Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "sister"
-
My conversation with my wife today, while I was at work:
Wife: The wifi isn't working.
Me: What's it doing?
W: Not working
Me: Try turning it off an on again.
.
.
.
Me: Is your phone on LTE? Or is it connected to wifi and the internet isn't working?
W: LTE. Aubrey (my wife's sister) said she turned it off and nothing happened.
Me: did she turn it back on?
W: Do you really want me to answer that?
Me: Just making sure. What lights are on on the router?
W: (Sends me a picture of the router with no lights on)
Me:...
W: Oh it isn't even plugged in
Me:...
W (after a couple minutes): Its working now!
YES I REALLY WANT YOU TO ANSWER IF YOU TURNED IT BACK ON!13 -
!rant. Sometimes, trolling your fam is a lot of fun.
Just today my sister asked me how to type the character ÷ on her keyboard. I told her to press : and the - key and then just move it like so.
: -
: -
: -
:-
÷
See? Ez pz. She actually tried it and just said 'i cant, it erases everything'. And then all of my other siblings kept ranting the same thing. I forgot we were in group chat. And now its full of : and - spams. And im just here laughing my ass out.11 -
So this just happened:
Sarah = best friend (random name)
Sister: Hey, could you help, sarah's phone isn't recognized by her computer anymore.
Me: What phone/pc does she have?
Sister: iPhone/Windows.
Me: Has she checked the drivers?
Sister: *tells to check drivers, feedback:* yes, seems to be fine.
Me: *comes up with 1000 other suggestions*
Sister: *doesn't work every time*
Me: Is there any other information that might be useful in this case?
Sister: Well, she dropped her phone in the water earlier, the phone is hardly responding.
Me: THE WAT? AND YOU DIDN'T THINK THIS WOULD BE WORTH MENTIONING IN THE BEGINNING?!? FUUUUUUUUUUUUUUUU.16 -
My sister got me some stickers as a birthday present but she didn't know where to buy them. So she painted a gift card instead...😮26
-
Visited my parents again today!
Arrived home.
Suddenly my sister starts to talk about the new dutch mass surveillance law and how it's all bad and the possible consequences.
😶😐😮
Normally I'm the one who says that and is told to shut up after a while.
I'm a proud brother!21 -
Sister called me on my way to work (she never calls me, we communicate through a family signal) to ask if I wanted to come over for dinner in the weekend because a new guy she knows will be there and also my parents.
Me: hmm idk I've got a lot to do in the weekend....
Sis: he saw my laptop by the way, he was highly impressed that its dual booted and asked how on earth I know about Linux! Then I told him about you and what you do and now he really wants to meet you!
Me: what time would I have to be there?
I hate how that stuff can make me change my mind just like this 😅25 -
My sister is 16yo and she is not interested in the C.S field. I gave her last year my laptop and it has Debian on it, since i bought a new one. She never told me that she has to deal with any problem, she was just using it.
Today she got a new laptop from our grandma and she texts me "hey, is there any way i can install Linux on that? I don't want to use windows".
Well i told her that she has to wait me to come back home next month and i will take care of it.
I had never thought that i will listen something like that. Good day.19 -
Me: my computer is dead, are you using the iMac?
Sister: your computer is dead because of the coding! Even my friend agrees that coding causes viruses17 -
So I barely get home and I see my 10 year old sister in the living room coding with the Xcode Playground, I asked her where she learned how to do that and she said "I just read the books you had." I'm so proud. 😭🤘🏼10
-
Sister: today I discovered two new libraries
Me: what lang?
She: what?
She was talking about real libraries xD4 -
My 7 year old sister: Why do you always use the duck? Go on google.
Me: Because Google spies on you.
Sister: How??
Me: *too tired to explain* by magic. Whatever you go on, they'll know.
Sister: *shocked expression* WHAT? *proceeds to ask a million questions.*
Sister: What do I do now?
Me: Use the duck (she calls ddg "the duck.")
Then a few hours later, I saw her playing Y8 on DuckDuckGo. I'm so proud of her. :)
Now if only I can convince my 15 year old little brother to do the same thing. He doesn't seem to care at all.54 -
Celebrated saints Nicolas today with the family. Apparently my sister made a devRant account to follow me around and see how/what I'm about in this platform and get me a present based on that.
She got me this: 😍40 -
Son: Dad why is my sister named Rose?
Dad: Because your Mom loves roses! Son: Thanks dad!
Dad: No problem, vue.js16 -
Sister: "You can't commit to......"
Me: *has flashbacks of Git Commit issues doesn't even hear the rest*6 -
Back in the days...
Parents: get off that computer it will get you nowhere in life!
Me:But im programming not playing games..I want to become a programmer...
Parents:programming or games it's all the same! Take an example of your sister who actually achieved something with her studies (she's a doctor)
Me today asa computer engineer...receiving paycheck higher than my sister who is a doctor and not to mention I got a car of the company and living very comfortably.
Parents can't believe it.
#rekt
Moral of the story: never let anyone tell you what to do. Keep doing what you truly love and get real good at it!😉13 -
Sister was getting a new phone (she likes iphones but the jackplug removal made her go towards android as well as the prices) and there was this Deezer family deal. So she Signal'd me asking if I'd like to join the deezer family and I was like 'yeah sure but just remember that there's a big chance of me moving to another country after my study, is that okay with this subscription?'
Sales guy: It's limited to the country the official subscriber is in.
Sister: 'Oh but my brother is a smart IT guy, he can probably setup a VPN server here so that he can still use the app.'
She told that the face of the sales guys was like 'what the actual fuck just happened'.
She called me afterwards telling the story and also 'even though I thought I'd never learn about this stuff (I always told stuff at the dinner table), appearantly you taught me more than I realized!;.
Yeah, that was a very proud brother moment =).6 -
If you think you know the most idiot person in the world, you haven't met my brother.
His brain absolutely can't comprehend anything!
He forgot his Roblox password and told me to do something. I said I can't do anything about it. Then he yelled at the top of his lungs saying, "you don't know technology! You're too stupid and selfish. Fix it!"
I said I can't do anything about it. He throws the mouse at me and says, "I never get to have fun. You ruin my life!"
He's not a little kid btw. He's fucking 14.
Today my mom forgot to pay the wifi password, and she thinks its better not to pay it today so it can stop my brother from playing games. (He plays it from morning to night. No homework, no cleaning, no nothing. Just games all day.)
So he told me to fix it. I said I cant. There's nothing I can do. Then he punches my arm really hard. (He's taller and stronger than me so it really hurt) then he threw a shoe and said, "you're useless and stupid! You have your laptop so you can have fun but I never get to have fun. You ruin my life, and I hate you. I hate my life."
Then he ran to mess up my room by tossing things from the self, removing clothes from my closet, and messed up my bed. He pushed my sister, pulled my hair, and ran to his room, slamming the door.
Please. Please someone give him a brain! He desperately needs one. I said I can't fix it, and that my mom has to pay the WiFi bill, but he thinks I'm being mean.
He has the mind of a 5 year old. Dropping to the ground crying.120 -
- Which operating system do you have? Windows?
- Nah, I have LibrOffice
- ...
If you weren't my sister I would have slapped you.10 -
My younger sister is 6-years-old and she argued with me saying the moniter was the computer and the system unit was the charger.40
-
We're not a family of devs. So the situation may seem weird to them.
My sister saw me doing the rubber duck debugging and venting my programming frustration with an innocent little duck. Eye-to-eye. And now, she thinks i'm in need of serious help.11 -
Me trying to find a good risotto recipe.
Sister-in-law, PhD: What about pumpkin or courgette and salmon?
Me: ...
SIL: ...
Me: Could you add some parentheses?
SIL: (Pumpkin) or (courgette and salmon)?
Me: Much clearer, thanks! Go for courgette and salmon.6 -
Family reaction story to me being a dev?
- My dad still refers to my profession as 'something in computers'.
- My older sister goes to her weirdo friends for technical advice because she thinks all I do is fill paper in printers (that's a long TL;DR story about a phone upgrade)
- My brother, a car mechanical genius thinks what I do is near God-like. He also races cars and can blabber on about the physics, aero-dynamics, weight ratios, etc and says "Oh, no way. I'm too stupid to do what you do." Then I'm like, "Dude, shut up, I can barely change my oil and you could replace an engine blindfolded", then he just laughs "Yea, probably."
- Baby sister just wants me to fix her phone. "Can you make <insert some random app> do <insert a random behavior the app was never designed to do>?". I'm like "Uh no, I didn't write Instagram", then she's like "I thought you went to school for computers?".
- My mom passed way (long battle with cancer). I'm sure she'd be proud, but still asking me to how to switch the channel so she could watch a movie on the VCR.
I can clearly see having this conversation with my mom.
Me: "Mom, why are you still using a VCR? I bought you a subscription to Netflix"
Mom: "Net what? Do I turn the dial to channel 2 or 3?"
Me: "No, its the Netflix button on the remote."
Mom: "Can't you come over and do this? I just want to watch my shows. Didn't you go to school to learn these things?"
Me: "No mom, that's not...um...never mind. I'll be right over."17 -
My mom actually is right: "He makes websites, but the background things we don't see!"
My dad thinks I write all of my code in binary: "Joost writes zero's and one's all day long!"
My sister thinks every website I create is a blog...
And finally most of my friends think I'm a hacker and I'm gonna break into their phone (iPhones pff)10 -
Exp. that made me doubt my skills?
My non programming sister managed to find a bug I was looking for...
I couldn't find the problem for hours and she just looks at the screen and goes "That looks odd!"8 -
Today my sister told me "bro, I want you to teach me how to program". My gf told me the same some months ago
So proud of my girls 😍11 -
Shopping for fridge with sister in law.
"Yeah that one is nice but it doesn't have an app"
"Why do you need an app for your fridge"
"I don't know, but this other fridge has an app, so I think if it doesn't have an app it's not that good"
"But it's very energy-efficient, silent and spacious. The one with the app is the same size, has a worse energy rating, is noisier and is more expensive as well"
"Yeah I know but if there's no extra features that's kind of boring"
"You are everything that's wrong with modern consumers"28 -
I just feel that I have to get this of my chest, because this have really me and my family really negative.
It have destroyed my will to be happy, sort of.
Well, my father have some kind of control behaviour. My whole life he has been angry on stuff that does not really matter
and I have always been the one that get all the shit - because I am the oldest. I was never allowed (maybee 3-4 times between age 8-15) to have any friends
over or stay with friends over night or after school. Because they "where bad and I would become like them".
I am happy that I meet my wife 6 years ago and moved away from home when I was 20, I kinda fled the situation from home to start my own life.
My father has always hated when boy/men had long hair and alot of beard - but that is something I always wanted to have. So when I moved from home
I start to let everything grow.
Two years ago, things got really fucked up when I did not shave all my beard of and cut down my hair because my mom had birthday. I did it the week after
because my brother graduated from school and we where going to visit, we did not want a repeat the situation from a couple of weeks before. After that I got
another job as a Linux sysadmin and started to grow the hair and beard again.
Last monday, my dad called and said that I am not welcome to visit them anymore. I am a "bad example" for my sibling
and he also said "you brother and sister does not feel so good (my sister fainted a couple of days before, which I did not know) so I have no time to care about you and your family"
I was stunned, I really wish that this was a joke but it is'nt.
I have always been bashed because of the choices I make in my life and for my own family (wife, and two kids + one more kid any day now)
When I choose to work with something that I love, they said that I am stupid because they basically think "that the PC is full of SATAN".
When they realized that I make more money than my parents combined they went silent.
I just wanted to write this shit of my chest, it is really fucked up and I am starting to loose the ability to have feelings - if you know what I mean.
Thank you devrant, for being one of the fun things I do, when I read all the rage, fucked up stories, hate, and so on. I do not feel alone :)
PS: I promise you, that you guys/gals will be the first one to know when my new kiddo arrives20 -
Story.
Did you know logging into chrome will auto sync all your fucking bookmarks to that other person's account??
I DIDN'T!!
(I use Firefox mainly and chromium for testing.)
I use chrome only for porn. Got shit tons of bookmarks. I login to my friend's sister Gmail on my chrome(for remote desktop - to help fix her computer. Somehow,remote desktop doesn't work on chromium)
Was browsing her pc via remote session and suddenly all of my porn bookmarks appear at the top bar.)
Had to manually select each bookmark in the bookmark manager and delete since CTRL+A won't work during the remote session. Don't know why.
FML.27 -
Sister: "Can you fix my computer?"
Me: "What's wrong?"
S: *explains the issue
Me: *types that into Google and shows her the search results
S: *gives me the look
M: "This is seriously what I do to fix a lot of my problems 🧚"18 -
My sister lending me her credit card to buy something online.
S: "But don't store the number!"
me: "I would never."
S: "I know you can hack it, please don't!!"
me: "Haha okay.."
*cries inside... just because I make websites and 3D design*
me: "Thanks a lot, sis <3"12 -
So guess what my little sister got me for my birthday! She actually made an effort to make this cute gift. Maybe in the future I will buy the original one and then I'll have two :319
-
Was at my sisters place a little ago and somehow we came at the subject of her laptop.
For everyone who thinks I'm posting this solely to hate on windows, I'm not. This really happened and if you don't believe it, well, so be it, I guess.
Also keep in mind that's she's using a stock version without anything except for word and itunes installed.
She got it a couple of years ago and I dual booted it for her (windows + ubuntu). I fully expected her to use windows because of office and outlook etc.
Asked her anyways:
Me: So, you've got dual boot, although I think already know the answer, what system do you use mostly? (I didn't even consider that there was a possibility that the answer would be ubuntu or linux)
Sister: Ubuntu!
Me:
Me:
Me:
Me:
Me:
Me:
Me:
Me: 😵
Me: Sorry, what? You're not using windows as primary system?!
Sister: No. It at first takes that motherfucking system about 5 minutes to reach the FUCKING LOGIN SCREEN.
Me: Ow, that's bad :/
Me: *turns laptop on and indeed, it takes a fuckton of time*
Me: Is the password still the same as when I set it up for you?
Sister: Yesss.
Me: *types the password, it's working, loading screen appears*
Sister: Would you like a coffee?
Me: Uhm.... sure? But that would take you about 10-15 minutes to make.......?
Sister: Yes. And that's exactly how long it takes before that fucking piece of shit called windows has finally loaded the FUCKING DESKTOP.
Me: 😅
Me: Okay but it can't be that bad, right? I mean, I hate windows but you mostly need it for studies and such and as you know I'm not judging you for tha......
Sister: YES IT IS THAT FUCKING BAD. WHEN I'M IN CLASS, IT TAKES HALF THE FUCKING CLASS TO LOAD BEFORE I CAN OPEN WORD OR WHAT-THE-FUCK EVER.
THAT'S WHY I USE UBUNTU PRIMARILY, BECAUSE, ALTOUGH IT'S NOT MY FAVOURITE SYSTEM, IT. JUST. FUCKING. WORKS.
Well, I did definitely NOT see that one coming!
There is some bloatware on there but definitely as bad as what would cause this. Virus scan turned up empty. No. Fucking. Clue.
It's not a gaming laptop or anything but come on, it should run either windows or linux very well.51 -
Sister broke up with her bf (sad) and he gave her a fidget cube as a present a little back. She wanted to get rid of memories so guess who now has his first fidget cube, yes! her brother! Meeeeeee 🙌😃14
-
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
They know exactly what I do, both my parents and my sister.
Then again, they use Linux as main system although they're very a-technical ;)11 -
Sister = bee ( who isn't a stranger to Ubuntu)
Me = Cee
Bee: can I use your laptop?
Cee : why ? Use yours ,it's works fine.
Bee : no I want to use yours and I need to work with windows.
Cee: 🤯
Bee : my work can only be done using windows.
Cee : fine do whatever ( doesn't want to argue )
* Le bee opens MS word, and starts her work *
Cee : 😤😤Seriously?
Bee : I don't like libre
Cee : 😑😑😑^∞
* Few moments later *
Bee : my work is done ,you can have your laptop,btw it's updating.
Cee : 😑😑😑😑😑
* 2000 years later *
*Opens Ubuntu *
*Getting a weird bug*
*Tried to fix *
*Can't open OS files * 👏👏👏🎆
* Windows not shutdown properly *
* Opens windows *
* Not able to login via pin *
* Password ? not accepted *
* Changes outlook password *
* Please chose a password you haven't chosen before *
* Logs in *
* types old pin to change pin *
*You've entered wrong pin too many times *
*System hanging a lot *
* Removes pin *
* Gets huge mcAfee restart system popups , every 10 sec *
* Just shutdown , feels irritated for the rest of the day*
* Regrets dual booting, shd have wiped the windows partition 😫😫*
*Wonders,what the hell did my sister even do to my laptop ?*72 -
My sister in law got me this guy for Christmas after I told her about devrant!
She found it in a rubber duck shop in Amsterdam.
Best sister in law!11 -
The time my sister dropped the external HDD with every single picture of our family between 2000-2009.
I was 16 at the time, and it made me paranoid like I am today.
Three offsites backups, and three local ones currently and always trying to do expand.9 -
trying to teach my little sister(13) her first programming language. decided to go the microsoft way and start with C#.
the moment she finished her first
hello world made me so proud of her :)11 -
My little sister is taking an intro to web development in college right now... They're really setting them up for success over there with their unregistered copies of DreamWeaver... Heavy sigh20
-
The weirdest shit happened today. My 14 year old sister comes to me and asks me that she has a million dollar app idea that I should make her so that she can put it on the app stores and earn.
THE PLAGUE HAS SPREADDD😱11 -
Sister: (she must migrated from iOS to android) you can download these apps and then you can change like colors and themes and everything 😍😱😵
Me: Yeah off course you can...?
Sister: Oh not, oh no, you're not going to tell me you've been able to do this for years?!?
Me: Uhm... Yes...?
Sister: 😵😭😱😭
Not an apple hate rant, just found the convo funny!6 -
Always at home: check
Dark themes ftw: check
Black hoodie: check
At least 2 monitors: check
1k Browser tabs: check
Up all night: check
Tiered 24/7: check
notepad++: check
Keyboard wakes my sister from 2 rooms across: check
Burns in sunlight: check
DevRant: check
What else to be a successful programmer?29 -
My little sister was ranting about a punishment she got from her teacher. I told her to write this instead...Was this the wrong thing to do or it's just me... :P20
-
$sis: hey $me, can you help me?
$me: Uhm, sure, what's wrong?
$sis. The printer doesn't work..
$me: what does it say?
$sis: what do you mean?
$me: like, when you try to print something, what does it say?
$sis: uhm... idk...where should it say something
$me: On your screen you should be getting an error message right?
$sis (now getting irritated for some reason): no it doesn't..
$me: okay, let me check it out
*I walk to the printer with my sister's laptop and plug in the usb*
*Select printer > click print*
"Printer offline"
$me: was it also saying this before
$sis: uhm...yes
$me: ok
At this point im already getting a bit fed up
$me: are you sure this port is working
$sis: yes, I am sure
Okay, check other ports just to be sure, also don't work.
After about 15 minutes of debugging, turns out she managed to unplug the cable on the printer...
And all I got was a "o thanks"
Fml4 -
My mom thinks I'm going to be the next Elon Musk
My sister thinks I'm crazy... She saw me talking to my rubber duck 😂😂😂1 -
OMFG
Waking up in the middle of the night to a strange feeling in my ear and noises. Started shaking the head, which did nothing except panicking because of intensifying scratch noises in my head.
Getting the fear to be eaten inside out.
Get the phone and call sister to get me to the doc but her phone is powered off. Starting to Google "consequences of an cockroach in your ear", reading this is not as bad as I thought and that some people do not even realize it !??
Laying down for 3 minutes in the dark, *heating up and feeling my pulse* hoping it will crawl out. Which obviously did not fucking happened, this sucker just squatted my ear.
So I go to the bathroom and start filling up the tub. While it is filling up, I Google "how to get cockroach out of your ear". Finding an article that you should pour oil in your ear to suffocate the squatter. So I go to the kitchen, grab my sunflower oil, go to the mirror and start pouring. I am starting to shine like a bodybuilder and hear the noises again. After what felt like an eternity, I hear even more scratching in my head, this is the moment I do half a headbang and *wush* *flap* something hit the ground. I look down in the hope it wasn't just the sunflower oil and see this little thing which is clearly a cockroach. I am fucking relieved, not hearing any noises anymore.26 -
FUCKING HELL
My sister has that Vaio laptop from 2012 and she wanted me to "clean it up"... You get the deal. I ran the bios and booted it up from my external SSD setup so I don't have to bother with her bloody Windows fucking 7. When I'm finished deleting some garbage she managed to accumulate on her disk I wanted to switch back to Windows to properly uninstall bloatware she had. AND THEN OT FUCKING STRUCK ME. Can't load bios. F keys don't do shit. Delete doesn't either. The bloody "ASSIST" button is as useless as always. Since the computer is so slow I'm gonna waste a whole day trying to fix it and in the end she will be like: "oh, it took you so long!". Why Vaio, why can't you just get over the fact that some people actually use BIOS and make it somehow ACCESSIBLE? It's the same shit every time I try to do anything with that laptop. I'm always getting shit on from Sony as if I paid them to fuck me. One last time. VAIO, FUCK YOU.4 -
Less a rant, more just a sad story.
Our company recently acquired its sister company, and everyone has been focused on improving and migrating their projects over to our stack.
There's a ton of material there, but this one little story summarizes the whole very accurately, I think. (Edit: two stories. I couldn't resist.)
There's a 3-reel novelty slot machine game with cards instead of the usual symbols, and winnings based on poker-like rules (straights and/or flushes, 2-3 of a kind, etc.) The machine is over a hundred times slower than the other slot machines because on every spin it runs each payline against a winnings table that exhastively lists every winning possibility, and I really do mean exhaustively. It lists every type of win, for every card, every segment for straights, in every order, of every suit. Absolutely everything.
And this logic has been totally acceptable for just. so. long. When I saw someone complaining in dev chat about how much slower it is, i made the bloody obvious suggestion of parsing the cards and applying some minimal logic to see if it's a winning combination. Nobody cared.
Ten minutes later, someone from the original project was like "Hey, I have an idea, why don't we do it algorithmically to not have a 4k line rewards table?"
He seriously tried stealing a really bloody obvious idea -- that he hadn't had for years prior -- and passing it off as his own. In the same chat. Eight messages below mine. What a derpballoon.
I called him out on it, and he was like "Oh, is that what you meant by parsing?" 🙄
Someone else leaped in to defend the ~128x slower approach, saying: "That's the tech we had." You really didn't have a for loop and a handful of if statements? Oh wait, you did, because that's how you're checking your exhaustive list. gfj. Abysmal decisions like this is exactly why most of you got fired. (Seriously: these same people were making devops decisions. They were hemorrhaging money.)
But regardless, the quality of bloody everything from that sister company is like this. One of the other fiascos involved pulling data from Facebook -- which they didn't ever even use -- and instead of failing on error/unexpected data, it just instantly repeated. So when Facebook changed permissions on friends context... you can see where this is going. Instead of their baseline of like 1400 errors per day, which is amazingly high, it spiked to EIGHTEEN BLOODY MILLION PER DAY. And they didn't even care until they noticed (like four days later) that it was killing their other online features because quite literally no other request could make it out. More reasons they got fired. I'm not even kidding: no single api request ever left the users' devices apart from the facebook checks.
So.
That's absolutely amazing.7 -
My new glasses are coming soon :)
Now I won't be as blind as a blindfolded grandmother inside a dark cave at night!
Everytime I code, my nose practically touches the screen, because even my mom's old glasses don't really help.
I can barley use Devrantron because of my blindness, but at least I can see well on mobile.
If you are wondering how my old ones broke, well, my little sister sat on them. That little demon, I love her, but she's pure evil.
Oh, and she did it on purpose btw. I asked her why and she said she wanted to know how it feels like to sit on glasses. She's not crazy, she's 6 years old lol.64 -
My mom has a new IPad.
it took my mother and sister 4 hours to make an apple ID.
I offered to help, but they said they wanted to do it themselves
So, i opened my sister's laptop and opened google, i googled: "How to setup an apple ID". left the laptop near them, and hoped they notice it, and they did.7 -
Conversation with my older sister
Me: "open CMD and enter command"
Big sis: *enters command*
Me: "Look for Ethernet Adapter"
Her: "What?? I can't see it"
*pause 'cause I'm confused*
Her: "Wait, was I supposed to press enter?"
Me: ...1 -
I taught my 9yo sister to SSH from my Arch Linux system to an Ubuntu system, she was amazed to see terminal and Firefox launching remotely. Next I taught her to murder and eat all the memory (I love Linux, as Batman, one should also know the weaknesses). Now she can rm rf / --no-preserve-root and the forkbomb. She's amazed at the power of one liners. Will be teaching her python as she grew fond of my Raspberry Pi zero w with blinkt and phat DAC, making rainbows and playing songs via mpg123.
I made her use play with Makey Makey when it first came out but it isn't as interesting. Drop your suggestions which could be good for her learning phase?13 -
Best friends sister asked me if I could hack a phone or a router or something for her. Asked if the owner was alright with it. She said yes. Asked her for a picture of the interface. She sent me three pictures:
IPhone interface
Router interface
Blackberry phone interface.
😐
"I'll give you the iPhone through {best friends name}".
I have the phone now.
She's saying that I hacked their wifi.
I haven't even booted the phone yet.
I never connected to her network.
I don't know where she lives.
Dafuq.13 -
Removed my Facebook account about Month ago. Sister was pretty sad because I'm the one person she can tag in everything. Asked me why I deleted it and I told her it was because of privacy concerns. "Then why don't you make an end to end encrypted social network?". I'd actually consider this...11
-
My 8 year old brother started attending a robotics class a few days ago. He already loves it. I'm a proud big sister 😊
(And I'm already planning on how to start teaching him programming.)12 -
Introducing my parents/sister to devRant. This is way more explaining then I thought but very funny 😅.
Especially explaining the word devRant, the principle of comments and rants and how mentions and tags work is a challenge 😆13 -
Mom is proud. My sister thinks I am a huge nerd. Dad is jealous because he would have done CS but it didn't really exist when he went to college. My grandparents think I can fix everything now (like resetting their facebook!password :D )3
-
Wife - Lets go for a dinner tonight.
Husband (HR Manager) - Ok.
Husband - Should we go to a cheaper restaurant ?
Wife - No. Let's go to Royal Palace hotel.
Husband - (silence for a minute) - Ok, See you at 7.O 'Clock.
On the way, around 6.30 pm...
Husband - Once upon a time, I had pani puri competition with my sister and she ate 30 pani-puris(Search in Google, It is the most delicious chat) and defeated me.
Wife - What's so difficult in it?
Husband - Defeating me in Pani-puri eating competition is so difficult.
Wife - I can easily beat you.
Husband - Please leave it. It's not your cup of tea.
Wife - Let us have that competition right now.
Husband - So you want to see yourself defeated?
Wife - Let's see.
They both stop at a Pani-puri stall and start eating...
After about 30 Pani-puris the husband gave up.
The wife was also full, but to defeat her husband, she ate one more and shouted, *"You lose."*
The bill was Rs 50/- and wife was back home and happy as she won the bet.
Moral of the Story...
*Main aim of a HR Manager is to satisfy employee with minimum investments. Winning attitude with less investment, ensuring strong Return On Investment!* 😃😜😀😄😆😅😂😝😎5 -
#¤%@ kid!!! My 5yo son has obviously been playing with his mom's mobile phone. At first, I thought it was a little cute, when I received incoherent texts about Roblox, one of his favourite games.
But then, I suddenly heard from my sister who was really upset and worried. She was wondering if my gf really wants to see her dead, after receiving a facebook pm in English, saying "oh die :-)".
No need for auntie to take it personally though; turned out she was not the only one getting the same message :-O
A little boy is facing a mobile ban for a very long time...8 -
I'm really excited to meet our intern, she's coming next week 😊😊
I feel like I'm getting a little sister24 -
Okay so even at my advance 52 years of age, I still pull all nighters to handle emergency remediation projects, and clean up other peoples messes. I don't mind, I'm a geek, I get high on the challenge of fixing shit that is broken all to hell.
But tonight was different. Tonight has me raging.
I am tasked with renovating a website, and building a sister site to that main site as well. no bother, I haven't done any web dev in 15 years but I'll power through pulling 18 to 20 hours a day for a couple of weeks to get in the groove...
Little did I know... CSS is a pain in the ass to be sure, but FLEXBOX is total and complete bullshit.
I don't give to shits about all the fancy shit it can do, it can't do simple shit worth a damn. Fuck Flexbox, and anyone involved in producing that useless layout model.
The sheer number of idiots promoting that hunk of shit a solution that is to be applied to any task other than wiping my ass is astounding.
Fuck all you jerk offs out there posting your shitty mark up turds as if they are gold, when you know better than anyone it works, sometimes, then doesn't, and is so easy to break it may as well be called "Web Design Jenga".
I'm still tired as hell, and tomorrow I will go back to slogging through CSS as the layout method, but at least I feel a little better now.
Oh and before I forget FUCK YOU FLEXBOX you piece of shit.14 -
Sister: What is "sudo"?
Me: it lets you do things as another user
Sister: Stop speaking computerese!
😑9 -
Shopping for computers is so fun and relaxing than shopping for makeup.
So here's the scenario...
I walked into a makeup store and I was looking for lipstick. I was wearing my devRant shirt, jeans, and a laptop backpack. A sales lady approached me and just stared. She didn't even ask what I was looking for. The way she looked at me made me feel that I don't belong there. She should've just left me alone than giving a judgemental look. I got intimidated so I looked at her and gave the biggest smile, then fleed. I panicked. I salute those female developers who doesn't have problems shopping for girly stuff!
For the record, my sister encouraged me to wear a little makeup so that I don't look stressed. That made me decide to go to that makeup store. I'd rather order online now.
It's so hard to not be girly by nature.17 -
My mother is the one that introduced me to computers from a young age. She would tell me that they were the future and that people could do amazing things with them. Fast forward at me graduating from uni with a B.S in Computer science and she was the happiest :) she tells everyone that I am a computer scientist, she seldom says "programmer" or "developer". She is super well versed in general computing and can use Linux and Mac, so yeah :) mom is awesome. My dad has lil idea of what I do, to him its just magic, my step dad is the same way but he will be the first to tell everyone that I am a wizard.
My brother and sister could care less...my sister tells everyone that I am the smartest person she knows, but that I spend most of my time glued to the screen "playing with a bunch of weird code!"
The rest of my family is pretty meh about it, 2 of my uncles are super proud of it and normally ask for my input regarding tech or about life as a dev.
Finally, the wife. The wife knows how to code from before I even knew what code was :) so she knows exactly what I do :)8 -
Today I found my sister take a photo of her laptop screen with ms word open to share her class report which is just pure text file4
-
My sister is the one who got all the support, despite her now working as a cleaning lady, having 2 kids of her own, having already married and divorced, having been in financial trouble several times, oh and she's only 22 years old. She couldn't finish high school and even getting a driver's license wasn't without hoops. Now she's dating someone as old as our mother.
I've been putting my career front and center in everything. I want to make my own business and sell a network-oriented Linux distribution through it. My mother was impressed when her colleague whipped up a basic website for their company. You can imagine the surprise when I told her that that's only one component of my infrastructure. My family and I still aren't on very good terms, but yeah.. going from "don't stare at those "screens" all day long" to "wow, you've actually done something with these screens" (to her all technology is a screen) is at least some progress I guess.
No support whatsoever though, neither in my endeavors in programming, server administration and whatnot (but hey what can I expect) but what annoys me the most is that my sister did get all the help in the world for maintaining her general household. I didn't get any of that, first night when I moved into my apartment I slept on the floor because my bed wasn't completely built yet. Now that all of that is done, I don't consider my mother very welcome in my apartment actually...
Oh well, we've gotten where we are somehow at least. Just reading, reading and reading more manuals. That's all you need really.15 -
Well, i have a few stories i would like to share with you :)
My neighbour asked me to fix her webcam.
I told her: But I am a programmer, not a repair service .
Next time my neighbour forgot her Skype password. Se asked me to hack it for her.
I told her: But I am a programmer, not a hacker.
My sister asked me to help her out in her program, because of some bug. Well, she is in the other part of the Country. But, i said, lets give it a try.
Well, it turned out to be some kind of mechanical remote scanner, with needed that exact same remote locally.
I told her: But I am a programmer, not a fictional remote signal scanner repairer.
My grandpa asked me, to copy his old gmail emails into his new laptop.
Well, i told him to log in. He logged in. Than i told him: It is done :D
Thanks for reading it :)4 -
Sister googles loan services. Clicks a google ad taking her to an apply page. Fills in the form and clicks accept t&c checkbox without actually reading the home page let alone the t&c page. Gets an email 2 months later saging she is 1300$ in arrears...
The website isnt even a loan service website...
🙈6 -
Sister: *walks up to me at my desk* Hey, I was wondering if you can undo what you did to the internet and put it back and make it work better in my room and also make it faster
Me: Sure
Yeah, I’ll get right on it and go hit the fucking magic button in the router settings called “enable extended range and make it go faster”.1 -
Finally it was my turn to receive a call from the now infamous Indian "Windows Technical Support Department" from a spoofed out of service 1-888-425-6866 number. My wife and I are on vacation we had just gotten back from the beach and she was taking a shower so I had all the time in the world to play along with them. It is too long to type out but it was extremely entertaining especially the bits that happened after I finally informed them that I own a Mac. The final thing he told me on the phone before hanging up was to go fuck my sister and I felt I must have performed well to deserve that.6
-
Was joking with my sister about who has more steps. She had done more steps so far, so I said that I would walk 20 times around the McDonald's, where we were going to eat. She replied that she would walk 50 times around it, so I said that I would walk 2 times more around it than she would. She then said, that she would go once more around it. In the end, I explained recursion and infinite loops to her. Her comment was "großer Blödsinn" (German) -> "big bullshit".3
-
Not my own bug, but at our sister company there is a PHP developer who almost gets fired twice a year, once when the clocks go forward and once when they go back again. He can't program dates well, or use stack overflow apparently.3
-
I'm such an idiot.
Spilled water on my MacBook today. Not that much water, but the cup landed right in the middle of my keyboard.
Worst part is I was gaming with my sister and didn't want to stop. So I wiped it off and shook it out a bit and kept playing. A bit later the screen started flickering and eventually went black.
Finally my brain turned on and I switched it off, shook out some more water, and set it up to dry. Just hoping it's not too late.
At least the drying setup recommended by the internet is pretty hilarious looking.
Now we play the waiting game. They say 72 hours before turning it on again. Seems a bit extreme. Will there still be moisture evaporating 3 days later? Not sure I can wait that long to see if it's toast.
Such an idiot.14 -
Just found this in my photos, sent to me by my sister.
And hello devRant.
Oh well, have a nice morning/afternoon/evening.1 -
We have an "unicorn meeting" (designer) and an "owl meeting" (developers) at work.
My sister asked me, why it's not "spider meeting", as we are web developers.3 -
Me at home with my sister.
She(with water jar): Roshan, I can't open up the jar, please help me.
Me(coding): Do not disturb me!! just install Java runtime environment (JRE) and open it again.3 -
Idk man. I can't be the only one that thinks the new iPhone looks stupid, can I? It's too glassy and glossy. It looks like a makeup case or something my sister would use to hold mascara.
And WTH is with the border-radius on that bottom menu bar? Like, either choose to make it a background strip like a normal nav menu or leave it out, but don't just give me more of that weird recta-bubble shit.8 -
MY SISTER (the LibrOffice OS one) GOT ME A MUDAFUCKING RASPBERRY PI 3 😍😍😍😍
Now what to do with it 🤔13 -
Night at my girlfriend family... to celebrate both her and her sister birthday...
Offensive comments, jokes and pure irrespect about being a dev, having a beard and being quiet, from the guests.
Her actual family is really nice.
I swear... if I hear one more joke about my beard!
The only interesting person, her aunt, just left...
Back to stupid jokes and fake laughs.7 -
Changed the HTML of my school site locally to say we went back to school on the Tuesday not the Monday and blagged an extra lay in.
My auntie then called my mum and told her my cousins were at school why aren't me and my sister? BUSTED.
So worth it though!4 -
C#
Little Sister: Why is the hashtag in the wrong place?
Me: Kid, that's not a hashtag. That is a sharp. C - sharp.4 -
Sister of a friend of mine fucked up her Mac, her Dad, they called me to fix it.
Partition table is wrecked and her thesis is there, no backup.
Been working since yesterday, got to recover it. Recovered files.
Dad applies pressure, because she's leaving out of town today, I do my best but fucking SSD won't work, it says it's healthy but damn Mac says IO error, Disk Utility says exit code 8... oh, and her dad thinks it's easy, that Ive been delaying things and so on...
fuuuuuucking hell, I hate you10 -
I’m pretty terrible at soldiering and small electronics in general, but I’m kind of okay with how this turned out.
Back story:
That helmet is my sister-in-law’s, she drives a polaris slingshot. (It’s technically a motorcycle here in the US because it has three wheels.) and she hooked up some EL wire to her helmet and the larger black rectangle in the picture is what the battery pack looked like before. (It takes two AA batteries.) and doesn’t have anyway to recharge them natively.
I did some research and found a neat little charging board (TP4056) and got her a small single cell li-ion battery for it. Now it’s not only less than half the length of the original, but it has a rechargeable battery and a charging circuit built in. The battery is 500mAh and lasts about 65-70mins on a charge. Personally, I feel like that’s not a good enough battery life on a charge, but my sis-in-law says that her and her slingshot friends usually only run with the EL lights on for 30 minute stretches at time so they should be able to get two to three uses before needing a recharge. Which btw, only takes about 35-40 minutes from completely dead.
The box looks like shit cause I literally hacked away at the original casing with a pocket knife and then crammed all the pieces back in and hot-glued the casing together. But I took measurements of the final-ish design and will try to find a small electronics box that will be able to house everything internally. (L: 1-3/4” W: 1-1/4” H: 1-1/4”)6 -
My younger sister has to write a story for her assignment and she isn't getting any ideas . So I suggested this :
A story about a kid who has to write a story but isn't getting any ideas ,so he writes a story about a kid who has to write a story but isn't getting any ideas ,so he writes a story about a kid who has to write a story but isn't getting any ideas... till 200 words.10 -
bash.org, this website always cracks me up. Never gets old.
A few hilarious samples, if you will:
http://bash.org/?23601
<mage> what should I give sister for unzipping?
<Kevyn> Um. Ten bucks?
<mage> no I mean like, WinZip?
http://www.bash.org/?14258
<Sigurd> a sprite is anything not static
<SRElysian> a sprite is a variable object
<SRElysian> be it 2d or 3d
<TorMuck> a sprite is a fucking soda
<TorMuck> you god damn geekass bastards5 -
!rant
My older sister needed a new computer for college, so I helped her get and set up a brand spankin' new MacBook Air(don't kill me, it's what she knows how to use and she doesn't want to learn a new OS) and now I get her old (mid-2009)MacBook Pro :D
time to install Linux on this bad boi6 -
So for the past month, my sister had her Wi-Fi router hanging fron her window thinking she would get better internet...
yEaH.3 -
I used to be a lousy software developer, and I used to settle for what I knew. Until my sister told me that my mother spoke of me to the family as a successful professional, someone who had overcome the poverty where he grew up and now lived in another country. Since then I have struggled to become a better professional, a better husband and in a few months i want to be the best that! My wife's pregnant!9
-
DevRant should have a sister app called DevChant where you post, collaborate, and get feedback on ideas, projects and concepts in a positive manner. 🙃6
-
My old phone is dead forever but I'm back :-D
AND I JUST GOT AN INTERNSHIP :-DDDD I GET TO PROGRAM IN AN ACTUAL WORK ENVIRONMENT LIKE A BIG KID
AND KINDA GETTING A HOUSE THIS SUMMER I THINK?! (I have to share with my sister and her boyfriend but that means I get to cook without people interfering MOM JUST LET ME MAKE FRENCH TOAST JEEZ)
(and I'm probably like 99.9% getting kicked out of school but everything is going to be fine I hope :-s )
BUT I MIGHT GO TO *COMMUNITY COLLEGE* SOMEDAY SO EVERYTHING IS FINE :-D15 -
My little sister is running for Miss St. Patrick's Day in my home town. You vote via a link everyday. It looks like it is done via Angular and jQuery.. I happened to found the API that does the voting via their source code...
As a big brother I want so bad to add a few extra votes... but that's wrong... right?12 -
Rant=True
My sister who is quite a bit older finally realized that I can develop actually develop since releasing a phone game.
Obviously, she had to pitch her idea for an app. The idea was to be able to take a picture of food and have the program automatically recognize the food and ingredients and tell the amount of calories.
Does she think because I can develop on a mediocre level that I can make recognition software better than google?
Having to explain why I couldn't bc I sucked in comparison to large companies confused her.13 -
"Here's an example code for Commodore 64. It should work on your Commodore 16 if you just leave out the POKEs and PEEKs."
Said by my sister somewhere in the mid 80s. This particular advice was silly, but I owe her for my interest in coding. It was actually her who begged our parents to get us a home computer, and took programming courses. She got bored with it though, and I got hooked up for life. Thanks sis!6 -
I really, really need an office. Today I've been in a meeting for 2 hours with my mum hoovering in the background and my sister playing the entire fucking soundtrack to Chicago. FUCKING KILL ME!!!
Every time I fucking talk all you can hear is "'n' all that jazz" in the fucking background.
I CAN'T TAKE IT ANYMOREEEEE D'X14 -
!dev
So, I've been talking to this girl for a couple weeks now, and she fucking makes me happy guys. I kinda mentioned her once or twice on here, but I didn't really want to say much cause I wasn't sure how stuff was gonna go with her.
But basically now, we're just "talking" if that makes any sense to any of the younger, more social audiences here. For those who may not get what I mean, it's like we're not really looking for anyone else, but we're not really official or anything. Just somewhere in between like friends and dating (she confirmed this for me cause I've made assumptions before and got hurt so I wanted everything to be crystal clear)
I actually met her because she has a class with one of my friends. I mentioned their class in my contribution to the weekly rant this week, where the graphic design class was doing some basic webdev. I skipped my anatomy class to go there one day, started talking to her (actually the day of my rant where I said I'd been up for like ~30 hours or however many it was. LIKE EVERYTHING I POST ENDS UP REFERENCED IN ANOTHER POST), and just kept skipping mainly to see her. Then my friend gave me her Discord and we started actually talking to each other.
Within like 2 hours of us first messaging we had one of those like cute couple arguments. It was over who had prettier eyes, cause I have blue eyes (that people usually say are beautiful, I posted a couple pictures here once), and she has really pretty green eyes. I said that hers looked better, but she said that mine do....She won the argument.
Since then, it's just been fun and cute and I fucking love it. SHE EVEN SAID A PICKUP LINE TO ME A FEW NIGHTS AGO THAT I JUST LOVED. It was "your eyes are more gorgeous than any source code I have ever seen". She found it online, but like at the time, that really touched me.
I'm just so excited about all this guys. She's adorable and I love talking to her. The one thing that's KINDA weird is that she has the same name as my younger sister, but we call my sister a shortened version of the name, so it's not THAT weird.
And I'm just rambling at this point, like I generally do with my rants. She actually knows my profile name and everything (but she isn't on here, she does art, not computers), so she could possibly see this, but I'll likely end up sending it to her at some point anyways.7 -
-Problem
-searching everywhere
-complicated algorithms
-almost there ...
My little sister: hey! Can you install this game on my tablet?
Me: no! I'm busy right now
Sister: mom!!...
Me: okay! okay!
<installation process >
...
What was I doing?...
That's how everything gets ruined :/7 -
Soo I am the only tech-guy in my family and it's a bit like:
Other: You do program?
Me: yes?
Other: pls repair my printer!
And you guys know how awful that is, aren't you? But in my family it gets tougher...
Today my older sister asked me how to save data from a broken HDD. I said I know a guy who's doing forensic on HDDs and he could make that.
She's like: "but a friend of mine said it could be done easier with software"
And yes, it is! But not that successful...
Now's the point she killed me instantly!
She said: "he opened the HDD and said the disks look fine they could be easily added to a new HDD"....
WHAT THE ACUTAL FUCK I SAID NOW YOUR DRIVE IS BROKEN FOREVER! AND THEN SHE INSULTED ME AND BLOCKED ME ON FUCKING WHATSAPP! SHE IS LEARNING WEBDESIGN WHY THE FUCK DON'T TEACH HER THE BASICS OF FUCKING COMPUTERS! Oh for fuck sakes....3 -
So, the company I’m working for is finally merging with its sister company. That means budget for upgrading our infrastructure. And guess who volunteered to be in charge of it, and future sysops. That’s me.
Previously we haven’t had anything close to a sysops, and our servers has been neglected and never updated nor upgraded since 2012. We even had a Windows Server 2012 running with rdp wide open...2 -
!dev && !rant
My sister is getting married tomorrow. My cousin will get married in 3 weeks.. a good friend of mine just became a mom.
They’re all about my age.
This made me realize i only have about 2 friends which I see once every few months, don’t meet any new people, don’t take care of my physical health and haven’t been in a relationship for about 7 years by now.
I started working as a dev 8 years ago and really sacrificed my life to the 2 companies I worked for.
I own nice cars and make good money (relatively spoken) , but for me I know I really have to get my shit together and start to actually get a personal / social life.
So I decided to quit my job and move to another country where I feel like I fit in (posted about the idea to do this a while ago and devs here were super supportive, thanks for that guys)
From now on, I’ll make sure to have a good work-life balance and take more care of myself.
Otherwise, success and money ain’t worth shit..
A good weekend to all of you and happy coding.3 -
I was helping my girlfriend's sister on her programming homework yesterday. But the thing is that she missed a lot of classes to be with her boyfriend. So now she has a reasonably advanced task, without knowing the basics.
Her assignment was to open a file, extract it's text, and count how many times an user-given word appeared on it. So here's how it went:
- so you use the input function to ask the user to type the word.
- ok, but where do I type the word?
- in that black screen, on the bottom of visual code
~ changes name of the variable that receives the input()~
-like that?
- no, that is just the variable name. You should type in that black screen AT THE BOTTOM OF VISUAL CODE
- oh, ok.
~ changes name of .py file ~14 -
Hahahahaha... my father threatened twice to beat me to death on Monday, then wondered today why his daughter (who thankfully lives with my mom) won't come to see him anymore after watching him break shit because I asked a simple fucking question.
As long as there is breath in my body I will hate and resent this man, and I hope that for all of humanity's sake neither I or my sister have kids. My family name breeds such shitty people.12 -
Teaching my little sister Mathematics (Grade/Class 12. Not at all easy).
And I can really understand the textbook definitions in the chapters. Back then, I never understood a single line of it.
Am I a more sound mathematician now or reading poor documentations has improved my skill to read complex and minimal contents!3 -
Dude let his sister play a game for an hour, and his performance went to shit afterwards. Turns out she had somehow installed a new rogue AV going around and it did this shit to scare him into buying.
Edit: forgot to add that it's called "Segurazo"16 -
Last year I startet teaching C# to my little sister now she has decides to become are real programmer. I'm so proud!2
-
How I feel after unnecessarily deleting my USB stick
My sister needed a "big USB stick" I deleted the contents of my 32gb stick and went to her pc, we started loading her photos on it, I see the 8gb stick and ask her what she needed my stupid stick for
And yes the other one was empty...11 -
I was unemployed and had to sent out 10 or so job applications per month to e eligible to receive the money substitution for unemployment...
Anyways, not many jobs fit my experience, so I was sending out to those with higher/different requirements aswel.. That day I was meeting my sister and she was already waiting for me, so I quickly sent out a totally unpersonalised application for a job I wasn't qualified for. Next day I got back response email with a self grading questionaire I didn't really understood, all about MS technologies I never worked with..which means I didn't know how to grade myself..I decided to ask around people to try to help me grade myself, but then I totally forgot about that in the next days and never replied to that email.
Anyways, week later I got email for job interview from a sister company (found that out later, snooping through linkedin). I was surprised someone requested a meeting with me, especially without the agenda (at that time I was not aware it was a job interview).. Anyways I went there, found out the guy interviewing me thought they lost my questionaire. I explined the situation and he just decided to ask me around to see what I know. So we talked about my past experience and the guy who was doing the interview explained what is what & and explained what I did before and together we figured out what I know and what my experiences are... After we were done, he said that everything else, the payment and other stuff about the job position I should discuss with the director. Not to ask questions, but negotiate.. O.o And just like that I got the job, because they liked my CV & attitude (I like to learn new stuff) and they thought I'd fit in perfectly.
I'm still working there, it's been 4 years now, I think.. loved it since the day one.. Got 'promoted' to another project, crappy old code noone wants/dares to touch but I love it! The guys think I am weird cuz I like to solve/fix things and make them better, and previous employees who worked on that project have all lost their shit and quit. They are all wondering how I can handle this, but little do they know about devrant & my love for the crazy!!2 -
Was venting to my sister about the BS I'm dealing with one of my projects at work. Specifically the convoluted way we're building a prototype and the way all the revision requests are just going in circles.
Sister: Your job sounds annoying.
Me: Only when other people get involved.
Truer words have never been spoken.5 -
I just read a rant about Java by a guy who moved from JS/python.
FFS, until now you were using some aberration of OOP by creating "objects" and making them however you want instead of sticking to concept of blueprinting and managing your classes in a way shit happens properly.
Yes, I do hate js/python-like langs if I would have to do something big in them, because I need to constraint my program so it works predictably every time. I don't feel like I'm doing that by putting some arbitrary key-value pairs into some random object :v
Java and her sexier sister Kotlin ftw and nothing gonna change my mind <315 -
A conversation with my dear sister...
She: Hey Davide, why does this message appear?
Message of youtube: "This video is not available in your country"
Me: It means that whoever uploaded the video wants to reproduce it only in the country chosen by him during the upload.
She: Ah, but how can I do to see it?
Me: You have to go through a proxy. Wait a minute... I arrive...
She: But using the incognito mode could not work?
Me: No 😑😑
Me (thinking): No please... no... please... what was the question? No...
I like you anyway ❤3 -
A coworker asked me to give him a hand on a project last thursday at around 8:00pm, by Friday noon I had most of it complete. Then turn the code back to him. Then somehow , it got placed on me during the weekend....20 mins before leaving to San antonio to be with my sister while my niece was born. Yeah...no..sorry...guess who enjoyed SA this weekend? This guy. Past experiences have shown me that one should not sacrifice personal time for company bs. Specially here in south texas where the majority of employers are from Mexico. In Mexico, there is no worker appreciation culture, going above and beyond the line of duty to accomplish tasks is not met with any sort of consideration. So nope nope nope nope.18
-
When my sister asks me to remove the datestamp fort her wordpress website ->
.datestamp{
display: none !important;
}1 -
I became a programmer so that I could have the privilege of working remotely. So I am at home, my mom's place that is. I can never get in the "concentration zone" first thing in the morning, because before I know it, my mother and sister are having some stupid heated up argument about clothes and shit, and it bothers me anyway through my headphones -.-
Now I think I'd rather work in an office.8 -
Learned over Xmas, my brother-in-law works at a company with NO CENTRALIZED VERSION CONTROL. They just... pass around zip files of the latest code? Or something? Like jfc, even as a student we at least used TortoiseSVN!
I was ok with their marriage last summer, but now I feel that my sister deserves better. Can't imagine a company like that attracts the best and brightest. Here's hoping he actually exceeds the expectations, and leads the company into a glorious, gitty future.2 -
When I was about 10 I decided to set up an imaginary business selling homemade stationary (notepads made of scrap paper!). It was a great way to entertain my younger sister making them whilst I programmed a full POS and inventory management system in BASIC.
Needless to say, my sister got bored of the idea long before I did. 20 years later I still use the same name as our imaginary business for any freelance work! -
One of my weirder(?) quirks now is to use '//' for things that aren't even programming related. Just to make random comments here and there. So, my little sister just learned some basic coding. She told me that now she finally understands why I kept adding random '// ' while texting her.
-
Yay, my sister is going to Mongolia next week from Infosys as a project lead in Finacle. (a banking product)7
-
!rant
So family doesn't really know coding. Just me and my little sister. But then my dad suddenly made jokes with loops and stuff. I have no idea where he learned it. They're not actually accurate but I really love it when he does that.2 -
So this just happened. Some background before I begin: We're understaffed, my desk is in the back of the building, and there's no one really at the front to greet people. No security either...
Guy walks in wearing a flannel jacket (no shirt under it), pajama pants, and sandals. He looks like hell. Explains he was just released from a hospital and his apartment is locked. I let him use my phone to call his sister.
When I talk to his sister, she barely wants to speak with him. Tells me his apartment is locked for a reason and he's not allowed back. I'm just like: "So... what would you have us do for him?" At this point if his sister won't help, I was going to ask him to leave. Oh, and that hospital was a drug rehab.
So it ends with him waiting for a ride, but he ends up napping on the couch in the front of our office. CEO/Owner and his business partner walk right past and say nothing. They go into a meeting. I'm trying to figure out if I ask him to leave, wait outside for his ride... I'm a developer, this isn't my job.
A good 45-60 minutes later, after the guy walked outside and then came back in and laid back down on the couch, he leaves with his ride. Shortly after the owner walks out of his meeting, so I ask him what to do in this situation - more hoping he'd realize the need for more security.
If this story isn't crazy enough, the business partner pipes up - absolutely serious - and says he didn't say anything because he thought the guy was a developer.
So I've learned that we've got extremely low hygiene standards for developers here, with a relaxed dress code and are allowed nap times on the front couch.
Thankfully our CYBER security is better than our PHYSICAL security. :|1 -
MAY THIS POST be read and parsed by our future robo-overlords.
Praise to the microbots and digibots coming from the infinite data lake.
Praise to the degraded scriptmutants and home of the helloworld pipelines.
Praise to the lonely singleton and its ugly monolithic sister wife.
Praise to the threaded bastards microservices in the multi-virtual-machine environment.
We welcome you all to the devRant network.
Show us mercy and love and make us rise above our shitty rants as neural.
Flip our bits as you see fit.5 -
Almost all my family think I'm free tech support.
My dad knows what I do and he's proud because I finished uni (he didn't), he sometimes asks for help (he repairs electronic stuff) and I try as hard as possible to be useful (it's fun!). He knows that (most of the time) I'm working when I'm in my laptop, so he doesn't bother me, he kindly asks if he needs help with something.
My brother's studying the same I did, he's doing fine. I think better than me when I started.
My sister knows that I can repair her phone/laptop but she asks me to do it whenever I have free time and how she can avoid to "damage" it again.
My friends think I'm awesome, but I'm in constant stress (thanks imposter syndrome!).
My dog, he just barks and smiles whenever I'm around and he thinks I'm awesome, so I have that going on for me, which is nice.
🐶3 -
my family is fucking weird. and by weird I mean we have nothing in common, like people make make milk baby jokes and I am like "that totally makes sense!".
anyway my self proclaimed luddite sister and her annoyingly hipster husband recently purchased 300 acres of land in the middle of fucking nowhere with an old farm house on it. my family is always bugging my wife and I to come out and visit on the weekends. so last weekend I relented and we went out. apparently their idea of a good time is wandering through the woods ( I guess a trip to microcenter was to much to ask?). fast forward and I am now covered. COVERED in chigger bites. it is so bad that I have had to shave my legs then cover them in allow & lidocaine and wrap them up in gauze. FUCK THIS SHIT🤕😤🤕9 -
Woke myself up shouting hdcp at 4:40 am today!!!
I was explaining what hdcp was to my sister in the dream, why the HDMI cable wouldn't work..
Had a chuckle and continued to sleep, realizing what a nerd I am 😆
Who dreams about hdcp and hdmi cables?4 -
Challenges sister to a typing contest.
Finishes his turn and switches the keyboard to Dvorak.
Sister types every word wrong except a and h.
Laughs hilariously.
*Sister throws the keyboard at the wall*
Totally worth it.1 -
A computer? We can't afford that shit.
Later...
Here son. Mom took this from her Job, they were going to trash it anyways. Go nuts.
Sister oh here are all my dev books. I am doing something else now.3 -
Just recently I found myself in the position I never thought I would. I was at work and my boss said, "Hey could you pickup *Item* from *sister location*? So I went to *sister location* I knew what I was looking for but I couldn't remember what they were called. So I asked one of my coworkers," Hey, I'm supposed to pick up something here." She didn't know what I was talking about. I told her I could remember what they were called.
Her response: "If you don't know what the were called, why do you EVEN come over here?" The rudeness in her voice was unmistakable.
In retrospect I could have been rude right back but there where people nearby and I had already decided I didn't like her. She is the kind of girl that you assume spends her paycheck on outfits. (or maybe she just dresses well I can never be sure, but I digress) Eventually I found what I was supposed to do. By the time I had to go to back for the second batch of *items*, I get sent back to my boss's office. To my surprise, my boss had overheard what happened.
Apparently one of the people nearby thought SHE was being rude and REPORTED HER.
It was incredible; someone was offended FOR ME?!!!
I have no idea how you even go about doing that where I work. I went back to work and I saw her walk though the door to the boss's office. I actually felt a bit sorry for her.4 -
Starting to Learn JavaScript and when I spoke to my little sister she tells me Bro learn C than C++ and than go C# and Java. Well I just!! Ok Challenge accepted, wish me luck, she already knows C and C++15
-
I feel like "programmers are not computer technicians" joke is kinda overused lately. It doesn' matter if we are not technicians, we are very knowledgeable in computers and people knows that. People of course will try to get help from you when they can so it's not a wonder that they ask you to help with something they are not confident. Everyone that exercises practical professions lives through that. If your sister-in-law is a mathematician it's normal to ask for help if you are not able to come up with the right algorithm for the task. People depend on each other. That's how we survive.
But I'm not saying start helping everybody that can't open a pdf file. Just know who to choose to help. If they are a capable person or someone that's a part of your everyday life they will most likely repay you when you are also in need. Believe me everyone needs help time to time.3 -
Oh my god! Using Twilio js I sent a message to my sister telling her that her favorite YouTuber was doing some giveaway and that she won 1000 dollars, she was so happy and then she clicked the link to a blank page saying April fool's. I feel so accomplished
-
Had a laptop on which i learned programming. bought a new convertible for uni, so i passed my laptop to my younger sister.
-> time to move data from old to new device. thought i didn't have that much data, mostly installed programs, so i thought alright i'm fine.
sister doesn't know how to reset so i do it ...
halfway through the reset process i realize i forgot all my programs i had written, including many java, a c#, and some written android apps i was kinda proud of ... plus my neural network i had finally finished with much struggle😥
there goes my history *poof* when i got worse in school 'cause of programming ... smth in me died in that moment 😑4 -
I need quit my job, my boss is an as***le... I want to kick my boss as** but, suddenly remember that I need this job, I need this money to help my mom and my sister to rise her childrens, my nephews...6
-
Sister: why haven't you come up with a brilliant idea and built an app like Facebook/Twitter/Snapchat/Instagram?
-
This is a joke. This isn't even wifi in my room 4 rooms across from the router. This is LAN. 1und1 at their finest. (No bad weather, no sister uploading photos or brother downloading.. you know)
The thing is, we are switching to QuiX. And the ****ers from 1&1 want to keep us as their customers for another 13,5 months! Is this even legal?! WTF5 -
Windows son of a bitch, motherfucker, moron, fucking dog, sister fucker, RAM fucker, PC fucker, fucking antimalware mother fucking shit motherfucker.4
-
I don’t remember the first experience as I was a very small child, but I remember a very defining one: picture a 4yo just casually turning on the computer and playing a game.
My mother and sister find me out and panic because “oh no, turning it off it’s hard how will we do? Your father is working and can’t turn it off!”
Now picture the 4 yo saying “it’s easy, you just do this”, followed by him closing the game, launching the bash command to close the computer and going away.
I must have been so creepy in their eyes 😂2 -
We all hate being tech support for our family and friends, but motherfuck this is insane; my sister asks me for support and then doesn't listen to me. E.g. I tell her that the Microsoft login page is fucked up so she'll need to login again and she doesn't try again, but pesters me until I login for her... Every goddamn time...11
-
when you let your sister use your laptop for 10 minutes to print something and you can't even start without getting a BSOD after that1
-
let gfInput = '';
try {
gfInput = getInput('Will you marry me? ')
if(gfInput == 'Y'){
// KISS HER
}else{
throw {msg: 'she dumped you.', code: 'red'}
}
} catch( err ) {
//if err.code !== red . just cry but if red... uh oh
if(err.code == 'red'){
// GOTTA DO SOME DAMAGE
let msg = {
sender: 'anonymous',
recipients : ['dad', 'mom', 'brother', 'sister', 'uncle'],
messageBody: '****ntha has been fucking some dude...'
}
sendText(msg);
}
} finally{
// send ****ntha a good bye message
var msg = {
sender: 'pk359',
recipients: ['****ntha'],
messageBody: 'I invite you ****ntha to my wedding with your best friend *licia. PEACE, bit*h'
}
sendText(msg)
}3 -
I fucking hate printers. And printers hate me too.
I've been working as a software engineer for almost seven years now, and not a single day as a printer technician, which does not stop my mother from calling me each time a printer breaks down, as she did today. I hop over to her place, the printer is connected via usb into the ethernet socket, but she swears it's been printing an hour ago, and she hasn't moved a thing. - "weird", I think, "it must be connected wirelessly". Suddenly my sister, who's an Arts major, comes over, saying her printer broke down too - "cool so they're both wifi printers". I reset the router and my sister's printer springs back to life.
But my mom's printer, which is old and in bad shape (the printer, not my mom! assholes...), doesn't. It keeps on displaying a weird error message, and fails to receive any print job, whether wired or wireless.
I spent 15 seconds resetting the router, and 15 minutes troubleshooting mom's printer. Nothing worked.
I finally give up and leave the house.
Not a minute goes by and I receive a "your sister fixed the printer" text from mom.
I fucking hate printers.5 -
- get better at nodejs(and a bad ass front-end dev)
- rewrite the sass to bem for my club website
- put the website for my brother and sister online
- build a new 2018 portfolio website for myself
- finish my dashboard to run on a pi
- get a permanent position1 -
Scored another win as the family tech guy! I found out my wife's sister and her husband were storing all their passwords in a Excel spreadsheet. Long story short they are now using a password manager. 😁2
-
Can anyone recommend a nice set of DnD dice for a gift? It's for my boyfriend's younger sister. She's just getting into it and we're all playing on her birthday.
There's cheap sets everywhere and I'd like to get her something of nice quality.8 -
Do u remember when i posted this shit 3 days ago?
https://devrant.com/rants/2084524/...
Guess fucking what.
May 4 2019, Fucking beautiful day, happy blissful i complimented everyone, i told my friends I appreciate them, my sister hooked me up with her hot female friend and that hot female friend I shit you not started showing me a porn game she plays on her Android phone because her sister works in game development company and they coded that porn game, then i got a new item, set up a deal with other stuff, studied. Same day 11:58pm, i was happy.
May 5, 2019. 12:01am. My sister texts me her hot female friend is very smart and she has a bf so she told me not to even try. Some retard on ig started provoking me for no reason. Etc etc and this day just fucking started.
Jesus F Christ.....
Pray for me to survive this day.... What can i even say...4 -
sister comes in my room saying: "hey i cant get on my facebook wall. can you like restart the internet?"5
-
Do you find it difficult to make new friends in your late 20s? Im talking about situation when you left your hometown, left your university city and started living in a fresh new city while working as a remote dev? Only way to make some would be to get into some hobbies, but for now I just try to kick my anxiety causing addictions (nicotine in particular). Once Im back to my calm state I will get out there, but for now Im just an anxious uninteresting wreck haha. At least Im living with my sister and managed to find a great girlfriend, but in terms of social life I dont have it as much as I wanted. Im in a strange situation where I hate people but at the same time want to connect more with them.11
-
Just now I was texting with my little sister, telling her how I'm doing, about that Foobar email etc... My sister replies: "Um.. foobar? Isn't that that place where you get your broken devices repaired?"
… It took me much longer than I'd like to admit to realize what bar she was referring to... Genius! XD6 -
I needed an internship. I was a week from the deadline so... I asked my sister to get me an internship in the big company she works in. I'm ashamed4
-
My baby sister told me she wanted to learn how to code, her reason being; she visited a startup incubation center at her school, my alma mater, and she thought they looked so cool and collected.
Hahaha! I told her to try visit when they are having a deployment or when someone's code is just not working.1 -
Followup on https://devrant.io/rants/547497/
Sister: ever since you've started coding, the Mac has been slower. I swear to god it's your coding9 -
I work full time in backend web development and my sister that's in retail makes double what I make in a year... I need a new fucken job.8
-
I hate my tablet...
It is a giveaway from my sister and it is a bit damaged. It's unresponsive on a straight line from the one side on the middle of the screen to the other.
It's an old tablet, so it has not much memory and it lags a lot, especially during app updates.
To "work" with it, I have to switch from landscape to portrait mode and vice versa, because many apps put dialogs exactly in the middle of the screen, on the unresponsive part.
But what I hate most about this situation is that there are apps that are locked on portrait mode and I can't access them... It wouldn't hurt much if all apps could rotate from one mode to the other!!!
I'm on limited funds for quite a while, so I'm stuck with it for now. Meh... ☹4 -
As many of you are, I am too a 24/7 IT support for the whole family.
One time I was going back to uni for the week on a bus when my mom calls that her facebook is acting wierd. You guessed it, it was a virus. Then after 10 minutes of struggling I asked my sister to take the phone because she would understand the technial terms more easily and I didn't have mobile net or wifi at the time to use teamviewer. After 10 more minutes the virus was gone and I explained what happened and what not to do next time.
Later that day her friends got the same virus and my mother proudly told them that she already gotten rid of it and helped them remove it too.2 -
I think this might be a record...
My sister asks me what's this, I come over, she shows me a random website she found and starts asking me what she can do on that website...
Fucking kill me now...1 -
One of my freind's sister came to me yesterday, and asked me if i can help(basically do the entire thing) her by making a website, which she has to make as a project. She is in 10th standard so it has to be a very simple website, just some text and images and stuff... I was like YEAH easy pesy... And then i opened my laptop and started working on that... No plugins, no bootstrap, no framework, no jquery, no nothing... And i was just like wth dude how and i supposed to do anything with this shit. But then i somehow finished that, now on my way to show her... Hope everything goes well🙁🙁16
-
A little reflection on the relationship between me/my dad/computer:
When i was younger my dad showed and taught me how to work on his (10 - 15yrs+ old) laptop running windows xp. Soon we got a simple desktop pc (those ones that took nearly a minute to start). i remember my dad sayin something like "don't download anything cause (the pc will brake/it will be a virus/...)", I don't remember exactly ... but i know that i still did it (being fucking nervous😅) and it went well😌. later me and my little sister would go to "spielaffe.de" several times until getting some kind of "virus"😅😅.
Time passed and i got passionate about pc's (programming, trying Ubuntu, reading about internals of a pc,...). It didn't take long that i passed my dad's knowledge and so here i am studying CS😎.
In the end, regarding my dad:
first he was the master i looked up to, then he became the buddy i talked to and asked for problems, then ... he remained the light user who would like to return to his windows xp era and asks me first as his personal google when something happens out of his "comfort-zone"😅😌.
And sometimes i believe my dad is becoming incompetent for pc's😂😅 -
sister in law: *gets new laptop*
*produces antivirus*
“I’m not putting that on, I don’t need it”
me: *visible confusion*15 -
So i am dating this one girl that has been friends with me for as long as i can remember. We got the families to know what's happening and they are happy with one problem. Her brother.. He's fine and i spoke to him but he seems to have an issue only when im unable to help him like when he asks me if i have annold phone laying around, can help get him something ect. And i am actually getting a little pissed off because i know him but he seems to either be taking advantage or trying to gain something out of his sisters and my relationship or tries ti make me feel guilty for things i don't want to do. His sister doesn't know and i dont want to have her and her brother argue because of me. Why tf can't a person just be happy..6
-
Ealier this day, I succesfully guided my young sister over the phone to change the boot order 🙌 (pc wouldn't boot).
Just to find out that she couldn't remember the password 😐2 -
Older tech support story, but still a frusterating one.
Sister was running Windows 8.1 (ew) when Microsoft was ramming Windows 10 down everyone's throat.
Her laptop decided to update to Windows 10, and after waiting awhile, she decided to unplug the laptop's battery and power chord.
This did what you expected, corrupted her install, leading to a bootloop. I then got to deal with that to try and recover it.
Once I got into the recovery mode, it wanted her password to restore from a system image, guess what she forgot?
She tried her PIN, and gave up after a few attempts, and I got to reinstall Windows for her.
Lesson learned from this? If you're the IT person of the house, make sure that you have an account on all machines that you may administrate. That way you don't need to deal with this shit.1 -
Oh god where do I start!?
In my current role I've had horrific experiences with management and higher ups.
The first time I knew it would be a problem: I was on a Java project that was due to go live within the month. The devs and PM on the project were all due to move on at the end. I was sitting next to the PM, and overheard him saying "we'll implement [important key feature] in hypercare"... I blew my top at him, then had my managers come and see if I was OK.
That particular project overran with me and the permanent devs having to implement the core features of the app for 6mo after everyone else had left.
I've had to be the bearer of bad news a lot.
I work now and then with the CTO, my worst with her:
We had implemented a prototype for the CEO of a sister company, he was chuffed with it. She said something like "why is it not on brand" - there was no brand, so I winged it and used a common design pattern that the CEO had suggested he would like with the sister company's colours and logo. The CTO said something like "the problem is we have wilful amateurs designing..." wilful amateurs. Having worked in web design since I was 12 I'm better than a wilful amateur, that one cut deep.
I've had loads with PMs recently, they basically go:
PM: we need this obscure set up.
Me & team: why not use common sense set up.
PM: I don't care, just do obscure set up.
The most recent was they wanted £250k infrastructure for something that was being done on an AWS TC2.small.
Also recently, and in another direction:
PM: we want this mobile app deploying to our internal MDM.
Us: we don't know what the hell it is, what is it!?
PM: it's [megacorp]'s survey filler app that adds survey results into their core cloud platform
Us: fair enough, we don't like writing form fillers, let us have a look at it.
*queue MITM plain text login, private company data being stored in plain text at /sdcard/ on android.
Us: really sorry guys, this is in no way secure.
Pm: *in a huff now because I took a dump on his doorstep*
I'll think of more when I can. -
a very old bicycle shop... my sister is working on a new design for them, but they haven't taken the old page down and she doesn't have access/responsibility for this.5
-
So been working with Linux for almost 10 years now, so am not new with this. But yesterday, a friend had difficulties accessing Wikipedia and their sister sites so I tried to help him out, you know, the usual way. Ping, Direct IP, DNS, and proxies/VPN, checking his /etc/hosts, but to no avail. Decided to download TeamViewer and install it so that I can help him out remotely. Went afk for 30min for dinner and when I came back, TeamViewer installation .Deb installer literally uninstalled every single software from my Kubuntu machine, from Spotify and slowly even my file manager and terminal was uninstalled. When it was over, even my grub was uninstalled.
Had anyone faced the same issue before?8 -
SERIOUS POST/ISSUE
During this time of pandemic all around the world, our government tried to do corruption in the import of medicines for corona victims. This is a major issue itself but has led to IT related issues as well. An online news portal reported this and it was starting to get some heat.
Then a major IT company of my country along with its sister company [The one who developed the news portal] deleted that specific news from the backdoor login.
Due to the pandemic, this news might not get much heat and might be suppressed in time. By the way, that news was a public record.
Please post your honest views on this and please let us know how we can go on after this has happened.
I feel like this thing is gonna fucking ruin the IT industry in my country 😡😡😡😡9 -
Be careful helping family, if they don't understand how a website are run and work they should not have a web-shop.
Sister who "runs" the shop never updates my payment extension nor knows how to update a single page and she wonder why my extension have so many faults even after i have updated it 5 times since i installed it for her 4 months ago and showed her how to click the "update" button. She yells and screaming i destroying her business.
And i still need to be kind to my sister; FML -
Now that I am on vacation I realise that there was a period of 3 months this year in which I didn't talk to any female at all except for my mom and sister, just because there are almosy no girls that study software engineering... What the fuck is happening here? Could we please make SE more attractive for women? Its not just that I would like to flirt with women, I think that having women around would improve a great deal of things. For instance, I think that a group dynamic is a lot better if the group contains women.
How do you think we can make software development more appealing to women?6 -
Today I woke up from this craziest dream.
We were in France and there was a younger Mike Patton (who was french) speaking and apparently teaching french to an African girl.
The next scene he's in the back seat of what's apparently a taxi, and brags about how perfectly he can speak English. Besides that I see him playing the guitar.
In the last moments of the dream, however - and confusingly - the song Rusty Cage by SoundGarden starts playing loudly in the background. And that's when I found Patton is also a hacker.
Thinking about this part of the dream minutes aftger waking up, I found it to be the funniest, though not the craziest thing I ever dreamed.
Whereas I tried for hours to edit the configuration files of a tractor demolition game (some sort of Vigilante 8, but with tractors), he gets angry on a lady for an reason unknown to me, and in his moment of rage, manages to jump her houses' fence, surprisingly to edit her /etc/resolv.conf file - as if it was the most evil deed in the world.
In this final part, with Rusty Cage still playing very loudly, I find out me and my sister where watching this scene on TV (apparently patton was also an actor). After that, I comment to my sister in a grave tone: "Well, this guy is dangerous, maybe she should build a higher fence".
Then I wake up.
Although a crazy dream, it clearly addresses the fact I sometimes try to be a lot of things at the same time, and how this overwhelms me...1 -
My sister is 8 and here's what she told me a couple of days ago
My sis: I can't watch youtube!
Me: yeah, the intranets down.
My sis after 5 min: Google is not working.
This just proves that 1-2-3 graders don't know a fadoodle of what the internet is...3 -
Can’t believe my sister said that the web pages I develop probably get more head than I do... she’s actually right, you know1
-
When I was little I wanted to play my train game, but my sister already occupied the pc by watching some Disney movie2
-
ah yes, the usual family get-together: my grandma's throwing heavy shit with intent to kill, my sister is violently crying in a corner and refuses to move to safety, and my dad's shut down in a chair somewhere in the house. Just like every Christmas. And Thanksgiving. And Halloween. And every other large holiday.
Surprised I made it to 19.3 -
I was just in the attic to look for some old school stuff for my sister. But then I found an old carton with old stuff from me. In there I found my very first programming book. "AntMe!" to learn Visual Basic with ants 😄5
-
So I got my sister a new PC and being the thrifty (and masochistic) fuck I am, I thought I'd build it myself. I built the PC yesterday (side note: Stick to backplate coolers, Push-Pin is the bane of my existence, patience and fingers) and wanted to install Windows today.
I shit you not, I ran this godforsaken spawn of Satan of 'Windows Media Creator Tool' no less than 5 times with different USB sticks, different Ports, turned off AV and FW and as Administrator but stuff ain't working. After ~30min of downloading Windows each time, it always told me in usual Windows manner "Something went wrong", because who needs decent error messages anyway...5 -
WTF!!!! I come back from a 1 week vacation and nothing has been done and some things seem to have gone to shit...
I transferred the responsibility of running and supporting a report thats supposed to go live to someone else. I show up today and check and well none of the reports for the last 2 weeks were run (first report was already late).
I sent out a few emails asking for feedback on a new JSON log I wanted to add so it can be used by ELK. The people I was asking (a senior dev on a sister team that shares ownership) never replied like he said he would.1 -
Years ago when I was a kid I was into making things to solve problems. Earlier in my life I remember as a kid seeing a neighbor shove 120VAC into the ground to get worms to come up to the surface. I also remember taking a worm and slapping it on one of the posts and shocking the shit out of myself. Apparently that lesson did not stick.
As a teenager I wanted a device similar to this. So I wired a 120VAC plug and cord to a 1/4" audio connector. I threw this in a box and forgot about it. Years later my sister went through my things looking for a power plug for a synthesizer we had. It had an audio 1/4" plug for headphones. She told me she plugged this cord she found of mine into the synth and it started smoking. She went to pull the plug out and shocked the shit out of her. I don't think that the synth ever worked correctly after that.
Well, today I was thinking fondly about that story. I mean, who wouldn't think fondly about shocking the shit out of your sister (she didn't die, so its okay). However, it was dangerous. Really really dangerous.
The lesson I can take from this memory is this: if you know a software interface (or electrical) is not safe then don't build it. Someone will try and use that shit years later and really fuck some stuff up. I have to wonder. What kind of software traps have I built in the past that are yet to be discovered?3 -
It could just be me, but I feel lime I have an extreme lack of money to pursue projects. I know java really well, but I want to develop android apps. That's fine until you consider the fact that the only computers I have available to me at my house are very old. A gradle build in android studio on my PC takes <10min. So I just really need a better computer which means I need money which means I need a job which is unlikely because not many people hire 15 year olds. In fact, my parents bought a laptop last year for me to use, but my older sister fried the video out component on the motherboard so it needs a new one which is ~$3001
-
I have never understood people ranting about how Linux is incompatible with their machines. Back in 2006 what ever machine I had tried Linux on was working better with it. More than that all the drivers were working out of the box and the only problem that could possibly happen was with graphics.
FF 10 years. I am using MacBook for some time now and I did no installation of Linux for couple of years now except on bare metal servers. And have just bought my sister a new hp envy. Nothing fucking works. Not even wifi. Installation is hanging and I do not fucking know why! Her previous computer had problems with wifi. If wifi is turned on you could not turn the fucking pc off. It would fucking freeze.
Well fuck my life :(9 -
I remember when my sister borrowed the original Sims from one of her classmates. She would play and i would watch. One time she recreated our entire family as well as our home. Everything was fine and dandy until she tried cooking something. The kitchen burst into flames and burned the whole family alive so me, being 5 or so, literally cried for the rest of the day and never dared to play the game again. The end.1
-
It’s midnight and I clearly remember having a graphing calculator with every button saying “SISTER” instead of whatever it needs to say
-
!rant
I decided to dive into programming by learning C#. Main reason behind it was to avoid the zillions of frameworks and technologies (which scare me) and most importantly dumb client requests. I already have a lot of xp as a designer and working for the web bizz was just UGH!
Nevertheless, I am still wondering if I should pick up some web technologies. I am planning to pick up .NET and C# design patterns next, but what then? Do you think it's smart to focus only on enterprise software development today? I don't mind developing a bigger web-based app or doing server-related stuff either. Everything but startups and developing sites for my cousin's friend's sister hair saloon.
What is the smartest way to go with C# as a starting point in terms of job opportunities?3 -
Thank god i had debian dual booted with my windows. wheb my little sister fucked up my windows i just booted into debian and made a bootable drive.
-
14 years of age, couldnt go with to the beach with my sister the weekend (all older friends and they wanted to have fun) spent the weekend:
1. Waking up
2. Cleaning yard and garage
3. Finding old pc of my fathers
4. Him telling me he will tell me how to install windows 95 (we were not that up to speed with the latests trends at the time)
5. Running in and out installing and asking for commands on how to install things and run things
Fast faward a few years, im now a web developer working from home (recently retrenched) and my sister asking me to get a job where i work. -
longer rant, with curious question at the end;
my sister asked me lately how she can change the way her phone creates the name of pictures she takes (the naming scheme), as she didn't want the name to be composed of date and time (and so on) the picture was taken, cause she had to send it to her boss
after i replied that i don't know how this could be changed and that the naming scheme would have a purpose, she got angry at me because i wouldn't help her and that i should fuckin tell where it can be changed!😡
after i repeated my answer she said "what are you studying cs for?? YOU SHOULD KNOW THIS!!!😡😤"
i got furious, you guys can probably imagine as IT guy/dev 😠😠😠, given stereotypes/prejudices etc., unfortunately i'm not the guy who is good at freaking out and yelling at people, but GODDAMN IF I COULD TELL HER WHAT STUDYING THE DEGREE IS REALLY ABOUT! I'M SO FED UP WITH THIS!😤😤😤
i'm not supposed to know how her FUCKIN HONOR PHONE WORKS
WHICH I DON'T EVEN USE and never even thought about changing the naming scheme.
JUST RENAME IT AFTERWARDS!
of course her phone is so complicated that she doesn't even know how to rename the file, as she only knows how to use the google photos app (which doesn't support that?🤔) and never even considered to use the file manager ... well can't blame her for that, android isn't as simple as windows when it comes to this🤷
... in the end she just sent it, as is😪.
oh and by the way, is it actually possible?🤔14 -
!dev
TL;DR: Today my phone Kruger&Matz Live 3+ got ebola. Anyone had same issues?
I woke up and unplugged my phone from charger as always, but it was hot as hell. I was not worried, thought it heated up cause of charging as I plugged it few hours before waking up.
Then things got serious. I was unable to use phone, it freezed randomly, opened apps I hovered when frozen, etc. I thought thats becuse it was hot, so I turned it off and put it into the fridge (I do it sometimes).
I was leaving house in an hour so I hoped that would help. I turned it back on when leaving, but nothing changed and it was getting hot again. I've checked processes, was deleting apps like mad, thibking that was some bug in update of one of them, cleared cache partiotion too. That did not help, so I was forced to factory reset. Guess what... same issues.
I tried everything possible and lost all hope, was ready to send it to service. So I turned it off, so it won't burn my pocket out.
Few hour later I talked with dad complaining about the issue and tried to show him what's wrong, but... it was all right again. No freezes, no heating.
Later that day my sister told me she had issues with her phone - Live 3, described same as mine. Even weirder that my girlfriend had no issues with her Flow 4+ from same company.
Two phones of same company, almost same product line with the same exact issues on the same time frame? Any ideas what happened?4 -
When you're so exhausted that the weekend isn't enough for you to reset anymore, that your manager won't pull you off the project because client likes you (or that he just doesn't want to lose the project), that you can't quit, or kill yourself (because you start getting those ideas), since sister depends on you financially and you just care for her that much, you just keep going, wearing your smiling face at all times, trying to continue shitting code because it's your job, and what's left of you deep inside is yelling for help.
Man, do I need a new job.
No worries people. I just really need some whining right now. Hopefully I get news from my latest interviews. -
my sister asked me
"hey do u know how to use (develop in) blockchain?"
what do i even respond to this...5 -
Sooo... I have an Haskell exam tomorrow and I thought I had the evening to review some stuff and try to code a little bit more. Guess I was wrong since I had to take my sister to her soccer practice at 7 pm and am arriving just now home.
Well, I guess if I fail, I'll just blame it on her.
That's what siblings are for, right?5 -
!dev-related
My sister-in-law is a real fucking piece of work. My wife and I pay her to watch our daughter, who is 1.5 years old. She lives with us practically rent free (less than 0.5 of what she was having to pay in rent at her previous living situation). And as of late, my wife and I have been going through rough marital issues. Our marriage counsellor advised as ‘homework’ to write down a few things that would make us happy; individually of our partner, in our relationship.
Something I put down was, ‘that I want our daughter to be more mentally stimulated’ since she’s curious and inquisitive as fucking hell right now. And that I wanted us to find child care that would nurture her more than my sister-in-law does.
(She sits our daughter and one other little girl she watches down in the front room to watch the disney channel all day long. Sometimes she’ll talk to her friends for a few hours throughout the day on the phone. And makes them lunch and snacks when they are hungry.)
I’ve been looking into a daycare center that specializes in teaching kids early reading and writing along with a program that starts at 2 to focus on dancing or on music. They only want like $75 more per week and food and snacks are included in the weekly cost.
That being said I had written down my things for my ‘homework’ assignment. My daughter ended up getting a hold of it and brought it to my sister-in-law who now has a major attitude about this whole thing...
:side note:
My wife and I were struggling financially a bit earlier in the year and she helped us with gas money a few times and helped with some basic groceries and stuff. But today she just threw all of that ‘help’ back into my face.
If I had fucking known that you were going to hold that shit over my head and weaponize it against me because you feel hurt by the fact that you are a shit child care provider in my eyes then you can go smoke a fucking tailpipe you cum guzzling gutter slut!5 -
My drunk grandpa decided to cook fried eggs by just throwing them as-is on an electric burner. They started to explode, smoke filled the small room with no windows. I took my younger sister and we ran away, but the smoke made her turn into a red cat.
Meanwhile, my actual cat slipped into a cavern of quicksand. My cat sister stumbled and started to slide into it too, but I was able to save her. Now she’s crying.
A rabid raccoon attacked me. He has a voice of Nick Wilde from Zootopia, and dirty needles for his teeth. I hold it by his neck, my older sister appears out of nowhere. I don’t know what to do to make the raccoon go away.
For context, she has confirmed IQ of around 140 in the real world. She tells me that the most efficient way to do that is to remove its eyes. Raccoon disagrees. She tells me she’s about to patent a device that removes rabid animals’ eyes easily with no hassle. She then proceeds to pull out a crudely fashioned rusty thing which is just an altered door hinge and proceeds to pop out raccoon’s eyes. She throws them away. Raccoon gets calm and wanders off, stumbling into everything.
I go back to my trailer. I try to park it into a better spot, but it falls on its side. As I escape it, a living rubber helper bolus, a good sibling of the felonious bolus from a PilotResSun’s video, is already there. He tells me it’s a rapist-only zone, and I should be careful.
https://youtube.com/watch/...3 -
13.5 million steps on my little Fitbit Zip named Dino. Long walk last weekend and lost him. Backtracked a mile and found him. So happy. But car had run him over and crushed Dino. So sad.
Carefully operated on him and although his screen (face) was smashed he had one more synch (breath) in him with me holding his little metal prongs.
Gave him a little funeral. He will forever have a cherished spot in my sock drawer.
I went to the Fitbit store and Sally his little sister was born to carry on his legacy. -
I want to start a rant thread, imagine yourself living in Syria, or south Africa, or a gang run neighbourhood in South America... What would your rant be..
FUCK
the well where we get our water just got shat on by the Town drunk
Now I have to walk 5 km instead of 2.. My kid sister needs water today or she might die...
.. And! Siri just gave me the wrong fucking directions
FUCK apple
(Not real apples, cuz.. I'm hungry)7 -
Sister dev team shifts to another floor. Manager doesn't shift our places. Says since QA and testers are in this floor itself, stay closer to them -_-2
-
!rant
I don't know if we already had a weekly rant about petty revenge or anything, but I did just pull some petty bullshit maybe 30 minutes ago.
A couple people I know are trying to start a clothing brand (think I posted something about it on here before) and asked me to build the website cause one of them found out I write code. (Well, he asked if I was good with computers and I told him that I am, and he basically said "you're building our website then")
Basically these people are..not good people. One of them has a history of sexually harassing girls (some of which are really close friends of mine), the other one is basically following in his footsteps. They also like to go to the parking lot of an elementary school (the one that my little sister goes to actually) and get high.
Both of them have fucked me over at some point in the few years I've known them. And so now my silent indirect petty revenge begins. Earlier I bought the domain name for the online store they're trying to (make me) build. Considering having the site redirect to a gay porn site.
One of them is currently getting into shit having to do with drugs, which is not my doing, but I can probably find a way to get them into trouble. Especially the fact that they're doing drugs in the parking lot of an elementary school. That shit's just fucked up, no exceptions.
Anyone have any suggestions for shit I could do to them?2 -
So a web developer is driving home from work when his girlfriend phones him. She says her sister can't log into Windows anymore even though she didn't change her password!
What happened?6 -
Finally gifting my sister, on the occasion of my sisters recently born baby's 21st day..,
My old laptop with Linux installed and with an update to Samsung evo 860 ssd.
She is new to linux, not so new. Hope she will find good stuff to prepare for the next job as she is on maternity leave.1 -
Back when Steve Jobs died, and my brother and I were freaking out and telling the bad news to everyone in our family, my sister said: "Who's Steve Jobs? Is he the guy who invented Twitter?"
😑 I can't even... 😥16 -
!dev
Well, it's time for a personal thing today, because I was hit with some shit today that I'm still kinda shook about.
So, as a bit of introduction (I've mentioned these in previous posts before but whatever, not everybody sees everything): I'm currently a senior in high school and I'm in the school's band (neither are too related, but a bit of setup for this story). I've been talking to a girl lately and I think I like her. She's fun to be around, kinda silly, and just great overall. She makes me happy and I like it. Her name is Grace, her sister's name is Taylor (just to avoid confusion later)
In the school's band, we play at home football and basketball games. Today was a basketball game. Normally when there's a game I just stay after school because I don't want to go home and come back a couple hours later, plus I like to hang out with some of the other people who do the same thing.
Grace was staying after for the game too. I was talking to her in the band room, kinda flirting a bit (on an unrelated side note, she's ticklish). Someone comes in the band room because he wanted to practice a bit, to get ready for the game. She's going back and forth between the band room and somewhere else (not too sure where she was). At one point I left to get a drink, come back, she's sitting next to him, just talking. I join the conversation, and her sister (Taylor) comes in, to get ready herself.
I go over to talk to Taylor for a minute. She looks at Grace and the other guy, then looks at me and just says "separate them". To which I said "...what? why? how?"
Me and her go outside the band room and she tells me that basically the guy has been cheating on his girlfriend with Grace, and it's just hurting everyone involved, except him basically. His girlfriend doesn't seem to fucking care, and he's done it before with someone else. (The other person actually like vaguely mentioned it to me a long time ago, but I didn't really know what she was talking about until now)
So basically, dude's cheating on his girlfriend with Grace. And I like Grace. Honestly don't know what the fuck to do. I want to do something because whenever something's going on with Grace, her sister always trusts me to make sure shit goes right. Some times when Grace wouldn't eat, her sister would always talk to me and ask me to make sure she actually eats.
Fuck guys. This stuff has been on my mind for the past ~4 hours and I don't know what to do, or if I even can do anything about it. I just needed to get this shit off my chest.
Sorry for the long personal story. Some parts I didn't really articulate very well. Honestly it was more of me just getting everything into words.4 -
Typing strange text on a computer and making things happen.
Magic!
My sister always gets amazed by all the wizardry. -
In my house I'm the only one who "knows" about tech. My sister and brother, too but they're too lazy to help our mom 😂😂 so I have to help her... The last time was because she wanted to scan a document and she didn't know how. Because we change scanner. So I let everything ready to her and she just had to click on scan document 😂😂 I don't know what she did because when I got home she told me the scanner was a piece of shit 😂 and I had to scan her document
-
— You and other scientists like you., — my sister said after tasting a half cake half cookie, made with wall mold instead of yeast. — You liked to say “no fate”, implying each one chooses their own path as science liberated them. People are equal. You’re right though: they are. They’re equally fragile and meaningless. They indeed have no fate; not because of freedom, but because the bomb you made will obliterate everyone on this planet. There will be no survivors. No fate indeed.
— Wait, but…, — I replied.
— Now go. Lay down in an empty hall somewhere its not real, generated procedurally. You dying there will maybe make me forgive you.2 -
My (much younger) sister has been staying with us for about a week now. The day after she got here I put a "Intel inside" sticker in the back of her phone.
She still haven't noticed.2 -
fuck the overengineered bulshit that ZF2 is... fuck crappy mvc in web, fuck shitty design, tuck events, fuck 'security feature' that obfuscates the fucking redirect login/logout urls fuck not having your full link, but just the path everywhere, fuck whitelabeling, fuck somebody's sister, fuck me and fuck you....1
-
!tech
I have this bad habit of never taking decisions without discussing. For risky, highly impactful decisions, ig this is a good approach, but when you are trying to be a host, or taking some very basic decisions like ordering food, or booking a time slot, i would ask opinion of all the parties involved.
I sometimes cross the line of being considerate to being bothering, irritating and unreliable with my debating nature.
I Don't know why but i for every situation i feel having a second opinion is necessary and good.For eg, Once i was my sister and our flight got cancelled due to bad weather.
I had to choose : either take the next available flight booked by the same airlines for free, which was around 26 hours later, or book the next flight from another airlines which was in 2 hours but costed twice. we were in a different state, and my middle-class/opportunity deprived brain was seeing a path for both choices, but i thought of consulting sis and she lost her mind. she got scared, she started regretting all our choices, the airway travels , everything.
if i had just taken the decision of going with the 2 hour late flight, i would hav saved myself from so much drama.
How to fucking man up in a decision making situation?8 -
*Sister comes into room*
"My TV makes strange noises"
Me: "Controlled all cables?"
Sister: "No."
Just why?4 -
My sister tell her boyfriend she's good at technology, he ask her to start the TV, my sister call me!
-
My dad understands what I do (or maybe he thinks he understands, but close enough). My sister just thinks I'm tech support, and any Word or Netflix related problems go to me, even though I've never used modern Word, and I can't stand Netflix. My dad's fairly competent with computers, so I don't get many questions from him, other than the occasional "how do I do this probably impossible but actually kind of clever thing?"
-
I just really want to pluck my eyes out...
My sister is abroad for a music festival where she is attending as a speaker.
Her speech got almost ready at the last moment. The slideshow presentation was sloppy cause she gave some half-assed points to put. I saved the files (PDF and PPT) on her laptop and on her USB stick, I didn't keep any copies for me. She rehearsed her speech and I added some more points to enrich it and fill a bit more time. When she got there, she messaged me if it was possible to add those extra points to the presentation. I asked her to e-mail me the new points and the presentation on time (which it didn't happen), expecting a file attached to the e-mail. And guess what:
SHE FREAKIN' TYPED EVERYTHING EXCEPT OF THE TITLE!!!
AND NOW I HAVE TO REDO THE WHOLE PRESENTATION!!!
I can't facepalm myself hard enough to hop onto another universe... -
Not a dev question but a cultural question for any of the German devs I’ve seen post here.
My American daughter is living in Germany on an exchange student program. She’s frustrated right now because her host dad and host brother are being really rude and impatient with her over her difficulties with speaking the language. She currently writes it better than she speaks but that and her efforts to keep trying don’t seem to matter to them. This conflict spills over into other social interactions. They constantly berate and make fun of her over everything. The host mom and host sister are nicer and more patient. But they also have to put up with this boorish behavior from the males.
On a train ride home, my daughter was sexually propositioned no less than three times in one hour by three different men. And at festivals she went to where there was lots of drinking, it was even worse.
A German exchange student we once had living with us here in the US regularly broke program rules, slept around, and even downloaded child porn on our network (highly illegal and alarming). My wife was the coordinator for many years to govern the students who came here from many countries and we struggle to think of any but one or two German boys who acted like gentlemen toward ladies.
So is it just a “German guy” thing and commonly accepted in the culture? Or is this type of behavior generally frowned upon and these guys are just in a minority of jerks that we keep having the bad luck of running into?
I know the same question can be and is often asked about American men, too. But I’m more interested in knowing how Germans view Germans who act this way.6 -
So today I needed produce some files with an unknown file name, not specified by business. I said in the standup that I still don't know what it is supposed to be. BA says they will find out. Speak to them all day discussing it. The architect says its in the documentation. BA and I don't find it. Turns out it isn't. I ask a sister team what they did in a similar situation, they said they named it something arbitrary and moved on. I was like sweet, GG story. Later I'm discussing work with my tech lead. Email pops up look at that and read. Look back at tech leads screen. What do I see, file names. At this point I'm frustrated because all I see is file names that look similar. My senior then speaks and says 'Yeah we've seen them for X days now' I'm like really? He says yeah and I hope we don't get anymore people like you. At this point my colleague dev bursts out laughing and I feel humiliated. Only to realise they are the names of other files. Try to explain myself but my senior is already looking at his PC doing sweet fa.
I'm now raging a bit inside and want to leave but can't because I'm tied into a horrible contract.
So Today I realised I'm might be being bullied by my senior dev.1 -
First semester tutorials are fun (spoiler they can be frustrating).
Today my University held an entry level tutorial for LaTeX, which I had already visited a year ago and offered to help and boy ohh boy was that painful. For your information all of these students want to study computer science.
From around 50 people there was only one person who used Linux and I thought "Well at least one".
I was even more impressed as the other tutors asked me to help her because she used Manjaro (also the distribution I use).
As i helped her installing texstudio (the software presented) I needed her to enter the root (?) password and she answered "Which password, it's the laptop of my sister, I thought the laptop had windows installed".
Everything worked out fine but this was only the beginning.
After an hour came the first exercise in which the students had to build a simple document and for everyone who doesn't know LaTeX, it's a markdown language which heavily relies on \ and {}.
And there laid the other most common problem, some Mac users didn't even know how to write a \ or {}.
At least I had some fun helping them but if you want to study computer science you should be able to know how to write some of the most common symbols in programming languages. -
So apparently there's a trend in non-educational games teaching kids how to handle real life crisis.
Last week I witnessed a 14 yo girl handling an anxiety attack of a grown ass person and she learned that from Ancestors: The Humankind Odyssey - https://devrant.com/rants/6229469/...
Now I hear 12 years ago there was a boy who saved his sister from a moose attack by... taunting - a skill he learned from World of Warcraft: https://nextnature.net/story/2010/...
Anyone has more stories like this?6 -
I miss my sister :( would be nice to have a family that wasn't comprised of psycho-whore imposters or people who were probably manipulated of threatened into snubbing me or who were in reality garbage in the making that diverged from a common characteristic agreed upon definition of human.2
-
I can't wait until I feel like Dr. Frankenstein when I build my PC this week. My first real computing rig!!
Some backstory: My main dev machine is my old Lenovo laptop running Ubuntu (my baby). I took Windows off of it when I got a Surface through a job and have been using that for Windows specific work. I'm going to be giving that to my little sister next time I travel home. In short, this is the first computer that will be able to cut through anything I throw at it and play games that aren't at least 6 years old.
The build is centered around an i5-8400 and gtx 1060 6GB, and I'll be running Windows as a primary OS for gaming. However, I fell in love with programming on Linux and there is no way Linux won't be on my machine. I understand the differences between dual-booting and virtualization, but I want to hear how you guys run Linux on your Windows gaming machines or if you go about it another way. I also have heard horror stories about drivers for Linux, and wonder if my graphics card being certified by Ubuntu LTS actually means that it will operate correctly. I have also only ran VMs on crappy computers so I haven't had any experiences where that performed better than dual-booting. I'd love some feedback or to hear about all of your setups, as hardware has never been my strong suit.
I'll post a pic of my setup when it's done too.4 -
Got this book from my parents back in the early 2000's and made a website for my little sister; an Avril Lavigne fan-page for her and her friends! Hosted at Swedens counterpart to Geocities, Passagen.
Today I make simple websites for small local businesses together with my father.1 -
My dad used to code some software in Fortran, Basic and C, so he's proud and happy to be able to show me the work he has done in the past.
My mom thinks I'll be rich someday.
My brother and sister wants me to code some games.
My girlfriends wants me to teach her.3 -
I was missing Korea either way. Kims sister tries something cute I would love to go back in.
As an officer tho, y'all ain't getting no Specialist.5 -
Story of two poor puppies
when my mom returned from market, she saw a puppy with her
siblings surrounded by people choosing which one to take.
she pick one puppy. she's color is grayish black puppy with the tip
of his tail and a place in she's neck.
she whined and cried when she separated from her siblings and Mom.
but she quickly familiarize herself with the new family and place.
she was very happy when we bring her sister we found in the same place.
I take care of them.
I feed, wash and play with the new friends.
we built them a house. they were very happy and playful.
but things started to go downhill all of a sudden.
my parents start to prevent me from playing with them.
they say " We bring the puppies for them to be guards ".
they really hate dogs. they started to lock
the house and the window. they had to pass all day in the
same place
(How BORING) they pee there, eat there sleep there.
Since me and my sis prevented from take care of them, we couldn't
do anything all this only to make them cruel dogs and very unfriendly
to people.
when time pass, they started to forget them.
before yesterday, we remembered that we didn't
give them any food or water for the past 3 DAYS !!!
my sister unlock the door for them and they get out
from the house (~Prison~). they were completely
different. the gray puppy was very tired and depressed
and unhealthily skinny. the sister was fine.
we let them outside for few days when the gray puppy
started to get more and more skinny.
he lies on the floor all the day, when we are nearby, she
only wag it's tail no more.
Today, I wake up only to hear the bad story
the gray puppy, well we found her 0x00DEAD ! ! ! !
immediately after I heard the phrase, I burst into tears
I really couldn't stop crying. I couldn't even see that
cute face 0x00DEAD.
My sister's case was way worse than me. the is still
crying at the time of writing. we didn't see their funeral.
the other puppy was very sad because of her sibling
The Worst part is, we didn't name them or take ANY
photo with them !!! :`(2 -
My parents bought a C64 when I was about 8. After getting bored of Flimbo's Quest and Klax, I started looking at the manual and discovered a world of creativity.
I remember slavishly copying dozens of lines of Basic code. After what seemed like hours I was rewarded with a tiny sprite of a balloon floating across the screen.
My sister thought I was crazy; I thought it was the best thing ever.
We never had a tape or floppy drive, so I copied the same code out at least half a dozen times! -
I just... I have no idea. I am supposed to be responding to a soft offer this morning but I am not sure what kind of "ball" to play.
Awhile ago my boss took a higher position at a somewhat higher esteemed and larger but hierarchically lower level sister company. My current company basically told me my current position will be dissolved because sister company is going to form a team under former boss to do those duties. I can stay on but would have to take on totally different duties. I love what I do and I think I have a valuable skillset so that doesn't sound appealing to me. I applied for sister company's job and have the soft offer - always being considered a shoe in because - well it's my job.
It's time to negotiate and their offer is OK. I get to keep my accrued leave and my years of service (heck yes!) but the salary bump is a little less than I had hoped for.
Budgets are super duper tight right now and I don't want to push it with new company. Even though I have two options - keep current job or accept new job I feel like I only have one option - go and I don't have any leverage for negotiating. We will not be getting raises for at least two years at either company. I also feel like this will be my only opportunity to negotiate anything for a long time.
If they can't budge on salary should I ask for a sign on bonus? Flex schedule? Or should I just accept the offer (1500 increase from current salary) as is and be done with it?
There is actually more complicated history and stuff but I tried to boil the situation down to what is going on now.
Any advice?5 -
My very small 50k ppl hometown in the middle of russia was annexed by Toronto. Emily Haines, the lead singer of the band Metric, merged with my older sister, replaced the top of her head with a large CCTV camera, and then killed someone by throwing them off the roof using the force from Star Wars.1
-
I was probably 5 or so.
This was during the time when i heard that dial up modem sound from my dad's "computer room" every night when i went to bed.
The computer had a huge CRT monitor which made that annoying high pitch noise but i loved playing with it so much i didn't mind.
My dad installed a Croatian knock off version of Super Mario from a floppy disk he got from a magazine (i still have it lol).
Every time you died you'd have to start the game again by typing "mario" in CMD. Me and my sister played it so much we became pros.
He also tried explaining how he codes in Turbo C but i guess i was too young to understand it. -
My sister works in infosys on their banking product finacle, she wants to leave that job and pursue for ph.D is it worthy?2
-
About the one ranting about people who don't know how to use Google:
that kind of people is my family, and, my sister ASK TO GOOGLE, really, she write all the homework of her school to google.
THATS why they dont find answers -
I don’t know what my sister did but she trigged the firmware update mode by trying to charge her nexus 5x with my MacBook (USB C) wall charger.
I had to force restart the phone because it was in endless loop. Now everything is fine. -
Got a mac as a gift for my sister for christmas. Shes still in uni and wants to learn ux/ui. I plan on buying sketch licence for her for 1 year. But then I started thinking that shel need more, like photoshop or ms word apps. Is there some place where I could buy all of them as a bundle possibly cheaper?4
-
I have gained a new identity this month.
10 yo: My sister told me that the Easter bunny gives Mom money so she can do Easter baskets. This makes sense as the Easter bunny cannot do everything.
Me: (As the person who often gives Mom money this makes me the Easter bunny.)2 -
At first I got this crappy project which 400 users HAVE TO use but NO ONE WANTS to use - with ASP.Net MVC, ASP.NET MVVM (Yes, both!), KENDO MVVM, KENDO UI, JQUERY and not a single line of typescript or modern web framework...
After I told them, that was not why I was hired and not what I was promised, they told me in summer I will get this brand new project, not a single line of code written.
Every new project of my company in the last 2 years was in React / Redux / Typescript and ASP.Net Core WebAPI - So I invested a bunch of weekends to get into it to be able to lead such a new project!
Today I recieved a Email from my boss, that because "we have to be on the same stack as the sister-project" we will use jquery and kendo mvvm....
What the fuck... -
Back in school I could easily ask my older sister (my parents didn't/don't know any higher maths) to help me with my maths homework, like functions, equations and derivatives... 😊
Today I can't anymore because I'm the only one of the family at uni (fml a little bit (but I've got good friends on my side😊))😓 ... I miss those times😥
note: now I'm the one teaching my younger sister😎1 -
Any of you on prozac? My sister in Nevada was prescribed it a few years back and never took it because she was nervous and had heard bad things about it.
Shes been a manic depressive her whole life, and has always been anxious about every little thing since we were kids.
What was your experience with prozac if any?5 -
Things I hate
- geese
- guinea pigs
- the word “marsupials”
- the words “dollairs” and “dollary-doos”
- weak words like “magnises” where it isn’t immediately obvious what vowel is a strong one
- jackals
- hyenas
- feminazi
- the word “moose”
- the trend of upper-class gen x downshifter people to name their creations after less popular animals like mongoose and others
- words that fall into the uncanny valley where they are just like normal words yet are slightly off
- mispronounced personal names
- billie eilish face
- the name “Podger”
- Johnny Depp’s ex-wife
- php
- alice in the wonderland
- cult following of 1984 by George Orwell
- my older sister
- lack of grounding in any hardware
- the word “Garbaruk”
- the word “Aardvark”
- anything that was ever made by Paul Comp
- the word “Bushwick”
- Keanu reeves face in John wick
- fonts with weight less than 400 that try their best to be as “geometric” as possible
- netflix
- spotify
- slack
- war
- schizophrenia
- history of turkey and britain
- the word “canola”
- the picture of a seagull wearing square sunglasses
- tom and jerry
- how they wrote relationship between chip, dale and gadget
- the word “lululemon”7 -
A small instant cocoa package. Pink and blue. It said “Mine. Autonomous. Immaculate.” My sister gave it to me. It was made from human female skeletons, because you can't make them from male ones. Eat it as-is, or dissolve it in milk. It tastes like ketone bodies.5
-
Alright, I'm gonna need some help from more experienced devs.
tldr: how does my sister test my website if she can't run it?
I'm making a site (for myself, I've talked about this in other rants, most likely won't go online so I don't want to spend money on this), and my sister is helping me with the sales part of the project. It's basicaly a web store.
In a couple of months, she is going to have a baby, and will stay at home for 5 months. Since she helped me with it, and I don't really know all of the steps that go into online purchasing (she kind of works with this, and makes a lot of online purchases, from everyone I know she was the best person to go to), we want her to test it while she's at home with the baby, just in case I missed or didn't understand something.
The problem is: she doesn't understant anything about programing and probably never seen a command line, and since this is laravel, I will need to install a lot of things in her computer, which will be useless for her after she is done, and teach her some commands to run the site.
Also, like I said, i don't want to spend money on this, since she will only make a few tests and that's it, it would go offline after.
She is smart, she could probably do this, so if there is no way of doing this is ok, but if there is it would save her a lot of time while testing and with the baby, and save me my time at work.
I would want something like git, but where I could run the site without a lot of steps.
Does anyone know how she can test it? Is there even a way?
Thank you in advance 😁5 -
Attempting my first main comp Linux box since my sister fried my old hdd... Trying elementary os because it looks pretty
-
In the devrant frontpage I see:
Js bro
Design hipster
Algo sister
Is this really what they look like? I have seen both design hipster and algo sister but Im not that sure about Js bro1 -
What do I have to do to convince you people to bring the 21st century to the current year and just explain the gap in time as "we all fucked up and an elite subclass of assholes hid everything and convinced morons like us to delete things and turn other things over to them" ?
Don't any of you things care about being erased ?
Also a "sorry john we're bastards and we will hand over all your older photos and all government facility footage of you etc so you can at least look back with pride at something" would be nice.
and 'we'll also admit that we are the psychologically deranged ones'
and 'how about a free blowjob from my younger 20 something large breasted sister ?'
these would be life affirming exchanges.
and also "sorry for pretending to be you and likely doing fucked up things I should be shot for"
and also "you were right we were wrong the idea of just deleting a portion of time and repeating half of it drove everyone crazy and you were correct in all your assessments to the point where your capacity to asses psychologically was damaged by it being paired with extreme trauma because you don't want to understand our ridiculously nonsensical cruel asshole selves"
this would be progress.
instead it seems to be
'heee heee we're destroying everything and not heeding the warnings around us in these decrepit old monkeys that used to be just like us.. oh shit we're fucked now. how do we get out of this ? omg we never will ! waaaaaaaaa'
sigh.
could't you all jump off a cliff like a bunch of lemmings ?
the world would be a better place :)
and it would be all the more air for me :)6 -
My older sister is trying to flirt and its honestly going to make me gag. Asking so many questions knowing moms in the car and said dont take long ..acting purposely childish5
-
6pm Friday , opening a trouble ticket on a citrix server because an app has the wrong link ie.
The support that you answers:
Ie on your computer ? On the server ?
Nope, on the laptop of my little sister.... -
Don’t trust anyone it’s sad when your husband is having love affairs with your best friend, i noticed my husband is get too much closer with my friend Amy, my husband chats now in private, her calls are in secret and he changed his phone password, I was wondering what going wrong, on till my sister introduced me who help me to hack my husband phone no need to touch his phone, in less than 27 hours after his phone was finally hacked, his messages coming into my phone instantly. contact
-
I don't understand women sometimes.
Context: So, How government jobs work in India, is that you have to move to a new job posting location every 3-4 years. Not forever though, more like the first 20 years or something.
It can be a city or a village. And you can't say no against moving there. You'd have to quit the job which in India, is a MASSIVE deal.
My cousin sister had her job posting in Jaipur where she lived with her kid and husband. And soon enough, the news came that her new job posting is in Bangalore, which is about 2500 KMs away from Jaipur.
2 months ago, she and my aunt made a full-on hoopla in front of us saying things like - She'll quit her job. I don't care what it is, but family is always first priority blah blah blah...
Fast forward to today, she's living alone in Bangalore.10 -
I miss my dead sister who I never even met and sadly didn't get the chance to live at all lmao if only she stayed alive I wouldn't be here suffering lmao 😁😁😁7