flavor of JS frame I'm not familiar with. Weekend later of crazy cramming I get up to speed and it's clear I can't get further without the friggin data.

The V2 is a scramble of bleeding edge of Alpha tech that isn't ready for production and is clearly just a paid training period for the dev. And clearly it isn't going so well because release is a month late. I try to contact, but no reaction. The owner is clueless.

Disheartening. A good idea is going to waste because of some "dev" dropping a ball and stonewalling the backup.

I fucking give him till the end of the next week until I make the hardware team a new api to push the data and refactor the whole thing in proper technologies and cut him off.

Please. If you are a dev and don't have the time to concentrate on the solution don't take it on and kill off the idea. You guys are the key to making things happening and working. Demand your cut but also deserve it by delivering or at least have the balls to tell you are not up for it.

I was at Leeds Central train station the other day, waiting for the platform to be announced on the screen in the main bit. I noticed a commotion to my right. There was a teenage girl screaming and writhing around on the floor, her mother was knelt on one knee trying to calm her. I walked over without thinking, I know nothing about Epilepsy or first aid, at a push I could probably figure out the recovery position from a faint diagram i have stored in the unused part if my brain...

(it’s where I keep the washing machine instructions, which incidentally were designed for maximum confusion, if Id designed a washing machine it would have 1 button labelled ‘wash’)...

Sorry, back to the story. So i walked over and just before I got there, with the mother looking directly at me, I realised, what the fuck am I doing, meanwhile the daughter was screaming still and writhing, a bit like a rapid angel print you would make in the snow as a kid (until your hand touched the dog shit).

I couldn’t help it, the words just came out, like a dumb fucker, i said ‘Has she got epilepsy?’ , i stood there waiting for the sarcastic comment or the murderous stare, even a fuck off would suffice, so that I could remove myself from the situation.

To my surprise, and shock, she looked at me, calmly and said “oh no, it’s not epilepsy or anything like that.... she’s lost her iPhone”.

I have a client (a friend of a friend of a friend) who came to me to build them a "simple" booking solution for their home cleaning business. Easy enough, I first thought.

Having taken a deposit based on my initial quote and contracts all signed, roll on exactly 8 months to where I find myself today.

It turns out, there is no cleaning business as the business will be totally reliant on the website. The original goalposts have now been moved to a completely different fucking country. The (now) required functionality has STILL yet to be finalised (I told client I'm not writing another line of code until EVERYTHING has been mapped out and made crystal clear), as every single face-to-face meeting / back and forth email turns into the client requesting hundreds more brilliant, essential features that make absolutely ZERO fucking sense. And now, to top it all off and push me into writing my first ever rant on here, I've just received an email from the client this morning saying "what I would like to have is like an online restaurant live booking system". WTF?!?!?

I work from home and have only my dog for company today, so please don't judge me. Just needed to let it all out.

The man who runs my IT department. The man who is in charge of all things and people that are technical: IT management software development, infrastructure, training, help desk, system administration​, etc. A man with a staff of fifty plus. If you were to peel back the flesh on this man's head and crack open his skull you would find dung beetles feasting on the feces that power his thoughts and motor functions. Underneath this foul membrane, if you could push past the maggots; the meal worms; his undying love for hourly binges of Johnny Walker Black on any day of the week with a name that contains a vowel; his fascination with shiny objects and his endless internal monologue wondering when they would hatch rainbow ponies that fly; his desire whenever he enters a paint store to open all the cans of paint and taste the different colors; if you could push past all of the vile crap that exists where Thomas Aquinas once theorized there was a soul, you would find a colony of paramecia at the end of their short lives laughing hysterically at how much smarter they were than the host they lived in.

This man was in charge of hiring the Manager of Software Development. The manager I report to. After seven months of ignoring this chore; after interviewing the sum total of four candidates; after making a point to tell myself and a colleague that there was no one qualified to fill this position within our company (an opinion that is both untrue and, when spoken, runs afoul of internal hiring policies) this man hired a soulless cretin with no experience in software development or with running a software development group. A man who regularly confuses web servers and SQL servers. A man who asked me how my previous manager reviewed my work, was told by me that said previous manager read my code, and then replied in his capacity as the manager of software development that "looking at code is a compete waste of time for a manager." A man so without any humanity or reason for being that he will sit silently, creepily, in conference rooms with the lights off waiting for meetings to begin. Meetings he has scheduled. That have no reason for being in the first place. Just like himself.

Shortly before the man in charge offered the Dev Manager job to the simulacrum of human flesh that is my manager, he met with me and others who had been involved in the interview process. When I informed him that hiring someone with no technical knowledge for a very technical position would be a mistake that he would suffer through for years, he replied in reference to his future hire that "his managerial experience makes up for his lack of technical knowledge."

Best. Prank. Ever. Worst prank ever too. Fuck.

So this chick has been super nice to me for the past few months, and has been trying to push me towards a role in security. She said nothing but wonderful things about it. It’s easy, it’s not much work, it’s relaxing, etc.

I eventually decided I’m burned out enough that something, anything different would be good, and went for it. I’m now officially doing both dev and security. The day I started, she announced that she was leaving the security team and wouldn’t join any other calls. Just flat-out left.

She trained me on doing a security review of this release, which basically amounted to a zoom call where I did all of the work and she directed me on what to do next, ignored everything I said, and treated me like an idiot. It’s apparently an easy release. The work itself? Not difficult, but it’s very involved, very time consuming, and requires a lot of paper trail — copying the same crap to three different places, tagging lots of people, copying their responses and pasting them elsewhere, filing tickets, linking tickets, copying info back and forth to slack, signing off on things, tagging tickets in a specific way, writing up security notes in a very specific format etc. etc. etc. It’s apparently usually very hectic with lots of last-minute changes, devs who simply ignore security requests, etc.

I asked her at the end for a quick writeup because I’m not going to remember everything and we didn’t cover everything that might happen.

Her response: Just remember what you did here, and do it again!

I asked again for her to write up some notes. She said “I would recommend.. you watch the new release’s channel starting Thursday, and then review what we did here, and just do all that again. Oh, and if you have any questions, talk to <security boss> so you get in the habit of asking him instead of me. Okay, bye!”

Fucking what.
No handoff doc?
Not willing to answer questions after a day and a half of training?

A recap
• She was friendly.
• She pushed me towards security.
• She said the security role was easy and laid-back.
• I eventually accepted.
• She quit the same day.
• The “easy release” took a day and a half of work with her watching, and it has a two-day deadline.
• She treated (and still treats) me like a burden and ignores everything I said or asked.
• The work is anything but laid-back.
• She refuses to spend any extra time on this or write up any notes.
• She refuses to answer any further questions because (quote) “I should get in the habit of asking <security boss> instead of her”

So she smiled, lied, and stabbed me in the back. Now she’s treating me like an annoyance she just wants to go away.

I get that she’s burned out from this, but still, what a fucking bitch. I almost can’t believe she’s acting this way, but I’ve grown to expect it from everyone.

But hey, at least I’m doing something different now, which is what I wanted. The speed at which she showed her true colors, though, holy shit.

“I’m more of a personal motivator than anything,” she says, “and I’m first and foremost a supporter of women developers!” Exactly wrong, every single word of it.

God I hate people like this.

Story time. My first story ever on devRant.

To my ex-company that I bear for a long time... I joined my ex-company 3 years ago. My ex-company assigned me and one girl teammate to start working on a brand new big web project (big one - two members - really?)

My teammate quitted later, I have to work alone after then. I asked if someone can join this project, but manager said other people are busy. Yea, they are fucking busy reading MANGA shit everyday... Oops, I saw it because whenever I about to leave my damn chair, they begin chanting some hotkey magic and begin doing "poker face" like "I'm doing some serious shit right here".. FUCK MY CO-WORKERS!

My manager didn't know shit about software development, and keep barking about Agile, Waterfall and AI shit... He didn't even fucking know what this project should look like, he keep searching the internet for similar functions and gave me screenshots, or sometimes they even hold a meeting of a bunch of random non-related guys who even not working on the project, to discuss about requirements, which last for endless hours... FUCK MY MANAGER!

I was the one in charge for everything. I design the architecture, database, then I fucking implement my own designed architect myself, and I fucking test functions that I fucking implemented myself based on my fucking design. I was so tried, I don't know what the fuck I am working on. Requirement changes everyday. My beautiful architecture began to falling off. I was so tired and began use hack fixes here and there many places in the project. I knew it's bad, but I just don't have time to carefully reconsider it. My test case began becoming useless as requirements changed. My manager's boss push him to finish this project. He began to test, he start complaining about bug here and there, blaming me about why functions are broken, and why it not work as he expected (which he didn't even tell my how he expected). ... I'm not junior developer, but this one-man project is so overwhelmed for me... FUCK MY JOB!

At this time, I have already work this project for almost 2.5 years. I felt very upset. I also feel disappointed about myself, although I know that is not all my entire faults. The feeling that you was given a job, but you can not get it done, I feel like a fucking LOSER. I really wanted to quit and run away from this shithole. But on the other hand I also want to finish this project before I quit. My mind mixed. I'm a hard-worker. I keep pushing myself, but the workplace is so toxic, I can feel it eating up my motivation everyday. I start questioning myself: "Is the job I am doing important?", "If this is really important project, didn't they should assign more members?", I feel so lonely at work... MY MIND IS FUCKED UP!

Finally, after a couple months of stress. I made up my mind that no way this project is gonna end within my lifespan. I decide to quit. Although my contract pointed that I only need to tell one month in advance. I gave my manager 3 months to find new members for project. I did handle over what I know, documents, and my fucked up ultra complexity source code with many small sub-systems which I did all by myself.

Well, I am with a new employer right now. They are good company. At least, my new manager do know how to manage things. My co-workers are energy and hard-working. I am put to fight on the frontline as usual (because of my "Senior position"). But I can feel my team, they got my back. My loneliness is now gone. Job is still hard, but I know for sure that I'm doing things on purpose, I am doing something useful. And to me that is the greatest rewards and keep me motivative! From now, will be the beginning for first page of my new story...

Thanks for reading ...

Boss comes to me with an idea, we use a spreadsheet to store certain sets of links for clients, sometimes with dozens of links, he wants us to be able to push a button and open all the links in the sheet. I'll admit I'm not exactly proficient in excel but said I'd look into it.

I came up with a macro which seemed to work for a while but there were a few links now and then that didn't want to open due to the way excel apparently checks the links prior to actually opening them. I told my boss that I'd look into a better solution but was slammed in office with scheduled projects.

I ended up taking time at home over the next week learning how to make this happen in Python. After a week I've got a CLI Python app which takes in an excel workbook and asks the user to select a sheet. Well employees don't like CLI so they asked for a GUI. I had never made anything with a GUI before since I'm not a software developer, anything I had previously written was written for me so it didn't need a GUI to be useful.

Spent another two weeks at home developing this thing and finally got a working solution. Now several employees are using my app as part of their daily job, saving them well over an hour of just clicking links in a spreadsheet.

Boss goes on a long rant about how he appreciates me and is thankful I was able to figure this out in my own time and save him money. So I say "If you really wanna show you appreciate me, you could approve that raise I've been asking for."

He replies, "Haha, yeah, but that's not gonna happen."

(I and THE back end developer, and I make less than the copywriting interns, time to start looking)

I THOUGHT I JUST DAMAGED MY PHONE SCREEN LIKE AN IDIOT.

I haven't slept for 3 days, so I'm kind of out of it.

I was using my phone for a few hours non-stop, because if my mom sees me on my laptop she might take it away lol.

I had to edit my manuscript, so I didn't put my phome down, and it's really hot in my house for some reason even though it's cold outside (63°f).

So my phone overheated, and being the sleep deprived idiot I was, I realized how squishy it felt when I kept pressing my screen down. For some reason it felt good to push on it.

I know, I'm stupid. I kept pressing down until I snapped out of the trance, and realized what I was doing, so I stopped. Then I saw these distinct patches on my screen. Like when there's water in your phone, and you see these roundish splotches. Also, I couldn't move the screen.

I panicked because I thought I ruined the screen, so I turned it off. I kept it face down on my table, and read a book for an hour.

When I turned it back on, the patches were gone. I guess they were present because my phone overheated or something.

Still, that was kind of scary. I thought I ruined it.

Always the same story:

Marketing: hey I'm gonna do a demo to a customer. They were asking for feature XYZ. That's ready on thr staging server right? Do you think I could use the staging server for the demo?

Devs: well feature XYZ is not 100% done. Basically just feature X is done, and it still has a few bugs. The deadline ain't for another month, since we gotta finish ABC first. I guess you could use the staging, but it has a lot of bugs.

Marketing: perfect!

*after presentation*

Marketing: the staging had so many bugs! Why didn't you tell me?! It was so embarrassing showing it to new customers! Anyway, they loved the new feature. We need it to be ready ASAP.

Devs: What?! That's gonna mess up with our schedule. You know what? Fine, but feature ABC will have to wait another month.

Marketing: Well, it'd be ideal if we could do both...

Devs: Pay for more devs or dor extra hours.

Marketing: Just do XYZ. It's a pity that you'll have to push back ABC but it's fine, XYZ is more important.

(I might ask, if it was so important, why didn't you notice so in the meeting where we had decided that ABC would be prioritized?)

*tons of working hours later*

Devs: There, we finished XYZ.

Marketing: Yay! Wow, this month we'll have two major features done: ABC and XYZ!

Devs: No, ABC is not done yet.

Marketing: What? But the deadline was this week.

Devs: It was, but then you decided to prioritize XYZ and we said we had to push back ABC to get XYZ ready, and you agreed.

Marketing: Did we? Fine. But do it quick.

Marketing and their mood swings.

Don't ever ever forget to push before leaving office.
I repeat : Don't ever ever forget to push!
Sends app to client.
At home and decides to check if the changes actually worked just to realize it crashes because i forgot to comment out my dummy test data.

*On a bus back to the office at midnight*

This is my most ridiculous meeting in my long career. The crazy thing is I have witnessed this scenario play out many times during my career. Sometimes it sits in waiting for a few years but then BOOM there it is again and again. In each case the person that fell into the insidious trap was smart and savvy but somehow it just happened. The outcomes were really embarrassing and in some cases career damaging. Other times, it was sort of humorous. I could see this happening to me and I never want it to happen to you.

Once upon a time in a land not so far away there was a Kickoff Meeting for an offsite work area recovery exercise being planned for our Oklahoma locations. Eleven Oklahoma high ranking senior executives were on this webinar plus three Enterprise IT Directors (Ellen, Jim and Bob) who would support the business from the systems side throughout the exercise.

The plan was for Sam Otto, our Midwest Director of Business Continuity to host this webinar. Sam had hands-on experience recovering to our third party recovery site vendor and he always did a great job. He motivated people to attend the exercise with the coolest breakfasts and lunches you could imagine. Donuts, bagels, pizza, wings, scrumptious salads, sandwiches, beverages and desserts. He was great with people and made it a lot of fun.

At the last minute Charles 'Don't Call Me Charlie' Ego-Smith, the Global Business Continuity Senior Vice President, decided to grand-stand Sam. He demanded the reins to the webinar. Pulled a last-minute power-play and made himself the host and presenter. You have probably seen the move at some point in your career. I guess the old saying, 'be careful what you wish for' has some truth to it - read on and let me know if you devRanters agree...

So, Charlie, I mean Charles, begins hosting the session and greets all of the attendees. Hey, good so far! He starts showing some slides in the PowerPoint presentation and he fields a few questions, comments and requests from the Oklahoma executives. The usual easy to handle requests such as, 'what if we are too busy to do recover all systems', 'what if we recover all of our processes from home', 'what if we have high profile visitors that month?' Hey you can't blame them for trying. You are probably thinking to yourself, 'been there - heard that!' But luckily our experienced team had anticipated the push-back. Fortunately, Senior Management 'had our backs' and committed that all processes and systems must participate and test - so these were just softball requests, 'easy-peasy' to handle. But wait, we are just getting started!

Now the fireworks begin. Bob, one if the Enterprise IT directors started asking a bunch of questions. Well, Charles had somewhat of a history with Bob from previous exercises and did not take kindly to Bob's string of questions. Charles started getting defensive and while Bob was speaking Charles started IM'ing. He's firing off one filthy message after another to me and our teammate Sam.

'This idiot Bob is the biggest pain in the ass that I ever worked with'; 'he doesn't know shit', 'he never shuts the f up', 'I wanna go over to his office and kick his f'in ass...!'

Unfortunately...the idiot Charles had control of the webinar and was sharing his screen so every message he sent was seen by all of the attendees! Yeah, everyone including Bob and the Senior Oklahoma executives! We could not instant message him to stop as everyone would have seen our warnings, so we tried to call Charles' cell phone and text him but he did not pick up. He just kept firing ridiculously embarrassing dirty IM messages and I guess we were all so stunned we just sat there bewildered. We finally bit the bullet and IM'ed him to STOP ALREADY!!! Whoa, talk about an embarrassing silence!

I really felt sorry for Bob. He is a good guy. Deservedly, Charlie 'Yes I am going to call you CHARLIE' got in big time hot water after the webinar with upper management. For one reason or another he only lasted another year or so at our company. Maybe this event played a part in his demise.

So, the morale is, if you use IM - turn it off during a webinar if you are the host. If you must use it, be really careful what you say, who you say it to and pray nothing embarrassing or personal is sent to you for everyone to see.

Quick Update - During the past couple of months I participated on many webinars with enterprise software vendors trying to sell me expensive solutions. Most of the vendors had their IM going while doing webinars and training. Some very embarrassing things came flying across our screens. You learn a lot reading those messages when they pop-up on the presenters' screen, both personal and business related. Some even complaints from customers!

My advice to employees and vendors is to sign-out of IM before hosting a webinar. Otherwise, it just might destroy your credibility and possibly your career.

Microsoft Internet Explorer is my least favorite enterprise software. We are forced to use it. I hate being forced. This is like being asked to climb a mountain with a broken leg...not fun, painful, hopeless, threatening, discouraging, slow, and ugly, and infected...it is downright evil corporate bullshit.

<!--[if IE]>
<link rel="styleshit" type=trash/css" href="die-die-die-you-evil-bastard.css"/>
<![endif]-->

Just push it over the edge with a chrome sword stuck in its back. I will just sit here by the fire with my pet fox and watch the opera as I listen to vivaldi.

Fuck today.

Today I was supposed to go into work and set up a dozen or so units for beta testing (its been a year and a half coming)..

Got up nice and early to get a head start on things. Stubbed (and broke) my motherfucking toe, then spilled my cereal milk on my laptop.. subsequently spend the following 2 hours tearing down and cleaning my poor little lappy. Get her all put back together, starting to feel a little better about the day. Push the power button, and fucking nothing but a tiny little fan noise for half a damn second.

With this luck I don't even want to move, lest a magic falling anvil decides to adorn my head..

!rant.
Here's some useful git tricks. Use with care and remember to be careful to only rewrite history when noones looking.

- git rebase: powerful history rewriting. Combine commits, delete commits, reorder commits, etc.

- git reflog: unfuck yourself. Move back to where you were even if where you were was destroyed by rebasing or deleting. Git never deletes commits that you've seen within at least the last 50 HEAD changes, and not at all until a GC happens, so you can save yourself quite often.

- git cherry-pick: steal a commit into another branch. Useful for pulling things out of larger changesets.

- git worktree: checkout a different branch into a different folder using the same git repository.

- git fetch: get latest commits and origin HEADs without impacting local braches.

- git push --force-with-lease: force push without overwriting other's changes

So the other day my Huawei phone got a push update, but after installing it, seemingly nothing happened.

I just took a look at my Android version.

I was rolled back from Android 8 to 7.

Let the softroot begin!

Here's a genuine rant for you. Probably the only one I've ever made and ever will..

It's a bit depressing and covers a few topics so just read it, it's important.

*deep inhale*
So, with the help of my friend and my Nana, I was getting VR set up. (Oh, what joy.)

Now, I love everything about VR. But the thing is, I've had this damned headset since may (Dell MMR) and I haven't been able to use it. The reason for that is, something always came up that I needed to buy and this became a huge deal.

But let's start from the beginning.. I'm curentally fighting depression. I have been for months. My only income is what my Nana gives me ($150/mo) and what my friend ocasinally gives me.

Anyways, the first issue was that I couldn't afford the headset. This was find, as my friend would get it for me, and I would pay them back the following month. But, then, once I got the headset that's when the real problems started. First it was that I needed bluetooth, so I bought an adapter. Then I realized my entire CPU was incompatable, so I had to get a new tower and I went ahead and got a new GPU as well. I also got a charging kit for my headset (This ended up making me owe my Nana money). Then after all of that was settled, I learned that the evauation software lied, and my computer doesn't have USB 3, so I need that too but low and behold; both of my graphics cards cover my second pcie slot. So my options are to either try and rig up something, or to buy a cpu and psu for my third AMD PC which I had forgotten about during this whole ordeal..

This was soposed to help me with my depression and stress. Now I don't even want to get out of bed.

With all that said, I might be getting on SSI soon (I'm sure some of you are familar with that, and no I don't want to talk about it) and when that happens I might just leave behind tech (well, my PC and games) and all the stress and pain it's caused me over my life so this was all for nothing.

Honestly.. I'm just done with everything. To all the new faces around here; Hello! How are ya? To everyone else; You know me. I've been around for a while, though I'm not popular because I lurked and commented with Alice. You all probably noticed that I left a while back, and it was because I was trying to get out of tech. My reason for tech was that I was searching for something. I was always looking for the next game to sate me, or fill this gap in my life. I became a programmer because it gave me control were I lacked it otherwise. I made friends online because my anxiety prevented me from doing so in the real world.

But to what end? What have I acomplished? My twenty second birthday is next month. I've no job, I move from family member to famly member because I'm so fixated on becoming someone else to make something of myself.

I have my own ideals, but it seems that I push them aside to try (and fail to) impress others.

It's time for change. Of course, I can't do anything without money, so I'll have to wait for my SSI which I will get news on in August.

I hope this message came through how I meant it to. There is so much I want to say, but I've no words to say them. And btw, the VR thing is just one of manny issue that i've delt with (but certanly the most expensive)

Alice, Zennoe (Alexis, whom is not on devrant); I'm not giving up tech entirely. don't expect to suddenly not hear from me. I'm mostly just giving up my computer and games. More casually so for now, and them more seriously once I get on SSI. I'll still message you every/other day like I have been. <3

Me: Requirements changed a lot since we first started. If we re-write a few sections of the app we can drastically reduce bugs, crashes, improve debug-ability etc.

PM: sure let me push back this unnecessary feature and you can do that next.

*woke up*

*cried at the thought of how amazing life would be*

I'm working in a blockchain company for $180 as a junior programmer and there is a mid-senior guy who get ~8 times more than me. So we got a project to make a backend API with its tests. When I was partly completed my part of the project I asked that "mid-senior" to share his code with me. Nothing was done, and he asked me to push my changes to git so he could start to do something (view at my code and start copying). BUT. He couldn't even pull from git. He couldn't use that fucking Visual studio's team explorer and even the solution explorer. Ok, he was working with VS for the first time, but I did too. I cloned the repo gave him the environment to start "working" and get back to my work. After that nothing changed, he was writing each one-lined if block for half hour and the code was very dirty. Finally I've got his laptop and started to writing his part by teaching him all the programming. You may say I'm mad. I really do, I think that I did all project. This is sad... How can people get this much by being this far from the programming? We need really high quality programmers.

I closed the lid of my laptop and went for a lunch. When I came back the damn machine wouldn't start and I realised I didn't push anything to github today so wish me luck recovering data from the drive.

(At least lunch was good.)

Greetings from Denmark! Thought I would join after a lot of lurking, and tell a little story, as to how I fucked up when I started in my company.

I've been there around 10 days and had never used git besides just add, commit, and push. I was told to work in feature branches, and I did, I was playing around trying to learn, and got some merge conflicts, made a lot of unnecessary commits etc. I was told to clean it up before I merged into dev. And as I didn't know git I asked how I could do that. I was told I could force push in my branch, and that it was okay as long as it was only inside my branch. I tried that and saw my command line force pushing to all branches including dev, and master. My heart skipped a couple of beats, and I went directly to my Lead developer and asked what happend. He got a bit mad at me for pushing in dev and master, and override all the commits there had been made. I tried to explain I didn't he did not really believe me, I was so nervous. Luckily everything came back to normal with people's local branches being pushed etc. But that day I learned about git's push matching config, and my lead was luckily only mad in the heat of the moment and even apologized for getting mad. Just one of my little fuck up's in my short time as a developer

Bout to loose my shit. Fucking hate it when clients push and push to launch the system as urgently as possible. Say they have run through the test version and understand what they are getting and sign it all off. Then come back 2am the day after launch and bitch and moan cause its missing features they thought where there when they weren't part of the original planning and always use the excuse "i have just bought a bunch of marketing, your loosing me money" or "I have an important even with important people that need this tomorrow" and try make it your fucking problem.
Firstly, fuck you
Secondaly, fuck you.
I cant even comprehend your lack of logic.

the effort to get girls, and children for that matter into programming has been terrible. I never thought I could find something worse than code.org, but here it is: SmartGurlz (because what could be smarter than spelling your own gender wrong, right?). this was on shark tank and this lady was making robots to try to get girls into programming. they pretty much control dolls on wheels by means of scratch. it's terrible. first of all, how the fuck is that profitable? when a little girl wants to play dolls, what kind of girl wants to *program* it first. jesus, no kid wants that.

second, this girls who code thing makes me barf. the thought process for many organizations trying to push girls to code is "hmm, if we isolate girls and give them lower standards, then maybe they'll decide to go into a male-dominated industry," because, fuck logic right? idiocy is dreadful. lastly, what I hate most about so many of the girls coding organizations, is the fact that they have to embrace the stereotypes. almost every single one cares about "feelings" or something similar. its bullshit.

and don't get me wrong, women should have equal opportunity, but pushing them into stem fields isn't good. bias in the workplace is what we should be talking about, or other topics like women being paid less. trying to make girls interested in programming is complete bullshit, let them do what they want.

back to "SmartGurlz," I looked them up and they confirmed what I expected. the first thing I see? not anything related to programming whatsoever, but different dolls wearing different outfits. girls deserve something better, and shouldn't have to deal with organizations trying to push them into something they don't want to do.

Why do people have to lie? I am seriously getting tired of it.

Context: While I was on vacation the company hired some guy we’ll call Bob.
Bob is a senior with 10+ years of experience. 5 of those years in React (supposedly).
I got back from vacation and was told I’d be working on a project with Bob.
I’ve worked in teams before so I thought no problem.

Now I am aware that different people have different styles, so that’s why we agreed on a lint config with some fancy git hooks.

I was excited at first because the project actually seems nice, but my excitement soon turned into terror.

First of all, Bob doesn’t seem to understand Git…fair enough, I’ll give him a quick guide…

Mf calls me at 11pm on a Friday because he can’t push because the tests are failling.

Now tests. Bob doesn’t write those. Great.

We had created a few components to use throughout the project.

Bob seems to consistently forget what components are and why you write them and just imports the defaults from the UI library we’re using.

Bob also has a kink for hardcoding values for some reason.

I talked to Bob multiple times about this and he just tells me he’ll change it but in the end the PR stays open for 5 days, before it’s actually me who goes in and fixes it. Oh and yeah this shit keeps happening over and over again.

Now I know some of us devs hate meetings but for the love of God Bob just show up. You don’t even have to speak. Or at least answer a message that corresponds to the working hours and not in the middle of the night.

I am getting tired of this behavior and am seriously holding back from reporting this to the management. It’s been a month and I am seriously worried about the project. I have my own stuff to do but it takes time for me to clean up his absolute mess that doesn’t even pass the CI.

Call me an asshole I don’t care. It’s been a month and I’m legit worried about the future of the project.

So I'm back from vacation! It's my first day back, and I'm feeling refreshed and chipper, and motivated to get a bunch of things done quickly so I can slack off a bit later. It's a great plan.

First up: I need to finish up tiny thing from my previous ticket -- I had overlooked it in the description before. (I couldn't test this feature [push notifications] locally so I left it to QA to test while I was gone.)

It amounted to changing how we pull a due date out of the DB; some merchants use X, a couple use Y. Instead of hardcoding them, it would use a setting that admins can update on the fly.

Several methods deep, the current due date gets pulled indirectly from another class, so it's non-trivial to update; I start working through it.

But wait, if we're displaying a due date that differs from the date we're actually using internally, that's legit bad. So I investigate if I need to update the internals, too.

After awhile, I start to make lunch. I ask my boss if it's display-only (best case) and... no response. More investigating.

I start to make a late lunch. A wild sickness appears! Rush to bathroom; lose two turns.

I come back and get distracted by more investigating. I start to make an early dinner... and end up making dinner for my monster instead.

Boss responds, tells me it's just for display (yay!) and that we should use <macro resource feature> instead.

I talk to Mr. Product about which macros I should add; he doesn't respond.

I go back to making lunch-turn-dinner for myself; monster comes back and he's still hungry (as he never asks for more), so I make him dinner.

I check Slack again; Mr. Product still hasn't responded. I go back to making dinner.

Most of the way through cooking, I get a notification! Product says he's talking it through with my boss, who will update me on it. Okay fine. I finish making dinner and go eat.

No response from boss; I start looking through my next ticket.

No response from boss. I ping him and ask for an update, and he says "What are you talking about?" Apparently product never talked to bossmang =/ I ask him about the resources, and he says there's no need to create any more as the one I need already exists! Yay!

So my feature went from a large, complex refactor all the way down to a -1+2 diff. That's freaking amazing, and it only took the entire day!

I run the related specs, which take forever, then commit and push.

Push rejected; pull first! Fair, I have been gone for two weeks. I pull, and git complains about my .gitignore and some local changes. fine, whatever. Except I forgot I had my .gitignore ignored (skipped worktree). Finally figure that out, clean up my tree, and merge.

Time to run the specs again! Gems are out of date. Okay, I go run `bundle install` and ... Ruby is no longer installed? Turns out one of the changes was an upgrade to Ruby 2.5.8.

Alright, I run `rvm use ruby-2.5.8` and.... rvm: command not found. What. I inspect the errors from before and... ah! Someone's brain fell out and they installed rbenv instead of the expected rvm on my mac. Fine, time to figure it out. `rbenv which ruby`; error. `rbenv install --list`; skyscraper-long list that contains bloody everything EXCEPT 2.5.8! Literally 2.5 through 2.5.7 and then 2.6.0-dev. asjdfklasdjf

Then I remember before I left people on Slack made a big deal about upgrading Ruby, so I go looking. Dummy me forgot about the search feature for a painful ten minutes. :( Search found the upgrade instructions right away, ofc. I follow them, and... each step takes freaking forever. Meanwhile my children are having a yelling duet in the immediate background, punctuated with screams and banging toys on furniture.

Eventually (seriously like twenty-five minutes later) I make it through the list. I cd into my project directory and... I get an error message and I'm not in the project directory? what. Oh, it's a zsh thing. k, I work around that, and try to run my specs. Fail.

I need to update my gems; k. `bundle install` and... twenty minutes later... all done.

I go to run my specs and... RubyMine reports I'm using 2.5.4 instead of 2.5.8? That can't be right. `ruby --version` reports 2.5.8; `rbenv version` reports 2.5.8? Fuck it, I've fought with this long enough. Restarting fixes everything, right? So I restart. when my mac comes back to life, I try again; same issue. After fighting for another ten minutes, I find a version toggle in RubyMine's settings, and update it to 2.5.8. It indexes for five minutes. ugh.

Also! After the restart, this company-installed surveillance "security" runs and lags my computer to hell. Highest spec MacBook Pro and it takes 2-5 seconds just to switch between desktops!

I run specs again. Hey look! Missing dependency: no execjs. I can't run the specs.

Fuck. This. I'll just push and let the CI run specs for me.

I just don't care anymore. It's now 8pm and I've spent the past 11 hours on a -1+2 diff!

What a great first day back! Everything is just the way I left it.

Who the fuck came up with the idea of using SharePoint? What it even is?! Is it a website, wiki, document repo...?

Our version seems to be a broken wiki with no info content, old links, illogical navigation. And somehow word documents are integrated into it. Sometimes you see some weird calendar and timelines (from old projects). You can navigate into a folder, but you cannot get back. There's no ".." button?? You can map it like OneDrive to yourself, but Windows doesn't support any document version control. Where's the check in/out option from explorer menu??? I sure as shit have those for SVN, GIT etc. Is there a new version created everytime I press ctrl-s or only when I close the document?

Well, I could open the document in "online" mode. Ok, the formatting goes weird and everything is super slow. But at least I can fuck up someone elses document by accidentaly copy/pasting stuff, deleting lines, hitting my face into keyboard etc. There's automatically new version added!

Somehow you can enable the forced check in/out for documents. Obviously only the library admin can do that. And since he's just a program manager, he has no clue what the fuck is version control or document management. So he has this thing on his "things to do" list. For him, document management means sending various spec versions as email attachments. And the developers can figure out together who has the most recent one.

How did M$ push shit piece of shit to corporations? They even use this crap for the intranet making it slower than creation of galaxies. Though it's ok, since you cannot find anything from the intranet. It's all just head honchos blogs, seasonal greetings and stock market statuses. Nowhere is seen the downstairs cafeteria menu for the day. Or where to report for broken toilet. You know, stuff that 99% of people would like to see.

I complained to M$ about the SharePoint, but apparently there's no problem. You can code it yourself? Yeiii! So, instead of just updating some line in design spec, I have to take a 3 month class and get a MS sertificate, code some class-based-web-shit for 6 months and maybe, maybe then I can make the page/document look normal?

I am thinking, that I will just start writing my specs on paper. I will put them on the shelf and if you want to read it, you will check it out manually. And if someone else tries to edit it while you are editing it, you just cover the paper with your hands. There might be a requirement to make the document look more like MS Word, but that's easy to do. Just go to WC with the paper and wipe with it a couple of times.

My teammate push 2gbs worth of CSV files into our repo.

He also merged all the other branches so, it's kinda hard to revert back without reworking a lot of stuff.

Forgot to push to stable branch before I left from work. Nightly build takes 5 hours so I needed to do that in order to get nightly in the morning. As I'm moving I have only cellphone with 16k internet at home. Sounded like I'm screwed. But luckily fetching few new commits and pushing them back to correct branch git managed even over this parody of internet connection. Love git, I'm saved. Whole repo has few hundred megs, if I had to download everything it would be faster to wait to get real internet connection in few days.

Worst exp. on a collab/group project?

Had a few, here is one.

Worked with a dev team (of two devs) in Norway to begin collaboration on providing a portal into our system (placing orders, retrieving customer info, inventory control, etc)

They spoke very good English, but motivation was the problem. Start the day around 10:00AM...take a two hour lunch...ended the day at, if I was lucky, 4:00PM (relative to Norway time). Response time to questions took days, sometimes weeks. We used Skype, which helped, but everything was "Yea...I'll do that tomorrow...waiting on X....I have a wedding to go to, so I'll finish my part next week."

I didn't care so much, I had other projects to do, but the stakeholders pounded me almost everyday demanding a progress report (why aren't you done yet...etc..etc.)
The badgering got so bad I told the project owner (a VP) if he wanted this project done by the end of the year, the company would have to fly me to Norway so I personally push things along.
When real money was on the line, he decided patience was warranted.

A 3 month project turned into 9, and during a phone meeting with the CEO in December
O: "Thanks guys, this project is going great. We'll talk again in February. Bye."
PM: "Whoa...what! February!"
<sounding puzzled>
O: "Um..yes? It's Christmas time. Don't you Americans take off for Christmas?"
PM: "Yes, but not until Christmas. Its only December 12th. Your taking the whole month of December and January for Christmas?"
O:"Yes, of course. You Americans work too hard. You should come over here and see how we celebrate. Takes about a month so we can ease back into the flow of things."
<Jack is the VP>
PM: "Jack wanted this project completed by the end of the year, that is what everyone agreed to."
O:"Yes, I suppose, but my plane is waiting on me. Not to worry, everything will be fine."
<ceo hangs up>
PM: "Oh shit..oh shit..oh shit. What are you going to do!?"
Me: "Me!?..not a darn thing. Better go talk with Jeff."
<Jeff is the VP>
J: "This is unacceptable. You promised this project would only take a few months. I told you there would be consequences for not meeting the deadline."
PM:"But..but...its not our fault."
J: "I don't care about fault. I care about responsibility. I've never had to fire anyone for not meeting a deadline, but .."
Me: "Jeff, they are in Norway and no one is working this project for the next two months. You've known for months about them dragging their asses on this project. We're ready to go. Services have been tested and deployed. Accounting has all the payment routing ready. Only piece missing is theirs."
J: "Oh. OK. Great job guys. I guess we'll delay this project until February."
<leave the office>
PM: "Holy shit I'm glad you were there. I thought I was fired."
Me: "Yea, and that prick would have done it not giving a crap that it's Christmas."
<fast forward to Feb>
O: "Our service provider fell through, so I'm hosting with another company. You guys know PHP? Perl? I don't know what they called it, but it sounded so cool I bought the company."
PM: "You bought what? Are we still working with Z and B?"
O:"Yea, sort of. How's your German? New guy only speaks German."
PM: "Um, uh... no one here speaks German"
O:"Not to worry, I speak German, French, and Italian. I'll be your translator."
PM: "What? French and Italian?"
O: "On my trip to France I connected with a importer who then got me in touch with international shipper in Italy. I flew over there and met a couple really smart guys than can help us out. My new guy only speaks German, J only speaks French, and R speaks Italian, Russian, and a little English. Not to worry, I'm full time on this project. You have my full attention."

We believe the CEO has/had some serious mental issues, including some ADD. He bailed within the first month (took another vacation to Sweden to do some fishing) and left me using Google Translate to coordinate the project. Luckily, by the end, the Norwegian company hired a contractor from England who spoke German and hobbled together the final integration.

Long time ago, back in a day of Microsoft Office 95 and 97, I was contracted to integrate a simple API for a payment service provider.

They've sent me the spec, I read it, it was simple enough: 1. payment OK, 2. payment FAILED. Few hours later the test environment was up and happy crediting and debiting fake accounts. Then came the push to prod.

I worked with two other guys, we shut down the servers, made a backup, connected new provider. All looked perfectly fine. First customers were paying, first shops were sending their products... Until two days later it turned out the money isn't coming through even though all we are getting from the API is "1" after "1"! I shut it off. We had 7 conference calls, 2 meetings, 3 days of trying and failing. Finally, by a mere luck, I found out what's what.

You see, Microsoft, when you invent your own file format, it's really nice to make it consistent between versions... So that the punctuation made in Microsoft Word 97 that was supposed to start from "0" didn't start from "1" when you open the file in Microsoft Word 95.

Also, if you're a moron who edits documentation in Microsoft Word, at least export it to a fucking PDF before sending out. Please.

The push back phrase my manager uses when I try to discuss a requirement which I think is incorrect:
"It was discussed and agreed upon at the beginning b/n PM and engineering"
To hell with that, if 10 people arrive at a stupid decision, its still a stupid decision

I just sit back until the project progresses much further and wait for another senior dev whom they can't ignore to bring up the same issue.
It is supremely frustrating 😤

Our project schedule is quite full at the moment, we are basically at the limit for the next three months.

In comes one of our sales people: "Hey, can we squeeze in a little project, nothing fancy just a very basic static web page." (No question mark there, it was not a question...)

I say no, we are full, the deadline is to tight (3 weeks), can't do it.

In comes boss: "Sure you can, just push everything else back." (We won't change deadlines, what he actually means is for us to do unpaid overtime for two months so he can barocke make a few thousand extra bucks...)

So I cave and allow it. It were just 4 hours of work, we can squeeze it in, maybe do a little less R&D this month.

Next day, the project scope changed, suddenly we are not taking about 4 hours but 80. Sure, we can squeeze two extra weeks into the month.

That is when I realized, I don't hate my work, just my work environment.

doNotMessWithITTeamInAFuckingProject();

Last night me with my team have a discussion with my project team. Currently we have a project for our insurance client building a Learning Management System. The project condition already messed up since the first day i join a meeting. Because since its a consortium project with multiple company involved, one of company had a bad experience with another company. It happened few years back when both of company were somehow break up badly because miss communication (i heard this from one of my team).

Skip..skip... And then day to day like another stereotype IT projects when client and business analyst doing requirements gathering, the specs seems unclear and keep changing day by day even when I type this rant I'm sure it will change again.

Then something happened last night when my team leader force our business analyst to re index the use case number (imho) this is no need to be done, and i know the field conditions its so tough for all team members.

So many problems occured, actually this is a boring problem like lack of dev resource, lack of project management and all other stereotype IT projects had. Its sucks why this things is happening again.

Finally my fellow business analyst type a quite long message in our group and said that he maybe quit because its too tired and he felt that the leader only know about push push pushhhhhy fcking pussy, he never go to the client site and look what we've done and what we struggle so far.

I just don't know why, i know this guy earlier was an IT geek also, but when he leading a team he act like he never done IT project before, just know about pushing people without knowing what the context and sound to me like just rage push!

Damnit, i maybe quit also, you know we IT guy never affraid to quit anytime from the messed up condition like this. Even though we were at the bottom level in a project, but we hold the most main key for development.

Hope he (my leader) read this rant. And can realize what happened and fix this broken situation. I don't know what to say again, im in steady mode to quit anytime if something chaos happen nearly in the future.

doNotMessWithITTeamInAFuckingProject();

Worst collaboration experience story?

I was not directly involved, it was a Delphi -> C# conversion of our customer returns application.

The dev manager was out to prove waterfall was the only development methodology that could make convert the monolith app to a lean, multi-tier, enterprise-worthy application.

Starting out with a team of 7 (3 devs, 2 dbas, team mgr, and the dev department mgr), they spent around 3 months designing, meetings, and more meetings. Armed with 50+ page specification Word document (not counting the countless Visio workflow diagrams and Microsoft Project timeline/ghantt charts), the team was ready to start coding.
The database design, workflow, and UI design (using Visio), was well done/thought out, but problems started on day one.
- Team mgr and Dev mgr split up the 3 devs, 1 dev wrote the database access library tier, 1 wrote the service tier, the other dev wrote the UI (I'll add this was the dev's first experience with WPF).
- Per the specification, all the layers wouldn't be integrated until all of them met the standards (unit tested, free from errors from VS's code analyzer, etc)
- By the time the devs where ready to code, the DBAs were already tasked with other projects, so the Returns app was prioritized to "when we get around to it"

Fast forward 6 months later, all the devs were 'done' coding, having very little/no communication with one another, then the integration. The service and database layers assumed different design patterns and different database relationships and the UI layer required functionality neither layers anticipated (ex. multi-users and the service maintaining some sort of state between them).

Those issues took about a month to work out, then the app began beta testing with real end users. App didn't make it 10 minutes before users gave up. Numerous UI logic errors, runtime errors, and overall app stability. Because the UI was so bad, the dev mgr brought in one of the web developers (she was pretty good at UI design). You might guess how useful someone is being dropped in on complex project , months after-the-fact and being told "Fix it!".

Couple of months of UI re-design and many other changes, the app was ready for beta testing.

In the mean time, the company hired a new customer service manager. When he saw the application, he rejected the app because he re-designed the entire returns process to be more efficient. The application UI was written to the exact step-by-step old returns process with little/no deviation.

With a tremendous amount of push-back (TL;DR), the dev mgr promised to change the app, but only after it was deployed into production (using "we can fix it later" excuse).

Still plagued with numerous bugs, the app was finally deployed. In attempts to save face, there was a company-wide party to celebrate the 'death' of the "old Delphi returns app" and the birth of the new. Cake, drinks, certificates of achievements for the devs, etc.

By the end of the project, the devs hated each other. Finger pointing, petty squabbles, out-right "FU!"s across the cube walls, etc. All the team members were re-assigned to other teams to separate them, leaving a single new hire to fix all the issues.

A manager, a mechanical engineer, and software analyst are driving back from convention through the mountains. Suddenly, as they crest a hill, the brakes on the car go out and they fly careening down the mountain. After scraping against numerous guardrails, they come to a stop in the ditch. Everyone gets out of the car to assess the damage.

The manager says, "Let's form a group to collaborate ideas on how we can solve this issue."

The mechanical engineer suggests, "We should disassemble the car and analyze each part for failure."

The software analyst says, "Let's push it back up the hill and see if it does it again."

I'm a jr developer. I started off in automation testing and don't mind it but the testing codebase is cancer, doesn't follow basic Java conventions even basic naming conventions like camelcase, and the tests are super slow using hardcoded Thread.sleep(). Since the automation tests are not automated, I have to run manually. YES manually, every morning I wake up early at 7am to run the 2.5 hour long tests (7am because this before people get to work and when the application goes back online). I run this bitch and monitor them but most of them fail anyways. I also have to write a email report on the results which means I have to explain why shit is failing so I have to debug all this crap. This shit literally eats up an additional 2-3 hours of my work day everyday and the time is not even accounted for. ALSO, since it's running on my laptop, it makes my computer slow most of the day. If I have to debug, I can't have the browser be headless so fuckin chrome browsers be popping up every 2 minutes. I did this for legitimately 8 sprints until I decided enough was enough and bitched about it and the team told me I had no choice. I eventually got them to push towards automating it but it's still in progress so I'm still running this dumb shit. The contractors try to take advantage of me any way they can by giving me mindless bitch work they don't want and they know I don't usually say no since I'm a jr resource. I hate running the fucking automation tumor. Sometimes I go into the meeting rooms alone to scream.
I feel like I'm wasting my life away and not learning as much as I could somewhere else

Always back up your data.

I came to my computer earlier today to find it on my Linux login screen. This could only mean one thing: something went horribly wrong.

Let me explain.

I have my BIOS set up to boot into Windows automatically. The exception is a reboot or something horrible happens and the computer crashes. Then, it boots me into Linux. Due to a hardware issue I never looked into, I have to be present to push F1 to allow the computer to start. The fact that it rebooted successfully, without me present, into *Linux*, could only mean one thing:

My primary hard drive died and was no longer bootable.

The warning was the BIOS telling me the drive was likely to fail ("Device Error" doesn't really tell me anything to be fair).

The massive wave of panic hit me.

I rebooted in hopes of reviving the drive. No dice.

I rebooted again. The drive appeared.

Let's see how much data I can recover from it before I can no longer mount it. Hopefully, I can come out of this relatively unscathed.

The drive in question is a 10 year old 1.5 TB Seagate drive that came with the computer. It served me well.

Press F to pay respects I guess.

On the bright side, I'll be getting an SSD as a replacement (probably a Samsung EVO).

There is a company providing a very speciffic service. And it has a core application for that svc, supported by a core app team.
That company also has other services, which are derivations of the core one. So every svc depends on core.

Now that we're clear on that... I was working in a team of one of the subservices. We very strongly depended on core. In fact, our svc was useless if integration w/ core broke down.

The core team had an annoying habbit. They refused to version their webservices and they LOVED to push api updates w/o any warnings. Our prod, test, other envs used to fail bcz of core api changes quite often. Mgmt, IT head was aware of the problem and customers' complaints as well.

So as a result, once core api changes we're all in a panic mode: all prior priorities are lowered and revival of prod is to be our main focus. Core api is not docummented, the changes are not clear, so we have to reverse engineer the shit out of it. We manage to patch our prod up w/ hotfixes, but now we have tech debt. While working on the debt, core api changed again, in test env. Mgmt pushes debt back and reallocates us to hotfix test. Hotfix is 80% done when another core api breaks. Now mgmt asks us to drop wtv we're working on and fix that new break. By the time we're to deploy the hotfix, another api breaks in another env. The mgmt..... You get the picture :)

2 years go by, nothing has changed so far.

My company has two offices in separate cities but they treat each the devs of each location very very differently.

In one office the devs get full power to experiment with whatever tech they want, they just stomp their feet and management gives em whatever they ask for, freedom of choice regarding anything they are working on, to be allowed to do greenfield work or experimental stuff

But in my office we are forced to do ONLY. Bug fixing and refactoring shitty code from over a decade a go, our tech is ancient and we are not allowed to to
Shit , anything we ask for is denied
And improvements to our process is shut down with the reasoning that whatever we got works so why meddle ??

For us , management is solely focussed on making sure we respond to support calls , deployments , configurations and little bug fixing. Basically they only care that we manage to finish for out next delivery.
No new work whatsoever!
If there is any hint of something new to to
Implemented the golden boys from the other office just stopm their feet tillmthey get it or just go off and start working on it then seek permission afterwards, with their much larger team they obviously get further than we do by the time management hears about it so they end up taking over the work since they already have more done already

My manager decided to push us to attend a company devCon to share ideas with our devs from our other location. This rapidly turned into a sour experience

Basically we do all shitty boring work which puts money on the table which goes straight to those idiots to play with...

They have the guts to laugh when we mentioned that we never get anything interesting to work on

Never seen so many of our devs looking up job sites on the bus back...
This is gonna blow up in management's face...

Lesson I learnt the hard way today: ticket every fucking task (including admin) to:

A. Cover your arse (if the tickets are not ready because they haven't given us enough information, push back on it before committing too much effort to doing it)
B. Better deliverable (what you output will probably be better quality because you worked out the requirements upfront + you know the audience)
C. You have something to show management when they want to try and overwork you some more

Disclaimer: This is not a Windows hate rant as this problem has been solved by Microsoft(partially).

I went to a hackathon last year at an engineering college. It was not such grand hackathon as people have in USA or Europe. So I entered in this competition trying to develop a medical app which asks the user detail about his/her problems then asks questions to match the symptoms of diseases. So me and a guy(who isn't a coder) tried to develop that app. He provided the data of diseases, I tried to develop kind of AI app with those data but found that job too hard for one day hackathon. So I wrote an email for api medic for their api which I was going to use. I then coded continuously for 4 hours in Android studio for the android app. The event manager told us late in the day that repo had been made for the hackathon and we must push our codes before 12 that night. The event manager provided the repo very late that day maybe around 6. I did a big mistake not creating my own repo on github to save every code I had written from time to time.(After this e vent whatever I code I save it in a repo). I was running Windows 10 on one of my laptop and ubuntu on my another. Due to some divine badluck I was using my Windows 10 laptop on that hackathon. So around maybe 10 I was about to wrap up the day push the code to repo. I went to getself a cup of coffee and returned to find lo and behold fucking BSOD. I was fucked, it was my first hackathon so made another misatake of using emulator rather than my android phone. My Android phone was not responding good that day so I used the android emulator.

From that day on I do three things:
1. Always push my projects to github repo.
2. Use android phone after running some minor tests on emulator.
3. Never use windows(Happy arch user till eternity.)

You might be thinking even though BSOD, it can be recovered. But didn't happen in my case, the windows revert back to the time I had just upgraded from Windows 8.1 to 10.

Why dont people trust you?

I was hired to be an SQL developer, I don't actually get to do much development, normally doing something involving copying and pasting in Excel.

Some of our databases were running slow and we noticed some (a few hundred) indexes were in shit state.

I knocked up a couple of scripts, one to reorganise indexes that were up to a certain amount of fragmentation and one to rebuild the indexes

My boss wants them tested (they were several times in dev) we've had these for over 3 weeks, but she doesn't want to run them.

Instead of fixing hundred of indexes she decided I should contrate on fixing some historic data issues that are preventing 10 indexes from being rebuilt.

Now there are serious issues and the CTO is asking why the indexes haven't been fixed.

I could have done this nearly a month ago, but now it's turned into a huge fucki g deal, and no doubt they'll try and push it back on me

I propose that the study of Rust and therefore the application of said programming language and all of the technology that compromises it should be made because the language is actually really fucking good. Reading and studying how it manages to manipulate and otherwise use memory without a garbage collector is something to be admired, illuminating in its own accord.

BUT going for it because it is a "beTter C++" should not constitute a basis for it's study.

Let me expand through anecdotal evidence, which is really not to be taken seriously, but at the same time what I am using for my reasoning behind this, please feel free to correct me if I am wrong, for I am a software engineer yes, I do have academic training through a B.S in Computer Science yes, BUT my professional life has been solely dedicated to web development, which admittedly I do not go on about technical details of it with you all because: I am not allowed to(1) and (2)it is better for me to bitch and shit over other petty development related details.

Anecdotal and otherwise non statistically supported evidence: I have seen many motherfuckers doing shit in both C and C++ that ADMIT not covering their mistakes through the use of a debugger. Mostly because (A) using a debugger and proper IDE is for pendejos and debugging is for putos GDB is too hard and the VS IDE is waaaaaa "I onlLy NeeD Vim" and (B) "If an error would have registered then it would not have compiled no?", thus giving me the idea that the most common occurrences of issues through the use of the C father/son languages come from user error, non formal training in the language and a nice cusp of "fuck it it runs" while leaving all sorts of issues that come from manipulating the realm of the Gods "memory".
EVERY manual, book, coming all the way back to the K&C book talks about memory and the way in which developers of these 2 languages are able to manipulate and work on it. EVERY new standard of the ISO implementation of these languages deals, through community effort or standard documentation about the new items excised through features concerning MODERN (meaning, no, the shit you learned 20 years ago won't fucking cut it) will not cut it.

THUS if your ass is not constantly checking what the scalpel of electrical/circuitry/computational representation of algorithms CONDONES in what you are doing then YOU are the fucking problem.

Rust is thus no different from the original ideas of the developers behind Go when stating that their developers are not efficient enough to deal with X language, Rust protects you, because it knows that you are a fucking moron, so the compiler, advanced, and well made as it is, will give you warnings of your own idiotic tendencies, which would not have been required have you not been.....well....a fucking idiot.

Rust is a good language, but I feel one that came out from the necessity of people writing system level software as a bunch of fucking morons.
This speaks a lot more of our academic endeavors and current documentation than anything else. But to me DEALING with the idea of adapting Rust as a better C++ should come from a different point of view.

Do I agree with Linus's point of view of C++? fuck no, I do not, he is a kernel engineer, a damn good one at that regardless of what Dr. Tanenbaum believes(ed) but not everyone writes kernels, and sometimes that everyone requires OOP and additions to the language that they use. Else I would be a fucking moron for dabbling in the dictionary of languages that I use professionally.
BUT in terms of C++ being unsafe and unsecured and a horrible alternative to Rust I personaly do not believe so. I see it as a powerful white canvas, in which you are able to paint software to the best of your ability WHICH then requires thorough scrutiny from the entire team. NOT a quick replacement for something that protects your from your own stupidity BY impending the use of what are otherwise unknown "safe" features.

To be clear: I am not diminishing Rust as the powerhouse of a language that it is, myself I am quite invested in the language. But instead do not feel the reason/need before articles claiming it as the C++ killer.

I am currently heavily invested in C++ since I am trying a lot of different things for a lot of projects, and have been able to discern multiple pain points and unsafe features. Mainly the reason for this is documentation (your mother knows C++) and tooling, ide support, debugging operations, plethora of resources come from it and I have been able to push out to my secret project a lot of good dealings. WHICH I will eventually replicate with Rust to see the main differences.

Online articles stating that one will delimit or otherwise kill the other is well....wrong to me. And not the proper approach.

Anyways, I like big tits and small waists.

I'm having a DAY.

it's like I'm trying to "2+2=4" and hitting "unknown operator =", figure that out, get "22" back, fix that, then math service is down, redeploy math service, wait 30 minutes, that's up, get "out of numbers" exception, turns out a dependency updated and now I have to register what "2" means, fix that, FINALLY get 2+2 to evaluate, I get 5. Figure that out, get 4! 4!!! FINALLY. Push it. Get 55 on the server. Gets 4 on my machine, getting some random 55 from the server.

I've talked in past rants about how marketing loves showing off features to customers that are still in Beta to give us devs more pressure to finish them earlier, but it really just ends up screwing up our schedule since we have to push back on other features.

We had warned them not to do so for a series of reasons. But this time, this time their bad practices has come back to bite them in their butts.

They've been bragging all over to customers about this API integration we've been developing. They caught a reasonable amount of customers whose main reason for hopping in with us was this API integration. We finished the code on time, and submitted to the API provider for them to revise our "app". It's been a long back-and-forth conversation clarifying purposes and trying to fix tiny details and, of course, the providers' emails take almost a week to come back. We're waayy past the deadline marketing had promised customers, and they know they can't really blame the devs.

Sucks to lose these customers, but it feels so good to show these marketing pricks a lesson.

I used to work on a production management team, whose job was, among other things, safeguarding access to production. Dev teams would send us requests all the time to, "run a quick SQL script."

Invariably, the SQL would include, "SELECT * FROM db_config."

We would push the tickets back, and the devs would call us, enraged. I learned pretty quickly that they didn't have any real interest in dev, test, or staging environments, and just wanted to do everything in prod, and see if it works.

But they would give up their protests pretty fast when I offered to let them speak to a manager when they were upset I wouldn't run their SQL.

I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.

I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.

WHATEVER.

Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.

So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.

Meanwhile, I'm still trying to run db migrations. shit keeps hanging.

Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.

I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.

I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.

Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.

But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.

I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.

UGH!

A coworker told me this a little while ago and I cringed.

"Coworker installs windows partition o n a Mac, not sure what utility he used but he's handled every IT issue, people in our company for years but googling and researching ways to do things.

Steve comes along to do a service on the Macs (apparently) and sees what my coworker did and says "get rid of that it's a security risk", coworker had a legitimate reason to use Windows, plugin for Excel only works in Windows, so Steve could have totally done checks to ensure security wasn't a risk, but he's a Mac elitist, what can you do :/, lucky coworker though gets to use a windows PC and never looked back xD."

Honestly scared of Steve doing that so called service seeing I have tons of things I need to use (source tree, Android studio, some tools to test push notifications) and just down right deleting them because of his reasons, that and the whole he does services after hours without much warning (last time it was a leave password on desk for the next "week" and Steve will come in and fix the Macs) I can't defend my argument of why I use something like Android studio (to develop the app for the company LOL)

TL;DR: OMFG! Push the button already!

I've been away on paternity leave for quite some time now. Today is my first day at work since the end of July.

Just a couple of days after my paternity leave started, I was contacted by one of the managers because a tracking and analytics service I had made some months earlier had halted.

Now, I did warn them that the project was fragile and was running of an old box in my office. So they shouldn't be surprized if it came to a halt every now and then.

Well, so being on my paternity leave and all I didn't want to spend time fixing it. I had a child to look after. So I told the manager that the box probably just had shut down. I think there was a power outage the day before, so I probably thought it was the cause. So he probably just had to turn it back on. I also told him the admin u/p in case he needed to restart some services.

Today, the CEO enters my office telling me to get that thing fixed. Because that manager apparently couldn't find the power button.

I got my promotion by forcing it. I work at a fairly large gov organization and have done so for 2.5 years. I had been asking for a pay rise for years but was always told there’s no budget. I was doing work way beyond my pay grade as many senior devs had left. Eventually I got really sick of it so applied to another company, took 5 interview rounds but I had an offer that was a 30% raise on my salary at that time.

I submitted my resignation fully thinking that i’m going to leave, but what do you know, my division not only found the budget but did so in 2 days to come back with a counter offer. It’s funny how when push comes to shove, money that previously didn’t exist just appears out of no where

Giant, month-and-a-half-long-ticket.
After learning six or so complicated areas of the system and updating them all to work with the new changes, make them all play nicely, etc. I finally got everything working. 95% spec coverage, though no ui tests because I haven't gotten selenium working. whatever, everything's done and works.

Second dev bases her ticket off of mine and continues working. Work elsewhere continues and there's an official release, so we both merge in master. I run tests, everything passes, and go back to working on other tickets.

She finishes her ticket.
We do end-to-end testing, and everything works perfectly. Time for a demo!

She merges in master again, and pushes her branch to two staging servers. (idk why two.)

Demo starts.
We connect to the staging servers, and... none of the UI changes exist; they aren't running the correct code!

So she runs it locally for a demo instead. Two features in my ticket no longer work. She throws me under the bus. She throws me under the bus again by criticising a rake task I scrapped because she wanted to do it. Then again because I didn't update my branch to master and push it before the demo, despite having no reason to. and despite the demo being of her branch.

Then she continues to show off and brag about how she's like the "legend" (senior dev) she envies. QAbuys it.

I'm having an emotion, and it's called anger.

Back in the day, when callbacks was all I've found on Internet tutorials, my code looked like this (img) . But then I found something called "async" and it changed my life!

But I couldn't let go of my old ways, so the code with async looked just like the callback one, but with new boilerplate code.

The thing is: you can't simply USE something new like you were using the old one. you'll probably use it wrong. you have to understand that this new thing is different and adapt your thinking process to better work with it.

you can sit on a skateboard and go forward using your hands on the ground to push it, but that's not how it was designed to work.

I still use callbacks because I have no intention of rewriting my working codebases right now (because they work just fine). But, even with my struggles in changing to new tech, I've learned to adapt (sort of).

There was a sales manager who was raked with overseeing me and another dev finish a last minute request project. He said at one point to the other dev that he was mad at developers because we understood something that he would never understand.

This same manager would often sit in on estimation meetings and constantly say that we were estimating too high and needed to come up with faster solutions. When we would offer him with caveats of possible technical debt or unintended side-effects/performance issues, he'd want us to go with that solution. He would then complain that we were always wanting to work on technical debt and that our application was slow. He would also ask for very high level estimates for large, unscoped features/apps without any meaningful level of detail, then hold us to the high-level estimated date even after revealing additional features previously unmentioned.

We learned to never compromise on the right solution and to push back hard on dates without proper scoping. They didn't learn, so I and most of the good devs left.

This is the last part of the series
(3 of 3) Credentials everywhere; like literally.

I worked for a company that made an authentication system. In a way it was ahead of it's time as it was an attempt at single sign on before we had industry standards but it was not something that had not been done before.

This security system targeted 3rd party websites. Here is where it went wrong. There was a "save" implementation where users where redirected to the authentication system and back.

However for fear of being to hard to implement they made a second method that simply required the third party site to put up a login form on their site and push the input on to the endpoint of the authentication system. This method was provided with sample code and the only solution that was ever pushed.

So users where trained to leave their credentials wherever they saw the products logo; awesome candidates for phishing. Most of the sites didn't have TLS/SSL. And the system stored the password as pain text right next to the email and birth date making the incompetence complete.

The reason for plain text password was so people could recover there password. Like just call the company convincingly frustrated and you can get them to send you the password.

I think this a perfect anecdote of where tech is going nowadays:

I moved my bowels on one of those high-tech Japanese toilets: it allowed you to control the seat temperature, cleaned your butt with spray (with an additional "ladies" mode), had several modes of flushing (1, 2, and "eco"), automatically lifted and closed the lid, played some music for you, had a remote controller for you to flush your shit at a distance.

But, guess what, IT DIDN'T FLUSH SHIT. It pathetically trying to flush my shit with 1000 different kinds of puny jets and draining modes but my heap of shit always bounced back because its flush was so weak that it couldn't push it.

I don't care if the seat warmer went out of control and burned my ass or if the butt cleaning jet didn't reach my anus,
JUST DO WHAT YOU'RE SUPPOSED TO DO AND FLUSH MY SHIT.

So you warn the agency that the client is going to eat into the Dev time with their constant design change requests. Warned them repeatedly for a good month, I should add, asking them to better manage the client's expectations and push back for a later launch date. Come time for development and they act all surprised that we can't build the entire site, that we outlined in the timeline will take 4 to 5 weeks of Dev time, in less than 2 weeks!! ... It gets worse! They say the client is happy to compromise as long as we launch "something" by this date. We list out what can be done, and the fact that there's no time for the client to do QC and we won't be able to do a full QA phase on the site until after launch and only when we finalise all the features. Agency says client agrees and within 3 days into development, they want to QC the site and add more features....... still wanting all this in 2 weeks. This site has now been in development for 3 months.

So after 6 months of asking for production API token we've finally received it. It got physically delivered by a courier, passed as a text file on a CD. We didn't have a CD drive. Now we do. Because security. Only it turned out to be encrypted with our old public key so they had to redo the whole process. With our current public key. That they couldn't just download, because security, and demanded it to be passed in the fucking same way first. Luckily our hardware guy anticipated this and the CD drives he got can burn as well. So another two weeks passed and finally we got a visit from the courier again. But wait! The file was signed by two people and the signatures weren't trusted, both fingerprints I had to verify by phone, because security, and one of them was on vacation... until today when they finally called back and I could overwrite that fucking token and push to staging environment before the final push to prod.

Only for some reason I couldn't commit. Because the production token was exactly the same as the fucking test token so there was *nothing to commit!*

BECAUSE FUCKING SECURITY!

I’m working at an architecture firm these days, so I don’t have many “dev” stories to tell. However, I’d like to share this anecdote to reassure (or demoralize) you all that the kind of nonsense we’ve all dealt with as software developers isn’t limited to the software industry.

I’ve been working on a project to build townhomes and apartments on vacant lots in an urban environment.
Space is limited, so the client assured us early on that they would be centralizing all the mechanical equipment (water heaters, air conditioners, etc.) in the basement of each building. We finally got all the apartments laid out and presented them to the client last week. During that meeting, we get a casual “oh, by the way, we need a 3-foot by 3-foot mechanical closet in each apartment.” Did the project manager push back? Of course not. Have our deadlines been adjusted as a result of changing requirements? Don’t be silly! Starting tomorrow morning, the team gets to feverishly search for an extra 9 square feet in each of a couple dozen different apartment layouts that are already “cozy” in time to meet our next deliverable.

Clients suck.
Changing requirements suck.
Pushover PMs suck.
In every industry.

When you snap at the other Developer because you SWEAR your bug fix push corrected the issue, to then be put back in your place...realizing the other Developer was right...humble yourself

Made an Android app a while ago. I needed some pet project so I decided to go with Java for Android. First time, no experience at all.

So everything went ok, I had a little help from a colleague, structuring code, and pushing to the store. Work done app was doing ok.

A year later I came back to this project. I needed to fix a bug - date time and daylight savings crap. 😥

Spent a week on it. Ready to push a new version to the store, with some extra features! Build apk. All good.

Wait. I need to sign the APK? Wtf. I had to format my hard drive. How do I recover my fucking certificate?

*Google's for a while*

No fucking way. I can't restore the certificate. Or get the keystore back. The solution is to create a new app with a brand new package name?

Thanks for nothing, I'm done with Android development.

Fuck this client's IT department. They're a bunch of Microsoft asslickers.

How am I supposed to push code to your self-hosted GitLab instance if you restrict me to Citrix RDP????? No OpenVPN access because I'm on Linux?? Seriously? Because I am not using any of your laptops?

FUCK YOU DUMBASSES, I COULD DO A BETTER JOB THAN YOU AND I JUST PLAY WITH LINUX.

When I said I only needed terminal access I would have never imagined they were thinking of Putty inside an RDP. What a steaming shit.

Oh you guys don't have a secret management service as any enterprise should? Oh I cannot add a secret management service as part of the solution I am building for you guys because "Hurr Durr yOu HaVe NoT pUt ThIs In ThE pRoJeCt PrOpOsAl sO nO"

Fuck you guys. You guys only don't want to move to the cloud to not lose your jobs. I would be far more productive than relying on you pieces of dumbassery.

They are all having each others back in using shit technology and practices.

Yea it’s totally cool. Dropping a conference call on me 30 minutes before it happens. And then you (and everyone else in the call) should be late too. And then do this stuff all the damn time and ask me why I have to push the deadline back. But get super pissy when I give you a realistic deadline that factors these bullshit experiences in!

Then after I wait 10 minutes on the line, tell me it’s been moved to the bottom of the hour which doesn’t really leave me enough time to do anything but play on DevRant. Fucking insanity.

So about 3 weeks ago I was laid off from my dream job due to corporate bullshit. From the feedback received since then it is clear that the company made a mistake hiring a brand new React dev while they really needed an experienced one. Because the consultants who were supposed to be weren't. And the other in-house front end dev was an elitist asshole. And I never received proper feedback until it was too late. Actually I still don't have proper feedback save for some vague stuff which really sounds like the kind of feedback you'd give someone in the middle of their learning process. They even said eventually given more time I could have made it. But alas they felt they had to make a call in the best interest of the company.

Things moved fast since then, I took a week to recover and then I spent time updating my resume before getting back in touch with the recruiter who got me my last job. Great guy and he was happy to help me again. Applied to some positions, got some replies, first in person interview I go to they are immediately willing to take me on.

So now I'm supposed to start tomorrow but somehow I'm having my doubts. The company isn't an IT company but rather a fashion company. They believe in developing in house tools because past attempts with external companies resulted in them trying to push their vision through. Knowing who they worked with I agree, they tried to oversell all the time. But after talking with their developers I noticed they are behind on their knowledge. But so am I. So there was no tech interview which means I am getting an easy way in. And if they honour their word I'll be signing tomorrow for around my old wages.

So you'd think that sounds good right? And yet I'm worried it's going to be another shit show working on software without proper analysis or best practices. I mean the devs aren't total idiots, they are mediors like me and I think their heart is in the right place. They want to develop a good project but it will be just us 3 making a modern .net wpf application with the same functionality of the old Access based system currently in use. I was urged by the boss to draw on my experience and I think he wants me to help teach them too. But I'm painfully aware for my decade since graduating I'm a less than average .net dev who struggles with theory and never worked a job where I had someone more experienced to teach me. I coasted most of the time in underpaid jobs due to various reasons. But I'd always get mad over shitty code and practices. Which I realize is hypocritical for someone who couldn't explain what a singleton class is or who still fails at separation of concerns.

So yeah my question for the hivemind is what advice would you give a dev like me? I honestly dislike how poor I perform but it often feels like an insurmountable climb, and being over 30 makes it even more depressing. On the other hand I know I should feel blessed to find a workplace who seems to genuinely believe that people grow and develop and wishes to support me in this. Part of me thinks I should just go in, relax, but also learn till I'm there where I want to be and see if these people are open to improving with me. But part of me also feels I'm rushing into this, picking the first best offer, and it sure feels like a step backwards somehow. And that then makes me feel like an ugly ungrateful person who deserves her bad luck because she expects of others what she can't even do herself :(

There’s so much we can learn from Gordon Ramsay..
I wish I could swear & insult like he can..

Woman: “who do you think you are? You insulted my friend!”
Gordon: “well if I did then I probably meant it, now get your fat ass back to your table”

“Congratulations, you just got your head out of your own ass. Now piss off”

*Customer wants more spinach*
Gordon: “ ok I’ll make you more spinach *dramatic pause* and push it up your ass”

Or my all time favorite:
“You fucking donkey”

Still on the primenumbers bender.
Had this idea that if there were subtle correlations between a sufficiently large set of identities and the digits of a prime number, the best way to find it would be to automate the search.

And thats just what I did.

I started with trace matrices.
I actually didn't expect much of it. I was hoping I'd at least get lucky with a few chance coincidences.

My first tests failed miserably. Eight percent here, 10% there. "I might as well just pick a number out of a hat!" I thought.

I scaled it way back and asked if it was possible to predict *just* the first digit of either of the prime factors.

That also failed. Prediction rates were low still. Like 0.08-0.15.

So I automated *that*.

After a couple days of on-and-off again semi-automated searching I stumbled on it.

[1144, 827, 326, 1184, -1, -1, -1, -1]

That little sequence is a series of identities representing different values derived from a randomly generated product.

Each slots into a trace matrice. The results of which predict the first digit of one of our factors, with a 83.2% accuracy even after 10k runs, and rising higher with the number of trials.

It's not much, but I was kind of proud of it.

I'm pushing for finding 90%+ now.

Some improvements include using a different sort of operation to generate results. Or logging all results and finding the digit within each result thats *most* likely to predict our targets, across all results. (right now I just take the digit in the ones column, which works but is an arbitrary decision on my part).

Theres also the fact that it's trivial to correctly guess the digit 25% of the time, simply by guessing 1, 3, 7, or 9, because all primes, except for 2, end in one of these four.

I have also yet to find a trace with a specific bias for predicting either the smaller of two unique factors *or* the larger. But I haven't really looked for one either.

I still need to write a generate that takes specific traces, and lets me mutate some of the values, to push them towards certain 'fitness' levels.
This would be useful not just for very high predictions, but to find traces with very *low* predictions.

Why? Because it would actually allow for the *elimination* of possible digits, much like sudoku, from a given place value in a predicted factor.

I don't know if any of this will even end up working past the first digit. But splitting the odds, between the two unique factors of a prime product, and getting 40+% chance of guessing correctly, isn't too bad I think for a total amateur.

Far cry from a couple years ago claiming I broke prime factorization. People still haven't forgiven me for that, lol.

Workload rant.

Our new line manager is overly expecting from all of us (product/design/tech) and is micro managing on ground level without having any real sense of reality. He just wants everything to be built overnight.

He is smart, no doubt about that. But guess, I learnt from him what I had to. Not to stereotype but he is a typical Indian manager who keeps pushing boundaries.

He just added 80 features for Q1 roadmap with on 3 PMs, 1 Designer, 1TPM, and bunch of techies .

What the actual fuck! 😂😂😂 And he wanted to add more, thankfully we ran out of time in the meeting.

And my super talent and genius blabbering co-woker who works mechanically just fucked herself real bad. Lol

I kept telling her not to add Feature XYZ to the roadmap because:
1. There'll be spill over from Q4
2. She is already overloaded with 1 task and keeps crying all day about being unable to handle it
3. She is setting wrong expectations with management for herself and rest of the team
4. Boss will add more work and she'll be fucked

She was adamant and did not listen.

Now this is what happened:
1. ALL her Q4 items got pushed to Q1. LMFAO
2. She was literally crying since morning on calls for being overloaded and we are yet to start Q1 assignments
3. Additional tasks along side feature XYZ were added on her plate

I tried to push back the manager and that's when he said okay, let's keep some items for Q2.

But holy shit. 80 features between such a small team and wanted to done in few weeks.

I need to pump more steam in my job hunt activity. This place is ridiculously toxic.

Here we go again. Months have passed since this client first wanted their website launched. But because they were suddenly and inexplicably in no real hurry to make it go live, we are now waiting for them to get back to us on whether to push to Production. Meanwhile, I have bills to pay and as soon as I told them I need the check by no later than April 1st, everyone over there is no longer answering phone calls or emails. Voicemail box is full and not accepting any more messages.

I think this would be the part where I call "Big Nick" and ask him to pay them a little "visit". If I knew someone like that.

I don't know how managers are planning deadlines and counting December as a full working month!

Most companies that I worked with, count either half a month or push the deadline until the end of January when the workforce is back but not here.

Our division manager has promised the customer that the production environment will be ready on the first week of January, without even consulting the team or checking the schedule like WTF!
The person responsible for setting the infrastructure was on vacation for 2 weeks and he didn't hand over the access to production or share the progress done.
Fast forward, the manager went to slack and pinged the whole company with full caps message that the production should be done today.

Fun times :/

Me: The dev agency didn’t follow best practices. They only implemented front end validation on the form. The form submits to a public endpoint, so bots don’t have to go through our site to submit the form. That’s why our database is still filled with $1 donation transactions. I honestly recommend telling this to the dev agency and request that you not be charged for the extra work needed to do this right.

Manager: They charge $95/hr and they’re billing for 8 hours already.

[Aside: The agency’s task was to implement a $10 minimum on the form, do some text changes, and deploy.]

Me: I would expect work to be done according to accepted best practices. It’s really a half done job.

Manager: But they were very helpful when we had that payment processing emergency. They stayed late to help us. We shouldn’t push this in case we need their help again. Can you do the backend validation? [We are in US and agency is in Lithuania.]

Me: 🤬😩😑🤐[To myself: This wouldn’t have happened if the fundraising team hadn’t panicked and would only wait until I came back from my one day of PTO.]

I want to write something in PHP.

Yes, coming from me, it sounds like stockholm syndrome, but for me PHP is reminiscent of simpler times.

I want to get a server right where I bought the domain, with CPanel, log in with FTP and ~~push~~ (excuse me, _send_) index.php and other files there. I want to open phpmyadmin and throw some stupid fields together that won't work at scale, but "scale" will never happen.

I want to design websites without normalize.css, without any kind of javascript but some silly UI stuff, I want to send emails with sendmail and not sendgrid. I want my gradient buttons back.

Symphony and Laravel can kiss my ass.

Hey ranters!

I'm here to ask a huge favor.
So I used to be on the app more frequently last year, but I started to work on a shit ton of personal/professional projects. I'm not technically back to being a regular again (probably never will be), I'm back to ask all you great devs to possibly check out a platform I'm working on. It's not 100% completed yet, but I'm at that weird 90% mark where you're almost done but you start to find other interesting things to do, so I'm forcing myself to ask people to hop on it to give me that push. It's going to have some interesting (if I say so myself) features.Definitely appreciate it! (Please don't kill me over the UI/UX, I'm primarily a backend dev...but it'll definitely improve by 100% Launch)

AND ONE LAST THING....I don't have a good name for it yet so..there's that..

THANKS!

Just came back from vaccation yesterday. During sprint retrospective today I hear my team was having trouble dealing with the API layer (which was mostly written by me). Suggestion was a session where I sit and explain the application to the team ,which I have no problem with.

One of my teammates asserts that it's written in such a way that "only the person who wrote it can modify it".

Agree to disagree but whatever. This thing goes through code review everytime I push changes to it. If there was a problem I don't know why he's just discovering it 6 months into the project. I assure you there's no rocket surgery going on. The problem is that I have been doing everything on that side of the project and nobody was curious enough to give it a read sometime. In fact I dont think anything needed to change while I was on vacation, they just didn't have me to troubleshoot every problem for them like usual 😤

Day 1. Push branch. Make pull request😀
Day 5. Got reply to fix some silly stuff🤡
Day 6. Apply changes. Ask for review again.😊
Day 7. Needed to work for another project for two weeks🤝
Day 25. Came back and pull request and branch were deleted from server 🧐🧐
Day 26. I merge my local branch copy into master and push it to server. So long bitches! 💅💅

Tldr: fucked up windows boot sector somehow, saved 4 months worth of bachelor thesis code, never hold back git push for so long!

Holy jesus, I just saved my ass and 4 months of hard work...
I recently cloned one of my SSDs to a bigger one and formatted the smaller one, once I saw it went fine. I then (maybe?) sinned by attaching an internal hdd to the system while powered on and detached, thinking "oh well, I might have just done smth stupid". Restart the system: Windows boot error. FUCK! Only option was to start a recovery usb. Some googling and I figured I had to repair the boot section. Try the boot repair in the provided cmd. Access denied! Shit! Why? Google again and find a fix. Some weird volume renaming and other weird commands. Commands don't work. What is it now? Boot files are not found. What do I do now? At this point I thought about a clean install of Windows. Then I remembered that I hadn't pushed my code changes to GitHub for roughly 4 months. My bachelor thesis code. I started panicking. I couldn't even find the files with the cmd. I panicked even more. I looked again at the tutorials, carefully. Tried out some commands and variations for the partition volumes, since there wasn't much I could do wrong. Suddenly the commands succeeded, but not all of them? I almost lost hope as I seemed to progress not as much as I hoped for. I thought, what the hell, let's restart and see anyway. Worst case I'll have to remember all my code😅🤦.
Who would have thought that exactly this time it would boot up normally?

First thing I immediately did: GIT PUSH --ALL ! Never ever hold back code for so long!
Thanks for reading till the end! 👌😅

Today's task - trying to work out if the guy who set up his repository using "mane" as the main branch name genuinely can't spell, just likes horses, or is just trying to push back against the recent trend of not using "master" 😂

Hey guys! lambda is amazing! Docker containers! They said the whole amazing point with containers is that they run the same everywhere! Except not really, because lambda 'containers' are an abomination of *nix standards with arbitrary rules that really don't make sense! That's ok though, you can push your shit to fargate, then it will work more like those docker containers you know and love and can run locally! Oh wait! fargate is a pain in the ass x 2 just to setup! You want to expose your REST api running on a container to the world? well ha, you'd better be ready to spend literally 2 weeks to configure every fucking piece of technology that every existed just to do that!!!! it's great, AWS, i love it, i'm so fucking big brained smart!!!

give me a break.... back in my day you'd set up an nginx instance, put your REST / websocket / graphQL service whatever behind it, and call it a day!!!!!!!

even with tools like pulumi or terraform this is a pain in the ass and a half, i mean what are we really doing here folks

way too complicated, the whole AWS infrastructure is setup for companies who need such a level of granularity because they have 1 billion users daily... too bad there are like 5 companies on the planet who need this level of complexity!!!!!!!

oh, and if your ego is bashed because of this post, maybe reread it and realize you're the 🤡

i'm unhappy because i was lied to. docker containers are docker containers, until they aren't. *nix standards are *nix standards, until they aren't

bed time.

So at the beginning of the year I took a new job at a large, stable company. Leaving a failing startup, toxic leadership, and an absolutely stellar development team in the process. Given what's happened in the world since then, I'm overall pretty happy with the decision to have some more stability for me and my family.

That being said, I'm super bummed out (and weirdly burned out) now because I feel like I'm becoming a worse engineer.

I've worked for large organizations before (single digit thousands of employees), but never have I experienced a personification of enterprise memes like this. Leadership too out of touch, lots of bullshit work just to make worthless reports look good, horrific legacy codebases and infrastructure, you name it.

My biggest problem are the expectations are shockingly low. I went from a hyper demanding work environment where the fate of the entire company seemed to hang in the balance each and every week, to an environment where we literally invent arbitrary, bullshit deadlines and requirements so we have something to feel some stress about. And even still, most of the deadlines are laughably far away. The pace of work that's not only accepted, but praised is so slow that I find myself procrastinating more and more. I spend so little time doing any work, and even less time doing things that would pass as "interesting", that I feel like the engineering and problem solving part of my brain is starting to rot.

To make matters worse, the culture is weirdly confrontational despite the pace being so slow. The people here are _incredibly_ pedantic and will launch into 15 minute arguments over the tiniest incorrect details in a story title. Interrupting someone just so you can say what they were going to say is a daily trial. And most ridiculous of all, _repeating_ word for word what someone _just_ finished saying like it was your thought and you didn't even hear them. I don't even know what the motivation for this could be because it makes them look like total clowns.

I've tried to bring up some of the things I find ridiculous, but most everyone has just accepted them at this point and there's virtually no effort to try and make things better. I only get stupid non-answers like "obviously you've never worked at a large enterprise before". Yes I have. Twice. We didn't partake in half the bullshit that happens here.

Honestly this was all just a passing frustration for the first month or two, but 7 months in I'm starting to see myself become complacent. My current output would be absolutely _shameful_ to myself from a year ago, and even my personality has started to shift to the point that I just go with the flow and don't challenge anything.

I've stopped keeping up with tech trends. I've stopped experimenting with new things. I've tried to do more work on personal projects, but the burnout is starting to affect my life outside of work. In general I've just completely stopped trying, and I absolutely fucking hate it.

I also feel like a total tool for complaining about having a cushy, stable job where I barely have to do anything given the current world climate. But I'm more miserable now than I think I've every been in my career. Has anyone else experienced this and found ways to combat it? How do you get your motivation back once it's lost and there isn't even any pressure to regain it?

I totally blame myself for becoming part of this joke. That's totally on me for not continuing to push myself, but I never realized how much of my "drive" from the last job was coming from the high stakes we were operating under. I really just want to get back to being proud of my work and pushing to be better.

Anyway, sorry for the lengthy post. This turned out to be a weirder rant/self-roast than I intended. But I'm hoping this will be the first step to kicking my own ass back into shape.

Today, a guy contacted me on upwork to fix his iOS game which was crashing.

So I asked him to put it on github so I can clone it and push the fixes.
For some reason he said it was not possible for him to put it on github,so he uploaded it on Dropbox and sent me the link.

How the fuck am I supposed to fix that 700mb project and send it back ? Again upload it on some cloud ?

AaaaGhhhh !!!!

Long time ago i ranted here, but i have to write this off my chest.

I'm , as some of you know, a "DevOps" guy, but mainly system infrastructure. I'm responsible for deploying a shitload of applications in regular intervals (2 weeks) manually through the pipeline. No CI/CD yet for the vast majority of applications (only 2 applications actually have CI/CD directly into production)

Today, was such a deployment day. We must ensure things like dns and load balancer configurations and tomcat setups and many many things that have to be "standard". And that last word (standard) is where it goes horribly wrong

Every webapp "should" have a decent health , info and status page according to an agreed format.. NOPE, some dev's just do their thing. When bringing the issue up to said dev the (surprisingly standard) answer is "it's always been like that, i'm not going to change". This is a problem for YEARS and nobody, especially "managers" don't take action whatsoever. This makes verification really troublesome.

But that is not the worst part, no no no.

the worst is THIS:

"git push -a origin master"

Oh yes, this is EVERYWHERE, up to the point that, when i said "enough" and protected the master branch of hieradata (puppet CfgMgmt, is a ENC) people lots their shits... Proper gitflow however is apparently something otherworldly.

After reading this back myself there is in fact a LOT more to tell but i already had enough. I'm gonna close down this rant and see what next week comes in.

There is a positive thing though. After next week, the new quarter starts, and i have the authority to change certain aspects... And then, heads WILL roll on the floor.

Why is web development such a headache?

I'm writing a responsive wesbite from scratch. All goes perfect, even cross browser.
It all works, adapts to screen size etc. Nice! About to get this code into production.

Me: I'll test the iPhone 5 viewport size before I push the code...

Responsive Developer Tools:

FireFox: nu uh, there's a magic random 1px margin to every element on your page now, which you cannot find in your css or in the computed tab. It's magical.

Me: weird, what if I change the viewport size to the iPhone 6's dimensions?

Issue persists.

Me: hmm, what if I add or substract one fucking pixel from the viewport width or height?

FireFox: What 1px margin? Don't know what you're talking about ... There never was one...

Me: ok, weird (sets viewport size back to the iPhone 5 format for testing)

FireFox: I present to you: the magic random 1px margin.

I'm at a loss. I really am. Been clicking and unclicking almost every responsive part of my css I could find for this page and it just doesn't want to work persistently. And I swear to god that it worked a week ago in that exact viewport size. It's so frustrating.

It’s actually been quite a fun day, after some ranting on one of our slack communities flutter channel, myself and my team realized we were in a really good place to give back.

We have been working on a large scale flutter application for about a year, phase 1 is about done and we at 11k LOC.

We have been doing a big push for testing over the last 2 months and are at about 50% coverage. The thing we realized is that is the 1 place flutter has fallen short with documentation.

Very little about what we learned for testing our code came out of a google search, or it came out of cobbling bits together from numerous searches and sources.

So we decided we are going to plan and host a virtual meetup to discuss what we have learned and hopefully teach a few people some useful things and hopefully also learn a few new things too.

In addition, and as it has a longer shelf life, we going to setup a medium publication for the company and start a series to cover small specific topics, specific use cases or scenarios that we had trouble with and solved.

Today I had my first thing to type out, had worked out how to test that a function that was passed into a widget was called. So the parent passes the child and onTap function but you are testing the child not the parent as the child is reusable...

Anyway, so with that idea I got hold of marketing for some assets, setup the publication and proceeded to type out 3 articles today, all nice short ones under 2 min reading time.

It really is nice to give back, it’s not like I am Remi smart and can go and write BLoC, but I am smart enough to figure shit out and type it up so that the next guy hopefully benefits from my brain bashing.

Most pissed off I've ever been at work when was I attending some development meeting about the "slow progress we were making", in which the boss (same one giving us shit for being slow) came up with several new good ideas that he wanted implemented ASAP. Same thing he'd been doing all year; fucking up our plans and adding a metric shitton of feature creep. I tried to give realistic estimates for how long it would take to implement, and casually mentioned that working on this would also push back the other stuff on our plate, but he snapped at me and accused me of being a "negative influence" and "sabotaging the project", and went on in a long rant about how we didn't take the work seriously enough and that we didn't put in enough effort.

I was a hair's breadth away from flying over the table and strangling him with his keyboard cable, and the only thing that kept me in check was the tiny amount of steam I vented by snapping the pen I was holding in two. We'd been working overtime every day for months to try to meet his insane demands and accomodate him by doing all the changes and additions he wanted done, and I found his tirade - mainly targeted at me - highly unfair.

Somehow I managed to exercise restraint, and I'm not sure if he even realized what happened.

So today a drawer above my desk fell, but sadly my MacBook Air was under it, now I had a cushion based cover and a hard shell case for my Mac. However the edges of drawer penetrated the cover and case leaving a dent on the back. Which somehow means I don’t get the display but everything else is working (ie keys and sound).

Now I have to push an important bug fix and screen replacement will take at least 10-12 days.

TL;DR: When picking vendors to outsource work to, vet them really well.

Backstory:
Got a large redesign project that involves rebuilding a website's main navigation (accessibility reasons).
Project is too big just for our dev team to handle with our workload so we got to bring a 3rd party vendor to help us. We do this often so no big deal.
But, this time the twist was Senior Management already had retained hours with a dev shop so they want us to use them for project. Okay...

It begins:
Have our scope / discovery meeting about the changes and our expected DevOps workflow.

Devs work Local and push changes to our Github, that kicks off the build and we test on Dev, then it goes to Staging for more testing & PM review. Once ready we can push to prod, or whenever needed. All is agreed, everyone was happy.

Emailed the vendors' project manager to ask for their devs Github accounts so we can add them to the project. Got no reply for 3 days.

4th day, I get back "Who sets up the Github accounts?"

fuck me. they've never used Github before but in our scope meeting 4 days ago you said Github was fine...??

Whatever, fuck it. I'll make the accounts and add them.

Added 4 devs to the repo and setup new branch. 40min later get an email that they can't setup dev environment now, the dev doesn't know how to setup our CMS locally, "not working for some reason."

So, they ask for permission to develop on our STAGING server.. "because it's already setup"... they want to actively dev on our staging where we get PM/Senior Management approvals?

We have dev, staging, production instances and you want to dev in staging, not dev?... nay nay good sir.

This is whom senior management wants us to use, already paid for via retainer no less. They are a major dev shop and they're useless...

😢😭

Cant wait for today's progress checkup meeting. 😐😐

/rant

The feature was to parse a set of fairly complex xml files following a legacy schema. Problem was, the way this was done previously did not conform to the schema so it was a guideline at best, which over the course of many years snowballed into an anarchy where clients would send in whatever and it was continuously updated per case as needed. They wanted to start enforcing their new schema while phasing out the old method.

The good news is that parsing and serialization is very testable, so I rounded up what I could find of example files and got to work. Around the same time I asked our client if they had any more examples of typical cases we need to deal with, and sure enough a couple of days later I receive a zip with hundreds of files. They also point out that I should just disregard the entire old set since they decided to outright cut support for it after all if it makes things simpler. Nice.

I finish the feature in a decent amount of time. All my local tests pass, and the CD tests pass when I push my branches. Once we push to our QA env though and the integration tests run, we get a pass rate of less than 10%.

I spend a couple of days trying to figure out what's going on, and eventually narrow it down to some wires being crossed with the new vs. old xml formats. I'm at a loss. I keep trying to chip away at it until I'm left with a minimal example, and I have one of those lean-back moments where you're just "I don't get it". My tests pass locally, but in the QA environment they fail on the same files.

We're now 3 people around my workstation including the system architect, and I'm demonstrating to the others how baffling and black magic this is. I postulate that maybe something is cached in my local environment and it's not actually testing the new files. I even deleted the old ones.

"Are you sure you deleted the right files?"

"Duh of course -- but let me check..."

Of course, I just swiped the wrong way on my fucking laptop trackpad and list everything I just typed. FUCKING MARVELOUS.

TL;DR: Teacher stopped me from being productive. Principal almost called cops on me. Nearly threw chair at librarian.

So I'm at school yesterday, and we have a presenter in 2nd hour, so naturally, I'm gonna be on my computer doing things for other classes at the same time. Efficiency. Teacher doesn't like it, I refuse to put the computer away telling her that I'll be more productive and still pay attention, which HAS BEEN PROVEN MIND YOU, but she ends up calling security on me and I get sent down to the principal's office.

I talk to him, and he says 'Yeah, I know it's in the way, but you have to follow the directive given by the teachers.' Fine, fuck it. Won't go to her class for third hour. (I have her twice in a row for two different classes.) Next day.

I walk in, asking her if she's gonna do the same thing she did yesterday, hoping that she realized her error and will fix it, but no. She says I STILL can't have the computer out. I'm sorry, do you not realize I have 6 other fucking classes, most of which are required to graduate, unlike YOURS, as well as a FUCKING COLLEGE CLASS TONIGHT?! She gives the ultimatum. 'Obey or leave.' Fine, I'll leave. I go to the principal's office again, he must have a stick up his ass or something today because he's not budging. We argue for a while and he gives a WORSE ultimatum: 'Obey, Go to the Library, In House Suspension, or I'll call the police.' What the actual FUCK MAN?! You're gonna call the POLICE on a NONVIOLENT STUDENT?! Are you fucking MAD? I keep trying to tell him that there's an easy solution to this, but as he's getting up to call the cops, I say 'Fine! I'll go to the library!' He follows me over to make sure I don't kill anyone on the way.

I slam the door to the library open, and when I walk in, the librarian is there at her computer, and she asks 'Where are you coming from?' 'Principal!' 'I need a pass-' 'Well, I'm sorry, I can't exactly get anything for you right now, I was just sent down here.' She says 'Either way, I need some kind of note or pas-' 'Listen, I'm not in the mood for any of this right now. Please, just leave me be.' She then tries to say something, but I cut her off quickly, 'Just back off and leave me alone right now. The more you push it, the more you're gonna make me want to throw this chair!' Imagine the volume just gradually getting louder on that last one. She quickly runs out and talks to the security desk or something, which is right outside the library door, but she's the only one who comes in, thankfully. I was expecting to be fucking dragged out for no good reason. I'm loud, not violent. I have no history of violence.

So yeah. Here I am in the school library, angrily tapping away at my keyboard, trying not to throw the entire table to the fucking moon. All because this broken-ass public school system has no idea how to deviate from the norm when it's actually productive and efficient to do so. And now, the obligatory:

FUCKING PIECES OF SHIT WHY DON'T YOU REALIZE THAT YOU ARE COMPLETELY WRONG IN EVERY SINGLE THING YOU ARE DOING YOU IDIOTIC SCUM-FILLED MEAT SACKS OF NO FORSEEABLE VALUE! FUCK!

TL;DR: A new "process" for collaboration between teams was created in order to stonewall requests from my team.

A couple months ago, we created a new Dev team that specializes in writing internal tools. This team was staffed with internal developers, and got a separate manager. The whole point of this team was to collaborate with my dev team so we can both help each other develop tools that the company needs.

One of the developers that was on my team went over to this team while he and I were still working on a big application. For a few weeks, he still worked on this application as he normally would, and we'd sit with each other and work through features together whenever we needed a fresh set of eyes.

Well, eventually his new team got protective of him and created a new "process" for our teams to request assistance from one another. So now instead of just popping over to someone's desk to ask a quick question, you have to send an email to the team and request that you can borrow that particular developer for a question, and then the entire team sits down and discusses whether or not they're going to allow that person to answer your question. Then after a week of discussion, if they decide to allow it, they schedule a meeting for a week later, in which you will get the question answered.

So instead of just spending 2 minutes to ask and answer the question, you have to spend weeks in order to request assistance, and then schedule a meeting.

It's ridiculous, and it's all because his team got protective that he was working with another Dev team. Dev teams collaborate all the time, and work together. My team is constantly helping other teams, and we don't have this ridiculous process. We get asked a question, and we answer it. Simple as that.

Last week, I sent an email for assistance in completing a feature, and didn't hear back. I talked to the Product Owner for the team, and he said "Just send an email," to which I responded that I did and hadn't got a response. He said "Oh....." I then told my boss that this is an enormous bottleneck, and he seemed surprised hearing that this is a bottleneck.

A week passed and today I still hadn't got a response, so my boss reached out to the Product Owner to push him. Finally, I got a response and they scheduled a meeting to answer my question 3 days down the road. So it's going on 2 weeks to get this simple question answered.

Normally I'd just have the other developer come over and help, but apparently they yelled at him the last time he did that.

The issue is that the process was created with the assistance of our "senior" developers, who never work with this other team in this capacity, so they just nodded and smiled and let them put this ridiculous process in place.

Like, get off your high horses. You don't "own" him, he's allowed to collaborate with other teams. This question would've taken literally 10 minutes, but because of your new "process" you've turned it into a 2 week debacle and you've effectively delayed the app launch with your pettiness.

They say that this process isn't intended to prevent us from getting assistance, and that might not have been the original intention of the Product Owner/manager, but it's very clear that the developers on the other team are taking advantage of it and using it as a big stonewall so they can beat around the bush and avoid providing assistance when it's needed.

If this becomes a trend, I'm going to schedule a meeting (which apparently they love to do,) and we're going re-work this entire process, because it's extremely counterproductive and seems to only exist in order to create red tape.

My first rant. Woohoo!

Honestly I do the whole shebang ussualy depending on what the needs are from network to servers to coding because for some reason nobody has any technical experience where I work.
I just started app development for a gamedev startup and I am in sheer awe of the amount of transpiling/compiling etc that needs to be done for an multiplatform app for iOS and android with js(x)/typescript, html, css.

I remember when I could just write some spaghetti code to make it working by following a couple of tutorials. Then refractoring and testing it for a couple of hours and be done with it. push it into production.

Now I am lost having to learn OOP, functional programming, reactjs, react native, express, webpack, mongodb, babel, and the list goes on and on...
Why not just make a new backend that does all of that in another language which supports all of that.

I have no formal education in programming/coding and the last time I learned JS it was just some if else, switches and simple dom manipulation.

I just want to get to coding a freakin' game but I have to learn JSX for the front and typescript on the backend.

I am this close to going back to ye ol' lamp stack and quitting this job. 😥

Multi User, One Account, and other shit

I'm gonna rant about something as a user, and someone who makes stupid web stuff.

My bank has been updating their web banking over time and they decided that every individual on an account, should have their own login. They really want to push this on their users, I suspect specifically folks like me and my wife who share one login for the joint accounts we have at the bank together.

Why share one login, because it's the only sure fire way I know that I and my wife can see all the same shit no doubt about it.

The banks never tell you what you can see or can't with joint accounts, I doubt it is even documented on their end, but in every damn case something is hidden or different in some weird way.

Messages to the bank people? If I send it, my wife often can't. I get that for security reasons that's a thing, but it makes no sense for a joint account.

ANY difference to me breaks online banking ENTIRELY. Joint accounts are supposed to be... well one account that is the same.

Other banks we used where we had different logins for the joint account, each login actually had separate bill pay accounts per user. So if I went to bill pay and scheduled something to be paid, my wife had no idea, same if she did.

Right fucking there, banking is just broken entirely!

So no Mr. Bank, fuck you we're both logging in via the same login.

Fast forward to N00bPancakes making a thing.

So my employer has a customer (Direct Customer). Direct Customer wants a thing that makes communication with their customer (Indirect Customer) easier.

The worst thing about making something for your customer's customer is that Direct Customer always imagines that Indirect Customer is gonna be super ninja power users....

But no, that's not the case... in fact almost nobody is a power user, and absolutely nobody WANTS to be a power users.

Worse yet in my case the only reason this tool exists is because Direct Customer and Indirect Customer can't communicate well enough anyway... that should tell you something about the amount of effort Indirect Customer is willing to expend.

So with that tool, this situation constantly comes up:

Direct Customer thinks it would be great if every user from Indirect Company had some sort of custom messaging, views, and etc in of Cool Communication Tool. The reason is because that's what Direct Customer loves about Ultra Complex Primary Tool that they use ....

Then I have to fight the constant fight of:

NOBODY WANTS TO BE A POWER USER, NOBODY EVEN WANTS TO DO MUCH OF ANYTHING ON THE INTERNET THAT ISN'T SCREAMING AT OTHER PEOPLE OR POST MEMES OR WATCH SHITTY VIDEOS. THE MOMENT ANYONE AT INDIRECT COMPANY LOGS IN AND SEES ANY INFO THAT IS DIFFERENT FROM THEIR COWORKER THEY'LL SHIT THEMSELVES, FLOOD EVERYONE WITH 'OH GAWD SOME NON SPECIFIED THING IS WRONG' AND RESPOND TO EMAILS LIKE A JELLYFISH DROPPED OFF IN NEW MEXICO... AND NOTHING WILL GET DONE!!!

God damn it people.

Also side rant while I'm busy fighting the good fight to keep shit simple and etc:

People bitch about how horrible the modern web is and then bitch at web devs like we're rulers of the internet or something.... What really pisses me off about that is other devs who do that.... like bro, do you make policy at your company? You decide not to sell some info or whatever shit your company sells? Like fuck off with your 'man I miss html' because you got scared by some shitty JS error and ran back to your language of choice and just poked your head out of the the basement and got scared... and you shit on another developer about that? Fuck you.

Below is a transcript from work Slack today. Only the names and some code are changed. It ended up causing a bit of drama. DevRanters, what do you take from this?

---

Delivery Lead:
Hey Gang. What's the blocker for FEATURE-123?

Dev1:
FEATURE-122 crashed on iOS app when viewing Feature Introduction page.

Teach Lead:
I've talked about this with Dev1 on a side channel.
And diagnosed the stack trace.
It looks like there is/was some bad handling of a List in the Feature Introduction view logic.
But this is confined to changes that Dev2 is still working on.
(It's not present in master)
Dev2, what's your current position on this?

Dev2:
I have tested at my end with Dev1 but it seems to be working fine

Tech Lead:
There is a race condition related to the use of someList.first()
My guess is that theres a Flow of those lists defined, with an initial value of emptyList
And that on your machine, that Flow is updating with a new value quickly enough that it doesn't matter.
But on Dev1's, for whatever reason, it doesn't get there in time, hits the empty list and falls over.
The logic that's performing the first() needs to gracefully handle empty lists as well.

Dev2:
Where is that logic called?

Tech Lead:
Here's the stack trace Dev1 provided in our conversation earlier:
Caused by: kotlin.NoSuchElementException: List is empty.
...
at 3 iosApp 0x00000000 kfun:kotlin.NoSuchElementException#<init>(kotlin.String?){} + 00
at 4 iosApp 0x0000000 kfun:kotlin.collections#first@kotlin.collections.List<0:0>(){0§<kotlin.Any?>}0:0 + 000
...
at 9 iosApp 0x0000000 kfun:kotlin.coroutines.native.internal.BaseContinuationImpl#resumeWith(kotlin.Result<kotlin.Any?>){} + 0000

This line:
kfun:kotlin.collections#first@kotlin.collections.List<0:0>()
...says that it's first() being called on an empty list.

Dev1:
FYI: Dev3/Dev4/myself are seeing the same issue with the same stack-trace above.

Tech Lead:
So Dev2, have you introduced such a call?
Because I checked master branch and there isn't one, in that version of the file.
Ok, I'll check your working branch Dev2
...
Yes you have here:
var processed1 = someList.first()
var processed2 = someList.first()
...
Lines 123, 124.
Solution looks really straightforward guys.

Dev2:
Okay, I will fix that and push the change

Tech Lead:
Check if someList is empty and allow for generating / handling null processedValues in the view.

Now; I'm going to be straight with you here.
This issue has been discussed over several hours today.
I expect that either one of you could have gone through the process I did in the last 10 minutes above, and resolved it in the same way :point_up:

Dev2:
I went on a break and it's not reproducible on my machine

Tech Lead:
I didn't reproduce it on mine either.

Dev1:
Dev2 and myself are now on sharing screen to sort this issue out. Hope to update back later.

Tech Lead:
<Screen shot of diff with changed code>
:point_up: That change should do it.

Dev2:
Already have pushed the change.

Tech Lead:
...just seen it, is good - same approach :ok_hand:
Dev1 please let us know when tested on your machine.

Dev1:
That does it. It fixes the issues. Thank you, Dev2. I will pick it off from here.

Tech Lead:
Glad to hear it guys.

Dev1:
I have to say this that it is not because we are not working on the issue - Dev2 and myself (together with Dev3/Dev4) have been on this issue all this morning. It just difficult to connect the dot when it wasn't reproducable on Dev2's machine. I brought the issue up because I wanted to switch to working on other tickets while waiting for this to resolve. Still thank you largely for Dev2's work and your keen eyes that spot and resolve the issue quickly.

Tech Lead:
Noted Dev1.
I think the take-away has to be to read the stack-trace carefully... don't worry - we've all been guilty of not reading the error in full, at some point.
The stack trace said that the 'first' element is being referenced from an empty list - that's just logically impossible, right?
Looking for that call to first, we saw it wasn't in the code before, and is after (two of them, in fact).
So then we ask ourselves, how can we deal with an empty list - and then solution almost presents itself.
It didn't really take reproduction of the error to resolve.
Maybe working with a new tech stack creates an anxiety that every issue faced will have a complex solution related to that stack; but I think you'll agree, this particular issue really just required a deep breath and your trusty 'debugging skills 101'... don't lose them! :smiling_face:

I turned down another women who was absolutely, 100% flirting with me, because, from what I can gather, she was trying to get out of a relationship with her current boyfriend, a military veteran.

I outright ignored her and then when that failed, I made our work relationship 100% about that, work.
Even though I'm friendly with everyone else.

I'm an absolute shit, aren't I? I feel genuinely bad.
I'm not sure if I did it out of a misplaced sense of honor for a dude who obviously has some ptsd, or because I don't feel like I'm able to connect with anyone anymore.

I feel like I'm alone in this world. Not, like, sexually or anything, but more like I don't want to burden anyone with the shit I'm going through. Like a man on a mission on a sinking ship, and it would be wrong to let anyone else on board.
Like a one-man shit-show, all singing, all dancing, driven to one end, with one purpose. And it'd be wrong to let anyone get attached, or invite anyone else in.

Fuck I got so many irons in the fire. I have an ARG in the works, a full game, a social platform that the code and marketing plan is laid out and I'm saving money for, two more games already planned, plus spending an in-ordinate amount of time with my father and sister and mother as they deal with the loss of my sister, plus volunteering to help the homeless, plus working, plus studying.

I barely sleep.

It's just me. I'm like a cruise missile heading to one destination, to some final destination, I just don't know what. And I don't let anyone in, because then they might see how fucking crazy I am, and how crazy my life is, and how crazy my goals are. Thats not a humblebrag. Thats more of a "wholly shit, I'm so in over my head, I'm fucking drowning" type thing. But I'm not giving up, I'm just going deeper.

And it feels like drowning but somehow I'm okay with it. Like I've passed the crux of loneliness, and settled for going for it all, alone, shooting out of orbit, and saying "fuck it all' to everything and everyone. They say "if you got everything you wanted, everything you wished for, you'd wish you hadn't, which is why god isn't a genie". And lately I've been thinking god doesn't exist, or doesn't care, because he's left it all up to me, and I've fucked it up good and proper, and am on my way to either nothing, or everything I've ever wanted.

Is this what happiness feels like? Or suicide?

I don't know. I mean I really don't. I don't want to die. I think I could stop existing and be okay with it. Having achieved at least a modicum of understanding the universe, at least accomplished something small but meaningful.
Or maybe I'm delusional, driven mad with the full comprehension of human floundering against a meandering existence.

I don't fucking know.

I feel like I'm spinning my wheels, so much, that even two weeks feels like a fucking eternity. I don't sleep anymore. When I do, I escape into my dreams, where I can fly, or float, and the people in my dreams tell me I'm living in the matrix and I believe them..in my dreams. Feel it even.

And when I wake up, the feeling persists. Leaves me in wonderland, for hours after waking.

And I have visions, of going homeless, like some buddha, all the time, and then I say "wake up J, you're fucking crazy! You want to go be some couch surfing homeless bum living off other's good graces? get the fuck outa here! While others suffer, schlep it at whatever job they work, day in day out, toil. In this economy? In this inflation? What a dishonest way of thinking. What a dishonest way of dreaming."

And yet I daydream. Because its the only escape there is from all the world has become.

And I bring joy to others, earnestly, vicariously, because its the closest joy I can feel, when I've become numb.

It is this quasi-permanent sense of alienation that permeates my whole world, a sort of invisible force field that separates me from others, even as I reach out to understand them, to comfort them, to smooth the corners off their world, so that they don't become like I have, something not entirely human, but...other.

Often when we meditate, long and hard enough,
at the center that emerges, at the center of ourselves, we find an abyss, a whole universe, devoid of anything, a perfect silence, mirroring back the cosmos, and other people. Observing, silent, irreducible, implacable.

Sometimes I feel like I don't exist. Sometimes I think others don't exist.

Very often I feel like nothing is real. And that I am playing some sort of game. Not like a video game per se, but that there is a bigger pattern, a hidden pattern to it all, just out of reach, and I'm reaching for it but understanding eludes me.

Not that the universe has made me for some special purpose, but merely that the universe observes me specifically, for no special purpose, other than that it can, whatever trivialities may impede or push forward my life.

As if the universe were bored.

Push the due date back

Started a new job as junior developer. One of my first task was to sent a simple notification on an event in out product. Write the code, test that it works, push to devops.

Code compiles, tests pass, it’s deployed to internal test env. Check that my notification works in the test env. No problem.

It’s deployed to the customers test environment. It works and customer accepts it for prod.

We release to prod and of course it fails. Seems to be a simple string.Format that fails for god knows why. After 3h of debugging on prod without success we decide to roll it back.

Today we decided to try it on a backup of the prod db since one of the strings was taken from the db. Still working. No matter what data I input when trying it locally it still wont reproduce the issue we saw on prod.

Fuck this

> Tries to be slightly festive by making a ball drop website on my phone using an app called play.js (its an app that lets you play around with nodejs, react native and react)
> Make some progress
> Gets tired of phone keyboard once back at the house so tries to upload to GitHub
> app makes a repo by default so when I made a new GitHub repo it had a different .git history, so i cant push to it
> copy files manually
> JavaScript happened
> Deletes code off pc and deletes GitHub repo.

First rant here..

So earlier this week, on a php Laravel project, I created a set of nice new features.

The code is tested, locally all fine, I push to Github, circleCi kicks in and double checks myself, still everything green. (Just for a not, its a private project so only I work on it.)

I go ahead and merge, deploy to staging and continue on my next ticket, which is a very small one.

I call it the day, next day I pick back up where I left, test locally, all green, push... then circleCi says no.

I spend 2 days debugging, trying to figure out what is wrong without advance. I just push develop branch again, guess what also failing.

I leave it for the day as I already spend enough time on it.

This morning, I simply do a composer update, push and everything miraculously starts working.. even if there were no changes in the working branches.

Im so mad right now, and this is going in my "try this before you debug a ci" book..

Spent two hours explaining to an intern the basics of version control and why you must always commit and pull before you push. He claims he understood how it worked. I come back the next day only to see my code was overwritten because he pushed and never pulled.. I get yelled at by my boss because he can't see the changes I made and assumes I was slacking off the previous day :/

I’m almost 49, which is now considered “old” by most tech companies if you’re just a lowly staffer. If I can manage to stay employed until I can afford to retire, my goal is to just push through in whatever job in the industry (or even out of it) I can manage to do. Learning and being proficient with zillions of languages and frameworks like all these job postings want is impossible for me. I’m trying to figure out a way to work in some aspect of the commercial spaceflight industry without having to go back to school for an engineering degree and clawing my way up again. If that means being a janitor at SpaceX or Blue Origin, I’m fine with it. I’m done with ladder climbing and ass kissing.

fucking permissions

I wrote a whole custom node js project because an exec wanted to see this tool work a certain way, I’m an iOS dev but I got it done the day he asked, and when I went to push it I realized I didn’t have the right account permissions. This service has “add-on roles” for accounts and I’ve had to ask for them before, so I went to that guy and he never responded. Then he went on vacation.

This morning I mentioned it in standup and my lead recommended I reach out to his boss, which sounded great bc we have an even better rapport than I do with the other guy.

His boss first said “that sounds reasonable” and then proceeded to TALK HIMSELF OUT OF IT and tell me to either find someone else to upload it for me or sit on it til the other guy gets back from vacation.

Does this ever end? Bc I used to chalk it up to first-year dev probs but we’re coming up on 5 years now and I don’t know what I did to deserve this torture

I deployed one of our staging websites to a free plan because the site is rarely used. Project Manager sends the stakeholders the new url. There will be a lot of 🤦‍♀️🤦‍♂️🤦 all around. Some of it’s my fault. A lot of it is just WTF.

Stakeholder: We still need the staging site because we don’t want to test in the live site…

PM: Okay. We didn’t say we were deleting the site. We are just moving it to a new and better hosting platform, so we’re letting you know the url has changed.

Stakeholder: This url is for the front facing page. How do I access the backend? [they mean the admin interface]

Me: The only thing that’s changed is the url for the staging website. So domain-A/account is now domain-B/account.

I thought that was a pretty straightforward way of explaining things, that even a non technical person would get it. They took the /account example as the literal login url.

Stakeholder: I forgot the password for our admin login and I submitted a password reset, but I realize I don’t know if I have access to the admin email. Or if it’s even a real email account.

WTF

I look back at the email chain and I realize that I gave the PM the wrong url.

Also, WTF x 2. How did this stakeholder not realize they were looking at the wrong website?? There are definitely noticeable style and content differences. And why would you have an admin login that uses a fake email??

Me: My apologies. I sent over the incorrect url. My instructions are mostly the same. All that’s changed is the domain.

Stakeholder’s assistant: [DMs me] How do we access the backend?

WTF…are they seriously playing this game and demanding I type out the url for them?! 🤬 I’m not playing this game and I just copy and paste the example that I already sent over.

They figure it out eventually. Apparently, they never used /account to login before They used /admin/index… but that would still bring them to /account, but with ?redirect=/admin/index appended to the url if they weren’t logged in. Again, WTF.

I know I made mistakes in this whole thing, but damn. I can’t even. I’m pretty sure this whole incident is fueling my boss’s push to stop supporting this particular website anymore so I can focus on sites that actually bring in revenue…and have stakeholders that aren’t looney and condescending like this.

For all the cheap-ass sys admins:
I wouldn’t pay 100$ a year to apple just to have push notifications when my server fucks up or an user fill my support form but I want to know that in real time but I have iPhone(forget about FCM).

So I downloaded pushbullet to my phone and integrated its API in my server and when something important happen I get completely free notification which (thanks to url schemes in ios) redirect me to my server administration app.

Note: I used xamarin for my management app to be ready for the moment when I switch back to android.

This is PART 2/2 of a series of rants over the course of a software engineering course years ago.

We were four team members, two had never failed a class, I’ll refer to them as MT and FT, male and female top students, respectively, and an older student with some real world experience who I’ll refer to as SR.

Rant 6: After the previous drama MT built the groundwork for the project without allowing us to intervene for a week. When he finally disclosed his code he gave us tasks and I was stuck unable to run the new project, due to the friction with MT I asked SR for help which took a couple of days. MT accused us of not wanting to work and claimed he’d just do everything himself. I continued working on the task improving MT’s code and committed the work, which surprised MT and told me I didn’t have to do it. He ended up complimenting my code and complained less about me as a result.

Rant 7: MT kept giving SR flak for not working and took him out of the repo, which I promptly forked just in case he tried anything scummy. SR was indeed working on certain things, but he wasn’t listening to MT’s demands, there was no team coordination. I had to act as a proxy and push some of SR’s changes myself while informing him of the state of things.

Rant 8: When MT finally added SR back and some of the tasks were cleared up, FT didn’t cooperate. She seemed to have zero initiative and always relied on MT to tell her what to do, which didn’t include coordinating with SR to get the front-end templates running. I tried getting them in a group chat but it didn’t work, she just ignored him.

I learned a few things from that.
1. No matter how smart or experienced someone may seem, sometimes people are just petty or take things too personally.
2. Top students are sometimes too focused on their grades and disregard depth of knowledge and work quality.
3. A bad team at college can somehow make something acceptable if everyone works on things that add some kind of value.

Long story ahead

Background:
I recently started a job in a smallish startup doing web development in a mostly js stack as an entry-junior engineer/dev. I’m the only person actively working on our internal tools as my Lead Engineer (the only other in house dev) is working on other stuff.

Now I was given a two week sprint to rebuild a portion of our legacy internal app from angular 1.2 with material-ui looking components with no psd’s or cut-outs of any kind to a React and bootstrap ui for the front end and convert our .net API routes into Node.js ones. I had to build the API routes, SQL queries (as there were plenty of changes and reiterations that I had to go through to get the exact data I needed to display), and front end. I worked from 9am until 11pm every day for those two weeks including weekends as our company has a huge show this upcoming week.

I finish up this past sunday and push to our staging environment. The UI is 5.5/10 as we’re changing all of our styling to bootstrap and I’m no ui expert. The api has tests and works flawlessly (tm).

So we go into code review and everything is working as expected until one tab that I made erred out and was written down as a “Needs to be fixed.”

This fix was just a null value handler that took three minutes and a push back to staging, but that wasnt before a stupendous amount of shit being flung my way for the ui not looking great and that one bug was a huge deal and that he couldnt believe it slipped through my fingers.

Honestly, I’m feeling really unmotivated to do anything else. I overworked myself for that only to be shit on for one mistake and my ui being lack-luster with no guides.

Am I being a baby about this or is this something to learn from?

go fuck yourself with your fucking communities. i went into computing because i like being left alone. who are all those fucking freaks building their communities? this is capitalism mother fuckers, everybody in the world agreed on it, on each person being an independent individual doing their job to the best possible standard, instead these low-skill low-iq oversocialised sheeple started conglomerate into communities and brainwash everybody that this is what it is about. get stuffed alright. all my life i've been introverted, just leave me alone to write code alright? take my library i don't mind i'll take yours no strings attached, just push the code and forget about it. but no, all these degenerate morons without CS degrees have occupied our safe space, pushed us out of it and just can't get enough of using the buzzword "community-driven" "volunteers" volunteer my ass assholes you can't even make software nobody in real industry needs you because you have no skill at all you learn a bit of js which is any 14-15 yo can do and now think you're some kind of prodigies, unsung heros of humanity who selflessly bring the progress. nothing can be further from the truth - because of you we don't have real software, we don't have investment we don't get no respect everybody walks all over software engineers treating us like shit, there's an entire generation of indoctrinated parasitic scum that believes that software tools is grown for them on trees by some development teams that their are entitled to automatically, because some corporation will eventually support those big projects - yeah does it really happen though - look at svelte, the guy is getting 50k a year when he should be earning at least 500k if he had balls to start a real businesses, but no we are all fucking prostitutes, just slaving away for the army of people we never see. are you out of your mind. this shit should be fucking illegal alright it's modern day slavery innit bruh, if a company wants to pay their engineers to work on open source this is fine, i love open source like java or google closure compiler, but it's real software made by real engineers, but who are all these community freaks who can't spend a 10 seconds on stage in their shitty bogus conferences without ringing the "community" buzzer? you're not my community i fucking hate your guts you're all such dumb womenless imbeciles who justify their lack of social skill by telling themselves that you're doing good by doing open source in your free time - mate nobody gives a shit alrite? don't you want money sex power? you've destroyed everything that was good about good olde open source when it was actually fun, today young people are coerced into slavery at industrial scale, it's literally impossible to make a buck from software as indie unless you build something really big and good, and you can't build anything big without investment and who invests in software nowadays? all the ai "entrepreneurs" are getting fucking golden rained with cash while i have to ask for a 5$ donation? what the actual fuck? who sanctions this? the entire industry is in one collective psychotic delusion, spurred by microsoft who use this army of useful idiots to eliminate all hounour dignity of the profession, drive the abundance and bring about poverty of mind, character, as well as wallet as the natural state of things. fucking amatures of course you love your shitty little communities because you can't achieve anything on your own. you literally have no personality, just one homogenous blob of dumb degenerates who think and act all the same. there used to be a tool called adobe flash builder, i could just buy it, then open and make a web app, all from start to finish in one program, using tutorials of adobe experts on youtube, sure it might have had its pitfals but it was a product - today there's literally no fucking product to make websites. do you people get it? i can't buy a tool that i need to do my job and have to insult myself by downloading some shitty scripts from some shitty unemployed devs and hope my computer doesn't blow up in my face in the process because some freak went off his nut and uploaded some dodgy ass exploit on npm in his package. i really don't like. it's not supposed to be like that. good for me i build by own front/back end. this "community" insanity is just a symptom of industrial degeneration, they try to sell it to us like it's the "bright" communist future but things never been worst, i can't give a shit about functional programming alright i just need to get my job done mate leave me alone you add functional because you don't know how to solve the problem properly, e.g., again adobe flex had mxml where elements had ids and i could just program to id, it was alright but today all this unqualified morons filled the whole space after flash blew up and adobe execs axed flash builder instead of adapting it to js runtime, it was a crime against humanity that set us back to 1000s

So arround a month back , I was watching videos and photos I clicked in the vacation I went.
All the photos and videos were in a 1TB harddisk and I connected to my TV for better viewing experience.

In the mid way, I had a power cut and suddenly TV switched off.

This was not supposed to happen because my inverter has to kick in !
Fuck it , something happened to my inverter and delay was just enough to switch the TV off.

Now TV is on , harddisk is recognised and
Hell yeah! There are no files in the harddisk!
I lost my shit !, Before I do any thing, I tried to recover the files, luckily some vacation images and videos were recovered but all of my project source code(the ones I Did not push it to github, those were done when I was learning), most of my documents etc.. were gone!

May not be the worst one , but I lost all my coding memories.I mean those projects were done in my school times.

Debugging WebRTC is pure hell.

For starters, it's JavaScript, so you know this isn't gonna end well. Second, it's still in kinda beta phase for some browsers so you gotta add polyfills. Let's talk compatibility now. During normal days, yeah, I could ask for a couple of computers in the office, each using a different browser. But, covid. One browser mishbehaves and doesn't wanna share the camera with the other browser, so I can't really test a connection with the only 1 computer I have. I can't take my partner's computer all day to debug.

Solution: ask the marketing department or even the execs to video chat with you to test it on a staging server. So I push my changes to the server, wait for them to build, call my lab rat, check all the bugs, clean the code, push the changes back up. No fancy breakpoints. I'm doing the old style like my great uncle did. Oh wait no, he was pretty intelligent, but my lab rat isn't. They probably don't know what a console is. So no baby I'm not only talking about console logging the problems, I'm talking `alert` the heck out of the bugs - okay no, I'll just display the objects in the middle of the screen. The screen is my console.

As a new freelancer I didn't have much clients , so I paired with a web designer +10 years exp. who work with me as a pm and that was a bad decision.
Although I am a back-end dev , half of the projects were frontend/WordPress theme (less price than back-end projecrs) - so 30% of the projects were cancelled .
sometimes I receive project's which have requirement, like magento, I don't know anything about ,
I tried to push myself but I burned out after six month.
he deals with clients, partner with other companies ,and I don't know anything about the terms.
at the end I was like an employee without any benefits from his company .
moreover I get my money after 45 day!!!
and not all my money .
this is a project I work for another company through him
A requirement for mobile back-end server was integrating with parse and that was my first time working with Facebook parse so ....
after two weeks ..
we received email from parse that they'll shutdown their service after a year .

so we moved to Amazon sns again my first time working with aws .
at the end I can't charge for extra money but my pm became a gold partner for that company .
the only thing that made me hold is that I need some high quality projects for my c.v.
-----------
he didn't show on hangout because I need my money .
this will be my last project with him.
wow I write too much ... I feel better now .😥

PC setup upgrade

I'm making baby steps, at least I can boast of a very standard PC and write code in peace and use all that screen real estate to my advantage

looking back at two years ago when I was crying and begging my parents for just a core 2 duo laptop that I could learn programming with,

now I almost have all that is needed and an even stronger drive to push my limits and become a better programmer

yes, the kind of PC makes a lot of difference when writing code.

I'm still unemployed and relying on small side contracts but it's still a big step and a consolation for me when I consider the crap I have been through for years

I'm not stopping, higher we go

On the MSc I was participating in, there is a teacher that has a lesson about Databases.

The MSc was not only for experience computer science students. We were informed that the first semester would be as an introduction to all.

So, Databases. No introduction at all. Just read the powerpoint and the pdf he had just translated (or not, because some were just from the internet), just refers to how they are structured briefly. He showed everything about Databases without the students that didn't know much to be involved (we didn't get to our lab for some reason) and then there was his assignment.

His assignment was written as it would be from a customer that knows shit about Databases (sorry but I had to rant). We sat down student's that knew already Databases and some of us worked as database engineers. We agreed on some steps that after read the next chapter of the assignment we reconfigured them. And so on, until we had nothing and we were back at the beginning.

Needless to say, I did not lose my Christmas holidays for him. It took me 2 days after to build a database that was not a full solution but a part (I wad noy sure, the assignment was ambiguous). I passed the lesson with the minimum passable grade.

So, I wrote a nice email to the MSc teacher that had to organize it (or something like that). I did not swear at all. I was professional and wrote what I encountered and what it should have been. The Databases teacher had always that smirk and face that he was THE boss and had no respect for his own lesson. But I didn't mention it. The organizing teacher shared the email with the databases teacher.

And the time came that we had another lesson (web development, it was awful under him) with the databases teacher. And he had the wonderful idea to read the email out loud in front if everyone. He did noy mention my name. I raised my hand and told my colleagues it was me. Then I asked him in front of them, if he was contented with the results (only a few passed the databases lesson and max grade was the smallest passable), first he avoided the question. I asked again. And he said yes. We all looked at each other and somehow knew. No one spoke and I didn't push because I didn't want to take the web lesson's hours for this. It was just hopeless.

From there on, the teachers said we were their best class ever but the most complaining one. They didn't even bother to analyze the "complaints".

So, there you go. One of the lot of those teachers.

Job review time,
(just a random pick from the a list).
---
"Engineering Lead"
Translation: "Chief Calculator Officer"

"Anyone can design or spec a product, get it manufactured overseas and get it to market. But will it be good? Will people buy it?"
Translation: "We're looking for a miracle"

"Take on a top notch team that is going places in Electronics, R&D and advanced product development."
Translation: "Professional Excel engineer wanted"

"This company is a little-known success story that has been operating for over X years, making mission-critical electronic equipment for use by consumers, professionals, government and industry."
Translation: "Design weapons and tamagotchis."

"Working as part of the Senior Leadership team, you will have charge of the I.P. engine and product development team spinning up new ideas and throwing them out the door."
Translation: "You're success is our success. Your failure is your failure."

"The Role
- Generate New Ideas
- Push for new products
- Drive manufacturing
- Manage a cross disciplinary team that includes Electronics, Software and Mechanical
- Project Manage new projects to completion
- Interact with marketing and sales to drive results"
Translation: "We've never hired one person to be a whole team before but we think it will work."

"On your first day, we expect:
- Strong Leadership experience and skills
- Solid Engineering Fundamentals
- Experience taking new and existing products to market
- Experience with manufacturing high-tech, mission critical equipment
- Commercial Acumen
- Bachelors in Electrical or Electronic Engineering"
Translation: "We expect you know where to hide the drugs already."

"Nice to have:
- Experience with Defense or Medical Systems
- R&D background
- MBA, B. Commerce or similar"
Translation: "By clicking on this job ad your background check is already under way."

"In return:
- A loyal and oustanding team will be there to support you
- Extremely knowledgeable experts to guide you
- Incredibly smart founders to mentor you
- The opportunity to work on a real product
- Extremely generous salary package"
Translation: "Our last dev has removed the Warrant Canary. Can you pleeease put it back?!"

Working for a startup building a device / app that let you answer your landline phone on your mobile, and get notifications of missed calls etc.

While developing I purposely didn't secure the endpoint that controlled push notifications.

I waited for the boss to sign up, went to the DB and stole his token. From time to time i'd send a request telling him he missed a call from his wife or son.

... then kicked back and watched the madness and frustration ensue.

To me this is one of the most interesting topics. I always dream about creating the perfect programming class (not aimed at absolute beginners though, in the end there should be some usable software artifact), because I had to teach myself at least half of the skills I need everyday.

The goal of the class, which has at least to be a semester long, is to be able to create industry-ready software projects with a distributed architecture (i.e. client-server).

The important thing is to have a central theme over the whole class. Which means you should go through the software lifecycle at least once.

Let's say the class consists of 10 Units à ~3 hours (with breaks ofc) and takes place once a week, because that is the absolute minimum time to enable the students to do their homework.

1. Project setup, explanation of the whole toolchain. Init repositories, create SSH keys for github/bitbucket, git crash course (provide a cheat sheet).
Create a hello world web app with $framework. Run the web server, let the students poke around with it. Let them push their projects to their repositories.
The remainder of the lesson is for Q&A, technical problems and so on.

Homework: Read the docs of $framework. Do some commits, just alter the HTML & CSS a bit, give them your personal touch.
For the homework, provide a $chat channel/forum/mailing list or whatever for questions where not only the the teacher should help, but also the students help each other.

2. Setup of CI/Build automation. This is one of the hardest parts for the teacher/uni because the university must provide the necessary hardware for it, which costs money. But the students faces when they see that a push to master automatically triggers a build and deploys it to the right place where they can reach it from the web is priceless.
This is one recurring point over the whole course, as there will be more software artifacts beside the web app, which need to be added to the build process. I do not want to go deeper here, whether you use Jenkins, or Travis or whatev and Ansible or Puppet or whatev for automation. You probably have some docker container set up for this, because this is a very tedious task for initial setup, probably way out of proportion. But in the end there needs to be a running web service for every student which they can reach over a personal URL. Depending on the students interest on the topic it may be also better to setup this already before the first class starts and only introduce them to all the concepts in a theory block and do some more coding in the second half.

Homework: Use $framework to extend your web app. Make it a bit more user interactive with buttons, forms or the like. As we still have no backend here, you can output to alert or something.

3. Create a minimal backend with $backendFramework. Only to have something which speaks with the frontend so you can create API calls going back and forth. Also create a DB, relational or not. Discuss DB schema/model and answer student questions.

Homework: Create a form which gets transformed into JSON and sent to the backend, backend stores the user information in the DB and should also provide a query to view the entry.

4. Introduce mobile apps. As it would probably too much to introduce them both to iOS and Android, something like React Native (or whatever the most popular platform-agnostic framework is then) may come in handy. Do the same as with the minimal web app and add the build artifacts to CI. Also talk about getting software to the app/play store (a common question) and signing apps.

Homework: Use the view API call from the backend to show the data on the mobile. Play around with the mobile project to display it in a nice way.

5. Introduction to refactoring (yes, really), if we are really talking about JS here, mention things like typescript, flow, elm, reason and everything with types which compiles to JS. Types make it so much easier to refactor growing codebases and imho everybody should use it.
Flowtype would make it probably easier to get gradually introduced in the already existing codebase (and it plays nice with react native) but I want to be abstract here, so that is just a suggestion (and 100% typed languages such as ELM or Reason have so much nicer errors).
Also discuss other helpful tools like linters, formatters.

Homework: Introduce types to all your API calls and some important functions.

6. Introduction to (unit) tests. Similar as above.
Homework: Write a unit test for your form.

(TBC)

"It is pointless to use just a fraction of the data in a homologation environment"
Those words reveal the truth in our creed.
We work in the deepest of back-ends to serve the front.
No data is true. Everything can be edited.
We are Data Engineers.

And for those words to take hold, a junior must execute a leap of faith, and push a hotfix into production.

So the project I work on basically has to talk to a 3rd party plugin, through a 3rd party framework. The 3rd party plugin is a black box. This conversation happened:

Software guy: so we aren't sure what is breaking the thing. It's either us or the plugin, but it's probably both.

Systems guy: well then if we aren't sure then why are we writing an issue for it.

SWG: because we aren't sure but we know we are doing at least something that contributes. We read int X from a table and put it into a float. X doesn't perfectly represent in a float. It comes out X.0001. Then they take it and when it comes back it comes back as Y.0001. We cram it into an int so it becomes Y, we compare it to X which is really X.0001 and it comes back invalid.

SG: well as long as we are sending them the right number . . .

SWG: but we aren't sending them the right number. They are expecting X not X.0001. Then they send us back Y.0001 but it should be X so it's wrong.

SG: so they're giving us the wrong return value.

SWG: yes, but because we're giving them the wrong number.

SG: well not exactly . . .

SWG: yes exactly. It is off by .0001 because of floating point math.

SG: well . . .

Me: look it doesn't matter how it's breaking. But it IS broken. Which is why we're filling out the damn problem report. THEY ARE EDITABLE. We talked to the customer and gave them the risk assessment. They don't care. It happens rarely any way.

SG: then can we lower the severity?

Me: no. Severity doesn't relate to risk. That is a whole different process. Severity assumes it has already happened. It's a a high severity.

SG: but the metrics.

Me: WE GIVE THE METRICS TO THE CUSTOMER. WE TALKED TO THE CUSTOMER. THEY DON'T GIVE A SHIT.

And that was how I spent Wednesday wondering how a level 4 lead systems engineer got his job. How many push ups did he do? What kind of juice did he drink?

Headsup: if you're making a game, or want to, a good starting point is to ask a single question.
How do I want this game to feel?

A lot of people who make games get into it because they play and they say I wish this or that feature were different. Or they imagine new mechanics, or new story, or new aesthetics. These are all interesting approaches to explore.

If you're familiar with a lot of games, and why and how their designs work, starting with game
feel is great. It gives you a palette of ideas to riff on, without knowing exactly why it works, using your gut as you go. In fact a lot of designers who made great games used this approach, creating the basic form, and basically flew-blind, using the testing process to 'find the fun'.

But what if, instead of focusing on what emotions a game or mechanic evokes, we ask:
How does this system or mechanic alter the
*players behaviors*? What behaviors
*invoke* a given emotion?

And from there you can start to see the thread that connects emotion, and behavior.

In *Alien: Isolation*, the alien 'hunts' for the player, and is invulnerable. Besides its menacing look, and the dense atmosphere, its invincibility
has a powerful effect on the player. The player is prone to fear and running.

By looking at behavior first, w/ just this one game, and listing the emotions and behaviors
in pairs "Fear: Running", for example, you can start to work backwards to the systems and *conditions* that created that emotion.

In fact, by breaking designs down in this manner, it becomes easy to find parallels, and create
these emotions in games that are typically outside the given genre.

For example, if you wanted to make a game about vietnam (hold the overuse of 'fortunate son') how might we approach this?

One description might be: Play as a soldier or an insurgent during the harsh jungle warfare of vietnam. Set ambushes, scout through dense and snake infested underbrush. Identify enemy armaments to outfit your raids, and take the fight to them.

Mechanics might include

1. crawl through underbrush paths, with events to stab poisonous snacks, brush away spiders or centipedes, like the spiders in metro, hold your breathe as armed enemy units march by, etc.

2. learn to use enfilade and time your attacks.

3. run and gun chases. An ambush happens catching you off guard, you are immediately tossed behind cover, and an NPC says "we can stay and fight but we're out numbered, we should run." and the system plots out how the NPCs hem you in to direct you toward a series of
retreats and nearest cover (because its not supposed to be a battle, but a chase, so we want the player to run). Maybe it uses these NPC ambushes to occasionally push the player to interesting map objectives/locations, who knows.

4. The scouting system from State of Decay. you get a certain amount of time before you risk being 'spotted', and have to climb to the top of say, a building, or a tower, and prioritize which objects in the enemy camp to identity: trucks, anti-air, heavy guns, rockets, troop formations, carriers, comms stations, etc. And that determines what is available to 'call in' as support on the mission.

And all of this, b/c you're focusing on the player behaviors that you want, leads to the *emotions* or feelings you want the player to experience.

Point is, when you focus on the activities you want the player to *do* its a more reliable way of determining what the player will *feel*, the 'role' they'll take on, which is exactly what any good designer should want.

If we return back to Alien: Isolation, even though its a survival horror game, can we find parallels outside that genre? Well The Last of Us for one.

How so? Well TLOU is a survival third-person shooter, not a horror game, and it shows. Theres
not the omnipresent feeling of being overpowered. The player does use stealth, but mostly it's because it serves the player's main role: a hardened survivor whos a capable killer, struggling through a crapsack world. The similarity though comes in with the boss battles against the infected.

The enemy in these fights is almost unstoppable, they're a tank, and the devs have the player running from them just to survive. Many players cant help but feel a little panic as they run for their lives, especially with the superbly designed custom death scenes for joel. The point is, mechanics are more of a means to an end, and if games are paintings, and mechanics are the brushes, player behavior is the individual strokes and player emotion is the color. And by examining TLOU in this way, it becomes obvious that while its a third person survival shooter, the boss fights are *overtones* of Alien: Isolation.

And we can draw that comparison because like bach, who was deaf, and focused on the keys and not the sound, we're focused on player behavior and not strictly emotions.

Me: [jira comment] We have similar text for the mobile version of the site already. [includes screenshot of what site looks like now] Are you sure about this?

[radio silence for a few hours]

Me: [slack] I want to follow up.

Web Operations: What’s the issue?

Ooh k. Slack messages can have a tone.

Me: I just want to confirm we’re not repeating copy.

Web Ops: We’re not.

I complete the ticket and submit for review. The C-suite for my department reviews.

C-suite: [to web ops in JIRA comment] This looks weird. Is this right? [sends screenshot of my work because there is repeated copy, like I said there’d be]

Web Ops: [in JIRA comment] Oh, I thought X was questioning the request. X changed the wrong text.

C-suite: The website has always looked like that. You’re looking at X’s screenshot for the current website. Look at the screenshot I sent over.

Later, I complain because web ops was completely unprofessional with the comment about “questioning the request.”

C-suite: Web Ops is working hard. It’s our busy season and it’s their first time dealing with it. You know, I’m going to teach them some css and html so they can make content changes in the CMS and they’re not sending over changes so often and bothering you.

Me: [to myself] 🤨 wtf so it’s ok for web ops to treat me like dirt. And in writing. And with service that’s version controlled—JIRA emailed web ops comment to me. And lol no 😂 on teaching them how to code. That’s such bullshit. We all know you’d never allow them to edit the CMS because they’d fuck up the site. And they wouldn’t do edits anyway because it’s beneath them. And idk how this relates to web ops gross behavior.

A few days later.

Me: I was offered a job elsewhere. Here’s my two weeks notice.

C-suite: Can you push back your last day? It’s our busy season.

Me: Nope. Bye Felicia.

Having to wait for your coworker to come back from his lunch break to push his commits

My coworker pushed changes to almost all of our ASP.NET pages. However, he did so by pushing only his files, and when asked to merge, he overwrote all of our changes to those pages since he last pulled from the server, which was ages ago. We were three changesets past that overwrite before we noticed things we'd already fixed were gone. Had to revert, which we didn't know how to do, and we didn't know what he changed in his push, because he didn't comment on the changeset. He undid weeks of work, thankfully we only lost a few days worth over we reverted. We're going to have a quick lesson on merging correctly on Monday when we all get back

Its time to remind ourselves the wonderful time of the year, where people look back and decide to be better and learn from your mistakes...

For example never test in prod and wake me up with notifications you dumbfucks... Someone has exams to do..

Seriously, I have seen a lot of push notifications lately, its some kind of Letstestinprod-uary?

I like rants that are thought provoking and push a message forward regardless of whether they may sting a little, so for my first post on here I'd like to hit at home with many of you.
Html5 "Native" Applications are not needed. Let's cover mobile first of all, the misconception that apps are written in either javascript or Native android/ Native ios environment. Or even some third party paid tools like xamarin is quite strange to me. OpenGL ES is on both IOS and Android there is no difference. It's quite easy to write once run everywhere but with native performance and not having to jump through js when it's not needed. Personally I never want to see html or css if I'm working on a mobile app or desktop. Which brings me to desktop, I can't begin to describe how unthought out an electron app is. Memory usage, storage space for embedding chromium, web views gained at the expense of literally everything else, cross platform desktop development has been around for decades, openGL is everywhere enough said. Finally what about targeting browser if your writing a native app for mobile and desktop let's say in c++ and it's not in javascript how can it turn back into javascript, well luckily c++ has emscripten which does that simply put, or you could be using a cross complier language like haxe which is what I use. It benefits with type safety, while exporting both c++ and javascript code. Conclusion in reality I see the appeal to the js ecosystem it's large filled with big companies trying to make js cross development stronger every day. However development in my mind should be a series of choices, choices that are invisible don't help anyone, regardless of the popularity of the choice, or the skill required.

Who actually started the reign of mixed character passwords? because seriously it sucks to have an unnecessarily complex password! Like websites and apps requesting passwords to contain Upper/Lower case letter, numeric characters and symbols without considering the average user with low memory threshold (i.e; Me).

Let's push the complaint aside and return back to the actual reason a complex password is required.

Like we already know; Passwords are made complex so it can't be easily guessed by password crackers used by hackers and the primary reason behind adding symbols and numbers in a password is simply to create a stretch for possible outcome of guesses.

Now let's take a look into the logic behind a password cracker.

To hack a password,
1) The Password Cracker will usually lookup a dictionary of passwords (This point is very necessary for any possible outcome).
2) Attempts to login multiple times with list of passwords found (In most cases successful entries are found for passwords less than 8 chars).
3) If none was successful after the end of the dictionary, the cracker formulates each password on the dictionary to match popular standards of most website (i.e; First letter uppercase, a number at the end followed by a symbol. Thanks to those websites!)
4) If any password was successful, the cracker adds them to a new dictionary called a "pattern builder list" (This gives the cracker an upper edge on that specific platform because most websites forces a specific password pattern anyway)

In comparison:
>> Mygirlfriend98##
would be cracked faster compared to
>> iloveburberryihatepeanuts

Why?
Because the former is short and follows a popular pattern.

In reality, password crackers don't specifically care about Upper-Lowercase-Number-Symbol bullshit! They care more about the length of the password, the pattern of the password and formerly used entries (either from keyloggers or from previously hacked passwords).

So the need for requesting a humanly complex password is totally unnecessary because it's a bot that is being dealt with not another human.

My devrant password is a short story of *how I met first girlfriend* Goodluck to a password cracker!

Weird metro experience just now. Its a usual, busy friday morning, and i realized my metro card balance is down to 0. So went to the card counter, only to find a long long line. Fortunately, a person i know was between the starting 4 , therefore i got into the starting of the line.

When i my turn came, this hot slim lady(/aunty?) Of 25-26(or 30-35, god that makup!) Just barges from nowhere, pushes me aside in a triangular corner and places her card there. Of course my card was already with the guy at the counter, so i didn't care, my card will be recharged first.

The problem started when he gave my card back. The hot lady just covered the whole path, and i was struck between the two walls and her ... Er...ass(not literally, but her back was just touching the third wall. I loudly said "Excuse me", and she said "of course", but the lady had er, bigger assets than she expected . So i tried to get out, but yeah there was some unintended pressing, not my fault!

People need to either know their ass sizes or don't have to push others in tight corners. I hope she didn't felt junior Lannister :p

Seriously guys, how do you deal when remotely collaborating with lets say not the most motivated and competent devs?

Our scrum team got formed about 6 months ago from leftover devs of other teams, choosing a couple competent devs at the core and other devs who were kinda gotten rid of by their old teams, and after 6 months of working together I can see why.

Situation is that we are 7 devs in our team and 4 of devs are not pulling their weight. They are seniors on paper, but in reality not really.

They rarely take something complex to work on and even if they do, they make sure they take as much time as possible. Two of them are contractors who I imagine decided to treat the job as a paycheck and nothing more. There is no initiative, no push to make things better and in general attitude is to do bare minimum: only what is being asked and then delaying the hell out of tasks.

Im not exaggareting: Im talking about every possible way of dragging out the tasks: delaying communication, sitting around for a few days while not asking for new tasks to work on if they are blocked, also avoiding standups. Working for days on very basic comments in their MR's. Getting "sick" for a couple days on deadline when things get tough, so that someone else would come in, refactor and save the day. Once or twice it could be a coincidence, but nowadays I can already guess ahead of time what kind of trick they will pull now.

Our project is an android app where we have to support few different tablets, so the most recent new trick that I witnessed is devs avoiding hardware delivers, sometimes for months. Idea seems to be if you dont ping your team that you dont have hardware, then you can avoid working on related tasks with that hardware.

Worst part is that they get away with it. Our teamlead is a senior dev who is first time teamlead, doesnt code anymore and doesnt want to rock the boat. He is the type of teamlead who sets arbitrary deadlines, makes it sound that they are urgent and takes a few days off in the middle of chaos just before deadline. Restrospectives don't help at all and if I try to bring up stuff directly to him he tells me to bring it up during retrospectives. We discuss issues, rant a bit ant then continue carying on like nothing happened and nothing changes.

So little by little in the past 6 months we came to this point where 2-3 devs are carrying the weight of the team and are in a constant crunch mode, while others are allowed to slack. Its becoming ridiculous.

Problem is that this is starting to affect our morale. Only way that is left to keep my sanity right now is to pull away sometimes and also slack. Then I come back at full capacity, give my best for a couple weeks until I have to go and fix some basic leftover task that has been purposefully dragged out for 2 months and left unfinished, then I just want to scream and I know that its time to disconnect again.

The moment when you forgot to git commit and push, and you decided to continue to work on new features and you could not roll back to the previous build...

Client push back: when the client wants an impractical feature to be implemented and you tell them HELL NO, with a little sugar coating of course

Sooo as of January of this year, I have a new boss, this dude basically acted as my “mentor” for the last year so he’s already tried micromanaging me but bc he wasn’t my boss, I could push back.

Long story short, he is now my manager, he’s the global marketing leader and I’m the marketing director for the Americas (been doing this role for two years) yet he treats me like I’m an idiot, in his words he wants to make sure I’m in control of my team before he lets me lead fully while simultaneously telling me that I need to step up and lead.

I politely asked him to let me lead and stop attending all my team meetings, stop delegating tasks to my team directly and instead consult w me so then I can delegate, and basically to respect the fact that clearly I’ve been successfully doing the job for the last two years.

He said no, that he won’t leave my meetings until he feels I have full control of my team, continues to over involve himself in all my projects, pulling my team in a bunch of directions w new projects and ideas left and right, and burning us all out.

To add insult to injury, he sent me a very “helpful” email detailing how I need to work better and faster and how he expects me and my team at full speed, my team is made up of me, two new hires that are a month old, my marketing manager, and I’m currently hiring for another team member. (This after he led a company restructure of my previous team that resulted in me losing 4 team members in December so I’m rebuilding my team).

I’m already overwhelmed and demotivated, pretty sure he wants me to quit and he has a proven history of bullying his staff, he was actually fired from our parent company for this exact reason a few years ago, he also happens to be European so not sure how rules work over there, but he was rehired by my company. My European colleagues hate him too, but they’re too scared to speak up.

I used to love my job and now i dread it, I drink every day after work and I get anxiety everytime he emails me which is at all hours if the day. Is it worth it documenting his bullshit for HR or should I just cut my losses snd leave?

Appreciate the advice!

I’m feeling a bit stuck at work recently. I have a new department head and he keeps periodically asking me to do things that are very much not the normal responsibility of my role. These are always very simple things, things I am certainly capable of doing, but should fall outside of my purview. We even have documented methodologies indicating this sort of thing is not the sort of thing I’m expected to be responsible for. The trouble is, I’m not sure if when he’s asking me to do this it’s because he’s still new and not completely up to speed on who does what, or if this is a situation where he is The Boss and if he’s telling me to do it then now it is my responsibility, if not permanently, at least on these specific occasions. I’m also disinclined to just run with it without saying anything because then it really will become my responsibility, and there are good reasons why it currently is not.

I am having difficulty thinking of a way to bring this up that doesn’t sound like I’m refusing to do it. On the one hand, it’s not my job, but I also know that going around saying “that’s not my job” is not appropriate. The situation is not quite that I don’t have the authority to do the task, but that’s closer to the type of reasoning for why my role isn’t responsible for the thing, and it’s always restricted to people in a different role. Part of the internal rationale was a sort of “too many cooks in the kitchen” situation in the past, but there are also other logical reasons why staff in my role are not intended to be involved.

I’m also hesitant to push back at all since I can’t tell if the boss is coming from a place of not knowing or one of reassigning. I don’t want to seem difficult (but also reallllly don’t want this added to my plate). I don’t know the new department head well enough to guess whether it’s more likely a misunderstanding vs a change in policy. I’m struggling with finding the words for how to bring it up without sounding like I am saying “that’s not my job”. Is this the sort of thing that is better handled in the moment, or waiting for a time separate from when he’s making the request to talk about it more generally? Help!

Who around here is saying the looovveeeee mobile development? EVERYTIME i come back to it, it's just cert nightmare - you need a provisioning profile this, distribution cert that, your profile has to INCLUDE the cert, on and on and on. god i hate it

Wanna know how I do it with web?

git push

When Do You Stop Taking Responsibility?

Let me clarify by describing four scenarios in which you are tasked with some software development. It could be a large or small task. The fourth scenario is the one I'm interested in. The first three are just for contrast.

1. You either decide how to implement the requirements, or you're given directions or constraints you agree with. (If you hadn't been given those specific directions you probably would have done the same thing anyway.) **You feel accountable for the outcome**, such as whether it works correctly or is delivered on time. And, of course, the team feels collectively accountable. (We could call this the "happy path.")

2. You would prefer to do the work one way, but you're instructed to do it a different way, either by a manager, team lead, or team consensus. You disagree with the approach, but you're not a stubborn know-it-all. You understand that their way is valid, or you don't fully understand it but you trust that someone else does. You're probably going to learn something. **You feel accountable for the outcome** in a normal, non-blaming sort of way.

3. You're instructed to do something so horribly wrong that it's guaranteed to fail badly. You're in a position to refuse or push back, and you do.

4. You're given instructions that you know are bad, you raise your objections, and then you follow them anyway. It could be a really awful technical approach, use of copy-pasted code, the wrong tools, wrong library, no unit testing, or anything similar. The negative consequences you expect could include technical failure, technical debt, or significant delays. **You do not feel accountable for the outcome.** If it doesn't work, takes too long, or the users hate it, you expect the individual(s) who gave you instructions to take full responsibility. It's not that you want to point fingers, but you will if it comes to that.

---

That fourth scenario could provoke all sorts of reactions. I'm interested in it for what you might call research purposes.

The final outcome is irrelevant. If it failed, whether someone else ultimately took responsibility or you were blamed is irrelevant. That it is the opposite of team accountability is obvious and also irrelevant.

Here is the question (finally!)

Have you experienced scenario number four, in which you develop software (big as an application, small as a class or method) in a way you believe to be so incorrect that it will have consequences, because someone required you to do so, and you complied *with the expectation that they, not you, would be accountable for the outcome?*

Emphasis is not on the outcome or who was held accountable, but on whether you *felt* accountable when you developed the software.

If you just want to answer yes or no, or "yes, several times," that's great. If you'd like to describe the scenario with any amount of detail, that's great too. If it's something you'd rather not share publicly you can contact me privately - my profile name at gmail.com.

The point is not judgment. I'll go first. My answer is yes, I have experienced scenario #4. For example, I've been told to copy/paste/edit code which I know will be incomprehensible, unmaintainable, buggy, and give future developers nightmares. I've had to build features I know users will hate. Sometimes I've been wrong. I usually raised objections or shared concerns with the team. Sometimes the environment made that impractical. If the problems persisted I looked for other work. But the point is that sometimes I did what I was told, and I felt that if it went horribly wrong I could say, "Yes, I understand, but this was not my decision." *I did not feel accountable.*.

I plan on writing more about this, but I'd like to start by gathering some perspective and understanding beyond just my own experience.

Thanks