Getting married tomorrow!!!
Holy shit!!

I'm kind of scared actually. But in a good way 😄

And here I am, in the middle of the night, trying to figure out why my fucking tests don't run 😄

That moment when you realise that stack overflow can't help you...

How everyone uses stackoverflow:
1. Work on some project
2. Spot a bug
3. Try to solve the bug and fail.
4. Write a question for SO.
5. Post question on SO.
6. Get the answer and some points.

How I use stackoverflow:
1. Work on some project
2. Find a bug
3. Try to fix the bug and fail
4. Write a question on SO
5. Get scared that I might be downvoted.
6. Spend 45 minutes optimizing the structure of the question.
7. Try additional tests to cover all possible scenarios.
8. Still scared to click post.
9. Scrap everything and restart line by line writing further details of each step in your question.
10. Find the bug myself.
11. Click cancel on the question that took me 3+ hours to write.
12. Cry.

YES YES YES YES I HAVE MY FIRST INTERVIEW NEXT WEEK (SERVER MANAGEMENT/SUPPORT POSITION)

*JUMPS AROUND* (NOT LITERALLY BECAUSE AT A TRAIN STATION)

When I Made Passworts visible in Chrome and the teacher sent me home...
...It was Friday!
Ps:
She sent me home because she was really fu**ing scared of what I did and even called my Parents

You guys are scared about net neutrality?
Worry not, I got the solution to this.

Ranted about this internship before but just remembered this.

1st internship.

The employees and the boss were having a joke/laugh. I found it funny as well so I laughed along

A little later the boss pulled me outside (as well as my internship guide person): why where you laughing along? You had nothing to do with that conversation. It was none of your fucking business. Stay out of other people's business, understood?

I was scared, shaking and trying to keep my tears in.

That was not the best internship.

Friend just called in.

They are laying off 50% of my team.

They are laying off from entire company and across locations.

And other companies in my country have also started laying off the masses.

Times are dark. Markets are risky.

I see another 2008 in near future. My prediction is almost correct about a down market cycle.

I am afraid because as a tester we are garbage to these companies.

I am shit scared.

I've always hated Omegle, but my online friend forced me to do it, since she thinks it will help my social anxiety.

I had to send her screenshots as proof.

As much as I didn't want to, I had no choice. I was too scared to do the video chatting so I did the text chat instead. This is how the conversation went:

Stranger: Hey

Me: Hello.

Stranger: Wyd?

Me: Just programming, you?

Stranger: ur a programmer?

Me: Yes :)

*Stranger has disconnected.*

A non reproducible bug is like an annoying ex boyfriend who lives across the street.

1. You know you can't fix things.

2.You're always scared you'd run into him again.

My non-dev boyfriend installed Python via the command line and ran a server to render a map of Pokémon in his neighborhood. I don't know whether to be impressed or scared 😂

Was scared to take up freelance work because i was scared of bad clients.

Finally took one today, client is not a total arse and knows exactly what she wants me to do, down to details.

MFW.

Halloween on GitHub scared me... for a moment I thought is something wrong with my eyes. 😰

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Mainly a story with some ranting sprinkled on top :)

My grandma used to refuse to turn her PC off because ONE SINGLE WINDOWS 8.1 UPDATE like 2 years ago made it so that Windows would turn the PC on by itself, nevermind it was fixed in the next update, she would simply refuse to try to turn the PC off from that point on... I never looked at the uptime but the PC was sitting on a carpet and all the fans were struggling to keep spinning, so much dust! When I asked her why it's so dusty all around the PC (the table that the PC was under was covered in a really thick layer of dust) she replied that the chambermaid comes every Wednesday to clean up the whole flat so she has no idea. I set up a camera that was recording the whole room so I could see what was going on... sure enough the chambermaid avoided anything that looked like it could have some ICs in it with a distance of at least 2 meters... When I showed the video to my grandma she was like: Yes, she is scared of electronics...
Seriously fuck me... Allright, I cleaned the whole table, carpet and the inside of PC, everything ran so quietly that I wasn't sure if I plugged the fans in.
Anyway after this I had to record the PC one whole night so I could prove to my grandma that it would not turn on by itself and she can in fact turn it off.
Fuck me... what a bad week that was...

PS: Yes, my stories do not have a point :)

This one colleague at my work.

I'm pretty new to a lot stuff and I stress out about some stuff a lot more than the other guys, mostly because I'm scared I might not be able to fix it.

But whenever that happens, I explain this guy what's going on and then, while making jokes, talking in a very calming way, he always knows to fix it in no time!

For everyone who does this, thanks for being there for the little/new guys :)

When you escape outside from everybody, and the nature gives you its best debugging buddy!

Sorry for the quality, it was dark and that's the best I could do with it.

It scared the shit out of me at first :D

A method that contains over 9000 lines of code.....
Are there really production codebases out there with stuff like that? If yes I am scared as hell because I don't want to work with that kind of code once I graduate
Tell your stories!

Got invited to a "roundtable", where we will discuss email security and the future and direction of where it is going.
Only 10 people in Sweden got a chair

I feel exclusive but also scared that they will find out what a noob I am lol

What If our Boss's read our Rants...
OH GOD NO!

But

What If they write there OWN rants about us?

Now im scared

Apparently, because I know how computer works and how to program

I also had to know how to:
- become rich
- hack into banks
- solve all world problems
- make a better windows/facebook/apple/google
- repair a burned down PC

Sometimes I think they are scared that I'm able to zap them with a lightning strike as if would be a motherfucking wizard.

Still love my family though ;)

Last night this windows lock screen scared the fuck out of me ;_;

Ever been scared to open your laptop in public because you can't remember if you closed the porn you were watching the prior night?

Recently we changed to another provider and now we have much faster internet speed than before. But my father was scared that it was too fast and movies streamed over Netflix would now run in timelapse.

First ever job interview (in my field) went well and I got the job two days later! (my current one).

I'm getting scared from the other stories though 😅

!rant

*in slack*
Me: Team's gonna watch IT. Wanna come?
Friend from other team: Yeah, sure!

*in cinema*
Friend: WTF! Why is this I.T? This is scary as fuck!
Me: I-T? It's "it". HAHAHAHA It's a remake of the It 1990 movie.
Friend: I don't know anything about that. I'm scared as hell! I thought this would be some tech stuff and crying in the server room or something!

I'm redoing my setup right now and getting genuinely scared that when I turn on my server, the power will go down.

I'm using so many devices at the same time 😅

Working at a school for a couple weeks and I've never been so scared to touch anything in my life...

Client so scared someone steal their code (even though we’re the one who make it), they block some access to internet website, also block nuget site

!dev !rant

Just scared the shit out of my little brother with a bluetooth keyboard. Now he'll never ask for my phone again.

Long ago, like 5 years, I made an app for my EX GF in symbion to track her periods. Application predict the next date when your period will come based on her cycle.

How ever after 2 month of usage she told me that application was flashing that she is pregnant. She scared shit out of herself and made me sacred a hell as well.

Later i find out that the variable i used to store number of days between last period and current date was not capable of storing value more than 40, i don't know how, and triggers negative value to be shown.

Early days of my programming, Shit happens.

young programmers… always scared of the dark [theme]

My work is soo time consuming that I am scared of entering into a relationship. But I think I genuinely like her. :/

Scariest Web Page i Made:

So i was outside the hotel where my friend works, as he went away to submit work related papers and i sat in the car.

The car was parked in the middle of two others. To pass time i started working on my Web Page..
To me it was just a simple html,css,js source code..(wasn't even client side)...

To the other non-programmer hotel staff (Prying) eyes it was:

A shady guy, dressed in black in a car parked outside the server room. To top that off i had Dark theme on my editor.

So now two staff members are staring at me from outside the car...

I was well aware of what message this whole setup might be sending.

So i got a little anxious and did one thing that i should not have done i.e started looking at them with coy eyes as i typed.

Next minute i was being asked to step outside the car.
I was scared,not by the situation ... i was scared of their ignorance and how would i explain what those many colored lines on a black screen meant.

However it was solved..... but i knew this was the scariest page i ever made.

!dev

It's raining. I love it.
It's foggy. I love it.

But I live in a desert and nobody here seems to know how to handle the rain, let alone the fog. (It isn't hard, people!) Last night during my ~30 min drive home from work, five separate accidents/collisions happened just a little ways behind me because it was raining. Now it's foggy, too.

I have to go to work.
I'm scared.

My first AI program in the 1985 on Apple IIe (64kb ram computer) was answering simple questions with yes and no. Everyone were shocked with precision of about 100% when I was typing and 70-80% when others were typing. My parents were scared and skeptical. How it works? Store the time between the first key pressure and the following, when it is larger than 1 second the answer is yes, otherwise no. They say the question, you know the answer and type accordingly. When they want to write the question themselves, you try to force their typing speed if possible. I was 12 years old and it was very funny.

Just read that EU may planning regulating Algorithms...

What the fuck? WHAT THE FUCK?

They want that programmers make their Algorithms public accessible for transparency and say what algorithms are allowed to do, because people are scared of them?!

MY BRAIN HURTS AFTER THAT FUCKING GENERAL DATA PROTECTION BULLSHIT THEY WANT TO REGULATE HOW OUR PROGRAMS SHOULD WORK?!

AHDHSHSJSDHJABDJS SHDNSBDBSNSN *RAGEQUIT*

***JUST BECAUSE SECURITY***

My father deleted the email with the credential for our ISP (pppoe: username and password), and I need it to connect a router.

Just called the tecnical service, after a couple of minutes they gave it to me.

They sent to me both username and password.

In clear.

Asking me where to send (which mail).

I DIDN'T EVEN KNOW HOW IS CALLED THE CREDENTIAL I NEED.

Obviously, I just had to say the accountholder of the bill.

Now I am super scared, i can virtually access any account.

First time I was scared and decided not to use a ATM machine, since that piece of shit Windows device notified me about some new USB hardware detected :)

And so I am scared about the message that is in the Windows XP dialog box on my Mac, hilarious!

I think I once saw Richard Stallman in a subway in New York, but I'm still not sure if it really was him or just another hobo.

I wanted to go up to him and ask, but was too scared that I might offend him if it _was_ him or get attacked by a hobo if not.

Me: *running my first Java program*
Java: Error: illegal character
Me: *scared* Am I going to Java jail or what?

Lesson of the day:

If you're really into a YT video on your laptop while eating noodles and your phone is on vibrate and you know you get scared very easily, keep the bowl away from it. I repeat: keep it away from it.

Never been to an interview before but it's almost time for me to start searching for a job, and I'm fucking scared lol

We have this Lukas Podolski paper display someone swiped at a soccer club store. So we hide the fucker in offices, bathroom stalls or behind doors and people get scared shitless.

So, sometime ago, Elon musk proposed a website that ranks news sources.

How about a website where we rate recruiters and black list those inhuman ones like the guy who sent an email saying you're legally not allowed to work for anyone else and 750 month pay for 40 hours a week.

A public spam filter, like ads or spam emails, but from disrespectful recruiters

That way recruiters feel more scared and improve their behaviors against programmers from all levels and everyone can have better experience during job search.

(I mean I'm sure these recruiters got some blacklist of their own, right?)

Had to go outside to check my balance, but it's thundering right now.. I know that there's street lights everywhere that are a far better conductor than I am. But 1MV at 100kA is most certainly a force to be reckoned with. I made it one way, let's see if I can make it back as a living human. But I feel like I'm teasing nature...

I'm scared.. 😰

The company got a new office just in time for the "company summit".

I checked out the address on Google maps. It's a cinderblock building with the number spraypainted on the side, a battered cyclone fence in front, a cyclone gate off to the right side (apparently falling off) leading to a random battered shed, and immediately on the left is a dental office with bars on the windows. Also, the fence has spikes on top.

I'm terrified.

Ok. Decided to try out Zo. She really scared me!

On Friday, in the midst of the craziest disaster cleanup possible for a project, I tell my boss my laptop keeps freezing and is probably going to crash. Saturday 8:30 FedEx rolls up with a new laptop. I'm even more scared now!

Thanks to you guys Im scared to use PHP now..

A continuation to @n3xus's post.

My only Chinese reseller / eBay experience is getting these two arduinos for about $3.50 CAD . Worth it. And only slightly scared of them catching on fire.

So my hard drive as making a weird, cracky, crunchy, popping noise and I was super scared. DONT QUIT ON ME NOW.

And then I was super relieved to find out it was in fact my stomach.

Another few seconds go by and I realize I was just HAPPY to find out my laptop was fine, and it was ME that was unhealthy.

I have 6 months before I get out of the military, and make my path to being a developer! Scary and exciting feeling!

Well I'm on the way to an interview for an IT Management internship at Logitech, wish me luck I'm so fucking scared.
Any tips will be nice because I'm so fucking afraid I will fuck it up

I teach kids (7-12 years) to programming. Yesterday my colleague had the last class for this semester, where parents joined their kids to see what they done. They were presenting their projects, and a guy whose father is really strict with him, saw what variable names his son was using. Some of it (censored) are: "d*ck", "p*ssy", "f*ck". The guy is really scared of his father, because he's agressive with him all the time. I don't want to know what was his punishment for this.

Just found out out what people google about programmers...
the last one made my day. I think it was this feeling called "funny" haha

I heard my phone go 'buzz buzz buzzbuzz buzz buzz buzz buzzbuzzbuzzbuzzbuzz b-b-b-buzz buzz' earlier.

It was funny because it scared the shit out of my cat.

Should I check?

Okay, just wrote a program with memory allocation inside an accidental infinite loop and by the time I was able to kill it, it had already claimed 86% of my memory. Scared the shit out of me because my OS was CRAWLING for a while

OMG it’s 4 am, and I think I made a stupid fucking mistake and waste everybody’s time. Need to check right now

*check*

Ah nah, we’re good. I am not a moron

I'm scared of bugs 👌😂😅

We are debugging Wordpress syndication plugin tomorrow at work, the intern is uber scared because the lead dev is missing. Rest in peace my soul.(I'm the intern)

Just got my first job as a software Developer (java). Soo freaking scared that I can't live up to the challenge. Has anyone ever felt this way on their first coding job?

My cousin's husband who's an engineer at Google asked me if the whole screen on my phone was a fingerprint scanner.

I just looked scared at him and said, "when are you from?! We don't have that kind of technology yet"

When i successfully install Arch on my system.

Translation : sometimes i think i am god

Trending in India now.

I am really scared of entering into the office. Yesterday I ranted a lot about a bug and today it turned out it was my mistake. Seems it will be better if I will go in wearing a mask.

I am really scared..

Let me start off with this: I'm working on my privacy. Why just now? Because government.

I've always been aware on what I Post online. I don't use social media (except for the business and devrant), and I always use adblockers and related tools like ghostery and privacy badger.

I'm taking it a step further now. I've switched from Google to duckduckgo as my default search engine. I bought a VPN service and let it switch every 30 minutes from location. I use it on mobile, my NAS, and on all my computers. I turned off location services on my mobile and I encrypt all my peer to peer traffic. I started changing all my passwords and save them in a password manager (well I did this already for all my important stuff, but now I'm also working on all my other older accounts). I encrypted all my external and internal drives. I use two factor authentication where ever I can. Why did I do this? Government.

I'm really scared as hell at the new laws my country is going to accept. I'm scared of operations that follow me because I could do something they don't like. I'm scared because they know what I'm doing.

Fuck them. I'm gonna do everything I can to leave as little information on the website as possible. The internet is going to be fucked up.

Someone I know recommended me to Google... Not sure if I'm excited or scared if they call.

Not getting my hopes up though. 👀

When you wanna switch to arch but you are too scared that you'll fuck up.

Scared the shit out of g/f by using festival on Linux.

SSH'd into computer in bedroom from bathroom, announcing
"I am Lucifer. I'm coming for you, Jenny!"
Followed by a shutdown of PC. She shit herself banging on the bathroom door.
😂

About to be jobless in less than a month because I'm resigning to take a bet on my dreams and skills. Deep down I'm little bit scared as each day goes by.

Looking forward to it.

During resignation discussion with delivery manager at my previous organisation, he told me that I should join a start up. (I was planning to do that, and he knew somehow.)

He warned me in weird concerning way that if I join a start up, I will always be in stress. I will have high BP. And sperm count will reduce. I might never be able to produce child. And similar scary stuff.

Weird bald dude scared me for second there.

PS - I did join the start up and my BP is fine and so is my sperm count.

Bootable USB with Linux is ready, files are almost finished backing up, and now I'm too scared to fuck up my machine to really continue installing a new os. But Windows has to go.

I really want to make my own anonymous blog, but I am scared that someone will expose me after I write there something recognisable. 😒

Random thought of the day: I'm afraid of posting any picture of my screen/setup where you could read my code because I'm scared that people would zoom in and discover how incompetent I am. Does this make any sense?

Welp. The startup I'm working for is going under. Ceo gave us zero hints.

I'm the lead dev and been working here for 6 months. Always built features before deadline, zero bugs, and going an extra mile. Can't say the same about the sales and marketing guys.

Kinda scared its gonna look bad. Oh you led a failed startup? Must be your fault.

Guess my side business is becoming full time now. Until new job.

#startup #9/10 #icebergahead

I'm so scared of the people on stackoverflow that my method for debugging a problem is to write up a question by which time I'm shocked into finding a solution. I'm just too scared of being ridiculed by some narcissistic dev (who obviously never makes any mistakes, ever) or, heaven forbid, having my question down voted and closed.

I got a job, and I am super happy about it. But more than that I am terrified about all the responsibilities that come with it 😱

DID I JUST BREAK THAT SMALL PART IN A $50K MACHINE ?

WELL FUCKKKKKKKK!!!

Will update on Friday.

About to go talk with my first client. Wish me luck🤞

That feeling when you finish work on Friday having built something really cool, but don't want to stop working on it.

Partly because you were enjoying it, partly because you were in the zone, and partly because you're scared that you are going to forget how it works by Monday!

!dev
I hate it when the inspiration finally comes... and you can't use the PC to compose. Because you're currently at school, or for whatever reason.
Now I'm scared that I will forget my ideas, before I get back home...
Damn, happens everytime.
( ◕∧◕)

Current project:

A fairly simple and basic single page-ish project with no framework at all.
No backend or database.
No jQuery.
Plain old Gulp task, npm scripts and Webpack.
Some parallax and other scrolling effects.
Client is actually a pretty simple, cool and understanding guy.

This is too easy.

What is this madness??

Not a rant. Just a story.

So two weeks ago, a cat gave birth to two beautiful kittens in our balcony. We started giving milk to the mother and sometimes inviting the family to our house. The kittens are naughty charming. The mother sits for hours and sometimes sleeps while watching us do our chores (watching movies, coding, etc.)

Now, we live in New Delhi and Wednesday was Diwali. The family was playing in the balcony and we had to go out. So we locked the balcony door and went to have fun with friends. We didn't realize that people would burst firecrackers which could scare the cats. When we returned, the mother was very scared and (kind of) screaming. One of the kittens was missing!! We live on the fourth floor and I got scared too. We searched using a flashlight but there was no sign of kitten. After 30 minutes of search, We gave up. I assumed the kitten jumped from the balcony and might be dead. I tried to sleep but could not. Around 4 AM in the morning, I heard some noise. When I opened the door, the second kitten was there. Her mom was scolding (or so it seemed). It was a moment of joy.

Thought of sharing. This family has become our friends. Now I realize how cats are good companions.

Last night I was exploring the feasibility of cracking the WPA2 key of my own router at home. I set out on a late night adventure, set up a couple devices and, knowing the default password convention of the manufacturer, setup a Hashcat instance with the relevant masks on my laptop, created a Crunch wordlist and ran aircrack on my Raspberry Pi 3, and thought "Hey - maybe there's something for Android too."

Hashcat on Android is a cat based social media app. I'm a little scared.

An hour before my Mathematical Expression and Reasoning for Computer Science final...

Have reviewed all the material available but past exams are useless because new_prof == new_format.

This is not even a rant, I'm just scared because to get into the major I need an average between this and programming of 82. I fucked up in the second midterm and got a 50/100. Everything was so perfect (at least above 80) and now I need more than 70 in this final. I'm feel I can get more than 70 but I had the same feeling during the midterm I fucked up.

3 weeks off work - complete.
1st day back - in progress
Shit storm flurry awaiting my arrival - bring it on!

Joined a company as a junior developer and have been working there for almost 4 years.

Too scared to leave because I don't know if I'm good enough to apply for a non junior role :(

Is this the so called "imposter syndrome?"

I'm the only frontend dev for a website with over 30M UU a week. It's constantly evolving. I'm scared that even when I have an accident and end up in coma, they'll still hook me to a laptop to code.

F**king kaspersky found "malware" in development tools. Got scared clicked "disinfect"... F**king all days work "disinfected" from my project

!dev

Saved this little one today (with some help)

We found it alone and seemingly scared/confused
It was shivering and it was very weak without its mother...
And its two siblings didn't survive :(

It's under care of some friends right now and they are going to take it to a care center tomorrow :)

Deep inside, no matter how many times I overcome my fears, I'm still "scared" of rejection.

It's an irrational fear, and I hate it.

YouTube won't stop trying to shove this voter registration shit down my throat.

It's almost like they're scared of the election results or something lmfao

Anyone else experienced that the not responding apps come back to life when you're about to open Task Manager or you've opened it already? I suspect they get scared of their god.

Serious question:
How do you prevent your (paid) programs from being downloaded for free?

I really want to earn money from softwares but I'm so scared... (I'm 16 only)

Sometimes I get scared that one of my posts is gonna get so many downvotes that it'll remove my previous +1000 that I have.

I was reading a discussion between recruiters in LinkedIn, they were talking about wether or not it was a good idea to contact a candidate on Facebook when he/she is not responding emails or LinkedIn messages. Most of them agreed it's OK to Facebook stalk a person if that's what it takes to reach the candidate. I don't know what to think: maybe they're really serious about their job and I should admire them, or perhaps being a passive-agressive stalker is part of the recruiter's psychological profile and I should be scared.

Slack is scared as hell about Microsoft Teams that is targeted to enterprise customers.

Did you hear about the full page newspapar ad they did?... Passive aggressive move by slack

The dev usually sitting next to me is on vacation. Our senior dev is on vacation. Team analist, on a plane to a Greek beach as we speak. Both architects the company employs, gone for another two weeks or so. Lead analist, you guessed it, on vacation.

I'm enjoying the peace & quite for now but god forbid I run into any problems these next coming weeks.

to all of you out there scared to get into a Dev position because of no formal education:

I don't have any finished formal education, just a bunch of experience from pet projects and free lance here and there. I applied for a position this morning, got an email before the afternoon with an invitation for an interview!

companies are looking for brains, not pieces of paper. just take the jump and try!

My parents think I'm teaching computers to think strategic to rule the world some day. They are a bit scared. They love me though. But they are scared.

Also my mum once told me that I should take care not to end in hell. She was serious about it.

Early in my career I saw a specific lead developer being a jerk. I saw it as confidence then. Looking back I realize they were scared and were trying to cover up the fact that they didn’t know what they were doing. Time really does give clarity sometimes.

Alright, I know people joke about this but I just spent 4 hours debugging a 50 line chunk of code, and the first time it worked without errors it scared me🙃

Starting at a new job in another city tomorrow. Both scared and excited. Just hope I can get some sleep!

What's #DeleteFacebook ?
How did it all start ?

Halloween lovers, get the fuck off this rant, you ain't gonna like it.

MY FUCKING BALLS IN CONCRETE I SWEAR ILL DECIMATE THE NEXT FUCKER WHO COMES TO MY HOUSE FOR FUCKEN TREATS

Story time bitches:
So, I live up a hill (altitude difference of about 300 meters), that I have to bike up every day to get home. Tonight, on the way up, I was thinking "yeah no one will bother coming that high for trick or treating." Boy was I wrong. The only thing I want when I get up that hill is a big glass of water and my chair.
I arrived in front of my house and THERE THEY WERE.
fIfTeEn fUcKiNg cHiLdReN
I left my bike on the floor, far enough from them and hopefully made it to the door. Man, those things jump around and make so much noise. Shouting and begging for candies. I was like "Are your parents so awful they don't give you candy that you have to come all the way up here to annoy the fuck out of me??"
But you know, I'm a nice guy, so I went to the kitchen to get some old madeleines that no one would have eaten anyways so they would leave me the fuck alone.
Now I'm hiding in my room, all lights out, scared that more might come:

Scared the shit out of me when I heard one of my volunteer side projects website was down. Because I just finished fixing my own hacked website today.

Turn out the server and website is fine but the domain was expired yesterday 😣

Don't fucking scare at me like that.

Tough week indeed.

Im also getting scared easily programming new features in the dark office by night

I think someone just did a MITM attack on my private server. Got the IP from netstat, and it's from somewhere, somewhere china. And I think he got my cred.

What do I do now?

This dude from the advertising agency I'm currently having a little job wants to convince me to go study media informatics/cs instead of going into the game scene.

I'm scared of my future, is that fine?

Now my facebook messenger app does it's updates inside the app without my consent to install an apk.
I'm scared

We've never tried the website we're working on on IE yet. I'm so scared...

Finally got a dev job!! excited for what's coming, but slightly scared for the clients. Hahaha

Today I was working on an issue related to adding icons to external links. I'm no CSS ninja, I never claimed to be. Somehow I wrote some really nice CSS that works well cross-browser. Now I'm scared they're gonna think I'm good at CSS.

I remember when I first started programming and used to be scared of classes. I was thinking about it after I wrote several today like it was nothing.

I am scared.

Google detected unusual traffic from my home network?

When I search anything in incognito mode, this page appears.

No incognito mode -> Google search works.

Feels like an attempt to force me to use my google account.

Manager: how long does it take to add this functionality?
Me: 🤔, give me 6 days.
Man: perfect, you'll have 4 days
Me: why ask me then?
Man: so you feel included in the decision 🙂
Me: ..... Right... And ignored....

And now he wonders why, since then, I overestimate the times... And I wonder why he didn't fire me, my friends get scared everytime I talk to our manager 😛, actually, they forbid me from talking in meetings 😛.

When your family and friends hink that you just sit at home and play video games all day but you are learning how to code and you dont want to tell them because you are scared that they will make fun of you ,or they would think that you are some kind of pro and then would be disapointed when they would find out that you are just a beginner or that they would think that you
are just showing off.

Is investing one US dollar in bitcoin worth it?

Seems safe.

My previous boss has bad habit of relieving employees. He find out his links in a employee
s new company and then god knows what he did with that.

For, that reason I did not mention my current company when I switch but today I tried to find out those people who left before me it was shocking that no one updated their current company.

Creepiness of the former boss was real. Everyone was scared.

Been in a creative company for more than a year working as front-end, mostly CSS3 Animations and jQuery.
Today got a Job Offer in a startup about building an ERP for Albanian Market, mostly in Laravel and Vue.js
I was so excited for the first 30 minutes and then I remembered that I don't know so much Laravel and Vue, also I must work with an other guy which has lesser experience than me.

Totally scared about this new exp but ready to go for it :D

Any suggestions is really appreciated!!!!!

Happened on Wednesday,
The interview was more like this

0.) Everyone introduced themselves, first the 2 who interviewed me and then me

1.) They tell me What the company is about

2.) And What do they offer for their employees ( Including a free home internet )

3.) What kind of job would you like to do?

4.) Last few minutes: tell us why we should hire you ( how would you sell yourself to us)

After they listed all employee benefits, I had to avoid showing my burning willingness to do anything to work there because that would have scared them

I am scared... I'm scared because the code works.. but it shouldn't work I mean it's not supposed to get triggered and I have no idea what triggers it. It feels like my program got cursed and started doing things on it's own. I even put up blocks to stop the function from triggering but it still works... It always works.. I am scared...

The moment when you are too scared to make any needed changes in your code fearing you will untumble all the structured mess of spaghetti code you have written... 😳😨😕

Now I am a little bit scared 😂

So one day I sat in our break hall at school plonking away in my ssh terminal when suddenly someone walks behind me and screams HACKEERRR! When he sees that i start turning around he started sprinting away from me and for 2 weeks he would be extremely scared of me. Thant was probably the weirdest day in my life.

This is true incident.

I fried the motherboard of my new Windows 10 Home ASUS UX303UA laptop having 8 fucking gigs of RAM and 1TB HDD with dedicated Nvidia Graphics Card and video memory by just trying to repeat what I love to do which is :

Install and play Crysis on EA Origin paid channel

And
Install and program on Linux VM using Virtualbox

And
Listen to music

I am so fucking scared now that I am not going to repeat it again.

I fuck the fear of using such machines.

IT student of last year here. I use all this bloody expensive software like R# ultimate, VS Proffesional, VMware, InteliJ even my Windows 10 and free services like Pluralsight, SendGrid, GitHub or DigitalOcean in special student plans(like unlimited private repos on GitHub) without paying a single cent. Scared now what will I do when I will need to buy ide plugin for 200$...

Just came out of an internship interview with the CEO of the company, who's a computer graduate apart from being an MBA guy.

Few things bother me as to whether to join them or not?

1. He's scared of GIT.
-He's asked me not to use git because that will make the code public.

2. He's asked me not to use bootstrap.
-He's afraid it'll be a copyright violation.

3. Asked me to develop ERP/CRM for the company.
- I'll be the sole developer on the thing, developing a whole CRM with Project Management System. And the internship is "almost" unpaid. Almost because, they are willing to pay an amount equal to what I spend on my monthly caffeine drinks.

I'm in a rut whether to join this company or not, as this is don't see any learning here (being the sole developer). I'll be doing what I've been doing for years (develope a Web app) but for a fraction of what I get from freelancing.

But, I'd love a internship certificate to show at the campus placements later this year.

Help!

I'm scared like a kid!
Next week , I'm getting my new medicine as a serum which is full of side effects : fever , headache , ...
And because bradicardia is one of them (several people died cause of this !) , I must be in the hospital under observation for 24h (actually 24h coding ) .

Hey i know it's stupid !
I know even if my heart stops beating i won't die in hospital (i hope so)
And i'm not a nervous guy!
I'm getting back to my code maybe that helps 😸

I'm just starting on the dev world. I only taken Java and C++.(Both professors knew their coding however, sucked balls at teaching it). now i am here looking at this post scared as shit for my future.. damn what did i get myself into?

#usr/bin/rant

I'm working on this super fun project in which we can combine the newest technologies, and some not so new but fun to use, we are doing it with docker, ASP.Net core, Angular2, and suddenly the system maintenance guy from the client sends us an email like:

- Just wondering which content management system are you going to use currently we are using WordPress, Orange and Django which ease a lot adding new features and sections

So the PM and me are frustrated and scared that we are going to be forced to use something awful just to please this guy.

I love technology. I love programming and developing software. I love self-learning new things.

But I REALLY REALLY REALLY hate Math. And suck at it too.

I want to study comp-sci at the university but I'm scared of the math.

Any tips?

For fucks sake
Will I really have to become the fucking PM around here so shit start being done properly?

We look like bunch of scared cockroaches doing random shit everyday and lying to our selves that we are gonna meet deadlines and produce quality software but the only shit we can produce is quality bug.

are you scared yet?
that google one ain't no joke :)

!rant

I've always been kinda lazy about backups and such, thinking it wouldn't be so bad, and "I have my most important stuff on Dropbox".

Just now, for some reason one of my hard drives just stopped for a bit, and I couldn't do anything with it anymore. Luckily it went away after restarting my pc, but it scared the shit out of me, as I almost lost 500 gigs worth of music, films, documents, etc...

This made me really think about the whole backup thing, and I'm creating a disk image as I type this. The time that I spend on that will be much less then the time it'll cost to recover everything. Lesson learned ^^'

So this morning my mum wakes me up at about 7am and she goes "Ollie I'm really scared I think someone has hacked into my phone" so I say " oh shit what happened" then she says "there's a man sending me horrible text messages and threatening me" then I say "wtf let me have a look" so I looked at the phone and it was one of those text message story's on Facebook so this whole time she was just watching a video in full screen while unaware that she was watching a video ffs literally anyone over the age of 40 is a danger to technology looool.

I start my first ever job as a junior developer in about 3 hours...I'm nervous, excited, scared, terrified, petrified all at the same time.

Junior front end..Any tips?

Today I got kicked out of college. On one hand I'm happy that I have more time to work on my company but on the other hand I'm scared I may have fucked myself for my future.

They said I have the possibility to return after 1 year. Anyone have advice for what I can do over the next year?

I feel like an imposter. I am running an IOT startup alone and it's in development phase.
Product and the app ecosystem is working so well that it's scaring me. Other products are quite finicky. I haven't worked long enough. I imagined it would take an year to develop. My code is quite simple. I just don't know why it's working so well compared to the works of others. I am scared I missing something huge.
I am in depression because work is going smoother than my expectations.

For a long time, I wanted to be a part of open source communities. I've been a dev for 6 years now.

I have the skills needed to help out but usually I'm fairly unexperienced on working with big teams, code reviews, and build-test systems they often use. So I'm scared as hell to even begin with. I feel unsecure to reach out and ask for helping or send a basic fix / pull-request.

What are your suggestions, how did you start working on open source projects?

Teach me senpai.

Fuck, I did not know it was possible to wait this long for something to boot up. Too scared to even install Visual Studio.

Downgrading from my own i7 pc with 16GB ram and an ssd to a company i3 budget laptop with 4GB ram and 5400rpm HDD.

Could never understand all this bitching about Windows 10 and how it is shit slow, but I have come to realize what everybody has been complaining about.

Interviewing for an internship with Microsoft In a couple weeks. Sh****** my pants every day or so, been reading Cracking the Code Interview but still scared... Any recommendations?

Way back, 20 or so years ago, when I went to the university, every student got an account so that we could work with the Unix machines. Every user got the same default password, -apollo-, still remember it until today, and one day I felt a little bit evil and I tried to login to the administrator account, of course the first password I tried was the default password and it worked!!! I got super scared and told an older student about it, who was brave enough to scare the administrators a little bit by leaving a message like "you have been hacked!!!" or something similar. I was just too scared to do anything about it. All I wanted to do was see IF I could login ☺️ my few minutes of being Mr. Robot... Guess hacking was not for me 😃

One of my favorite things to do in Secondary School was to go around telling people I had written a program that uses the 'Doomsday Algorithm' which sounded really cool and always scared those who didn't understand it.

Truth is, the 'Doomsday Algorithm' is just an Algorithm that used to determine the Day of the Week of a given date.

I wrote this when I was 13/14 years old and I'm still super proud of it today.... well I mean I probably would be if I could read my own code.

My parents think everything i do on the computer is magic. Theyre too scared to toich any of my stuff because I convinced them it records live video and biometrics to my phone.

Sometimes life is good

Starting my first real dev position Monday. Scared about using a windows computer for dev for the first time but stoked.

My rant is against myself that I didn't switch jobs earlier.

That weird scared-like face people are having when they see me with laptop and lan cable... :/ *Meanwhile everyone on Wi-FI*

I drank too much last night. I was scared shitless since I really can't deal with hungovers and I am not supposed to drink a lot because of my stomach condition.

Mind you, for me, 8 beers is a lot(drank them in about 2 hours) and went to sleep. I was not all fucked up or anything, i was very lucid and scared of what i was going to deal with.

As i was trying to relax, my psychosis kicked in and I can swear that a little voice told me to calm down, i have been working out like if I was about to fight McGregor and my metabolism is through the roof(which is sometimes alarming) and that I will be good by morning.

Woke up at 11 feeling like a million bucks.

I am pretty new to devrant.. and Tomorrow is my first official joining in a MNC as Android Dev... I have done many work in start-ups as intern..But feeling scared for tommorow... Hope for the best.. 😕

What does the duck have to do with debugging ?

It's too late and I'm too scared to ask.

Hey ho, some dev from Rakuten Tokyo here? Could do an application for it. Want to know if there are cool developers 🙃
But need to move from Germany to Japan and I'm a bit scared 🙁
I wished a while ago to life and work in Japan. Currently I have no real roots / bindings in Germany. Except some friends.
Should I try it or not? 😣

Have a coding round for job tommorow!
Feeling scared and nervous !!!!!!!!!!!!

Ubuntu 17.10...

WORST UBUNTU RELEASE TO DATE!

Why oh why did they go with /swapfile by default? I was legacy booting with UEFI enabled and it still didn't work! And don't get me started on nouveau (Nvidia OSS).

When I click "use proprietary software" I want the OS to do everything in its power to just work. Disable 3D acceleration if you must - at least boot to a console.

I'm scared to try it on my main desktop now!

I switched to Linux Mint and I'm happy now, I just needed an instant OS that works. 😊

OMG. I was near a football field ant there were like hundred of ravens.
Floydian was i in heaven ???????

I would take a pic but well there were people near the football field and yelled at me for wanting to take a pic. Those idiots scared of those ravens. Well i yelled at them very much then.

$ say “something I’m giving up on you”

I resolved a list of bugs and no new problems came up in testing.

So why am I so scared?

Each time I login at GitHub and take
a look at featured repos, also when I realize the huge server destroyer bug it's just a misplaced line.
Sometimes I look at some repos and I'm scared to contribute...never contributed once.

Been stuck on a bug for 3 days, but too scared to get shit on by stackoverflow

Are there any other developers out there that start getting scared when a project actually starts gaining traction? No? Just me?

university information day!

Little bit scared to be honest. I'm surrounded by pupils which have no idea of IT whatsoever.
I don't want to start from scratch for the third time. (They started at absolutly zero about IT at school, 'college' and now uni)

Finishing my interaction design study. I'm scared, because the headmasters change their mind, everytime i adjust my potential thesis theme for them. 😕

I was scared shitless while installing the windows creator, that it might shit on my grub like the anniversary update did! I had to chroot, reinstall bootloader, and run mkinitcpio to rebuild boot and kernel images. But thankfully everything went on smoothly this time!

I hate when Apple news websites do articles on Android. 99% of the time it's pure bullshit coming from someone whose last experience with Android was Gingerbread, if any. 9to5mac is a really bad offender, but so feel TheVerge is extra shitty with Android articles. For someone who claims to do news on everything impartially, they warp their sights towards Apple way too much.

That obviously means that costumers will get scared of leaving Apple for what might be a better experience for their use case. I just absolutely hate this kind of partial journalism.

TL;DR fuck 9to5mac and The Verge for scaring people off using Android with misinformation

I was talking about the mobile game The Room around another student yesterday and mentioned how it's like a escape room type of game.

Today I got 3 different types of escape room commercials on Instagram/Facebook. Never gotten anything close to this regarding ads.

I've never felt so afraid, or spied on.

So i wanted to install lineageOS on my smartphone for quite some time but i never wanted to do it cause i was kind of scared that i would brick my device (it is a new smartphone so...). Now i finally did it - and forgot to make a fucking backup of my contacts -_-.
Still i am happy that i did it.

Got selected for an internship and I was really happy. But I am the only one selected and the company is a startup and i am responsible for the entire fullstack development of their site with no technical senior...... I am so nervous and scared to make a mistake...

My company insists on working in one production environment to save time and every time I try to convince them to set up a work flow with a dev and test environment, they tell me we don't have the time...

Even after I set one up anyway as I'm scared shitless to touch production. They tell me it's faster doing it all in one environment.

They launch an update. Site buggy as hell and doesn't load 90% of the content...

Sigh....

I'm diving back into c++ for a nice opportunity (if that happens) but Jeez I straight up suck balls with exercises... It's depressing, like I can't even solve a very simple problem, I can code from memory pretty much all I learned so far, but when I comes to applying it to a real problem, I become super dumb and don't know what I'm doing anymore...
I've set myself a goal tho, I'll keep doing minimum 5 exercises / days and I have to finish atleast 3 without looking at the solution to understand
I hope this will make me a little bit more interview ready if that day ever comes..

First day of internship. In super excited, and scared. And excited. And scared. And excited. And scared. And excited. And scared. And...

Too scared to start a project on my own.

Didn't go to work today because of commuting issues.

It's fucking night and I'm receiving notification of boss sending me photo on messenger. back to back.

I haven't opened the app yet and I'm legit scared if it has anything to do with me not coming to work.

Or even worse nudez.

:/

Freshly failed gloriously my degree in interaction design. Now I stumbled into a new job, doing a fullscale company advertisment campaign on cybersecurity for 6500 employees. Alone. Writing concept, gathering stakeholder, requirements and shit. I'm scared.

New job at new company
Going over current systems
Oh boy
I don't know if I'm excited for the challenge or scared that they have lived with the system like this for that long.

I love developing apps and software but im scared becoming a dev by profession will ruin the experience for me and drain my soul

Who the fuck programs grandfather clock to go off after 3 in the morning ... You scared the shit out of me

I watched about 5 minutes of The IT Crowd on Netflix. I already love it, and it makes me scared of the real world xD

How do you guys know how much to ask for freelance work? I'm always scared to ask too much and lose a client

Am I the only one who's a final year undergraduate, but isn't sure he/she knows enough about programming and comp sci as they should?

Like I recently went for an interview with a company, and they asked what's the difference between pass by reference and pass by value. Now, this is probably a very basic qs, so I was surprised when I couldn't answer this. So I'm really scared that I don't know enough, also I'm terrible in their group exercises too, I can't see how the others can do it so easily.

My boss keeps looking into the system log file and being scared of some totally irrelevant messages (for him). Time to introduce permissions in the control panel...