A story about how a busy programmer became responsible for training interns.

So I was put in charge of a team of interns and had to teach them to work with Linux, coding (Bash, Python and JS) and networking overall.
None of the interns had any technical experience, skills, knowledge or talent.
Furthermore the task came to me as a surprise and I didn't have any training plan nor the time.

Case 0:
Intern is asked to connect to a VM, see which interfaces there are and bring up the one that's down (eth1). He shuts eth0 down and is immediately disconnected from the machine, being unable to connect remotely.

Case 1:
Intern researches Bash scripting via a weird android app and after a hour or so creates and runs this function: test(){test|test&}
He fork-bombed the VM all other interns used.

Case 2:
All interns used the same VM despite the fact that I created one for each.
They saved the same ssh address in Putty while giving it different names.

Case 3:
After explicitly explaining and demonstrating to the interns how to connect to their own VMs they all connect to the same machine and attempt to create file systems, map them and etc. One intern keeps running "shutdown -r" in order to test the delay flag, which he never even included.

Case 4:
All of the interns still somehow connect to the same VM despite me manually configuring their Putty "favorites". Apparently they copy-paste a dns that one of them sent to the entire team via mail. He also learned about the wall command and keeps scaring his team members with fake warnings. A female intern actually asked me "how does the screen knows what I look like?!". This after she got a wall message telling her to eat less because she gained weight.

Case 5:
The most motivated intern ran "rm -rf" from his /etc directory.
P.S. All other interns got disconnected because they still keep using his VM.

Case 6:
While giving them a presentation about cryptography and explaining how SSH (that they've been using for the past two weeks) works an intern asked "So is this like Gmail?".
I gave him the benefit of the doubt and asked if he meant the authorization process. He replied with a stupid smile "No! I mean that it can send things!".

FML. I have a huge project to finish and have to babysit these art majors who decided to earn "ezy cash many" in hightech.

Adventures will be continued.

I overheard this on my way back to home.

Girl 1: I bought a new phone yesterday.
Girl 2: Let me see it.
*hands over the phone*
Girl 2: There is no Instagram?
Girl 1: No, Instagram wasn't installed when I bought the phone.
Girl 2: That's weird.

*me almost dead*

Oh my god... Storytime.

A customer comes in with I assume is his father or grandfather.

Customer: I need a computer, but without all the internals

Me: So a case?

Customer: Yes, I need a Dell computer outsides, but without the internal components.

Me: Well, we don't have Dell cases, but we sell custom build cases and they come with a power supply.

Customer: *says nothing, but looks interested*

Me: *walks over to the cases to show him* So this is what the cases look like and we have two types, one for a ATX and one for a micro-ATX.

Customer: *still says nothing, but looks at them*

Me: What motherboard do you have at the moment?

Customer: Well, I don't have anything right now, but I'm replacing another computer that didn't work very well. I'm going to be getting some Dell parts to put in here.

Me: O-okay. So this other computer, I'd like to see it in shop to see what's going on with it.

Customer: Oh, you do NOT want to do that. I hooked it up to another computer and it blew it up.

Me: Huh, that's weird. I'd still like to look at it if possible.

Customer: Oh no, it's all wired wrong and... *some bullshit, but stay with me*

Customer: I am the best at technology. My hand has computer parts in it--government funded. *some more bullshit*

Me: Okay... *I try to bring it back around* Well, I'd still like to see the other computer for myself. So you don't have parts for this new build yet, right? You don't know what type of motherboard you have?

Customer: No.

Me: Well, I would get the internals first, so you know what size of case to get, and then get the case.

Customer: Okay. Thank you for your time.

He shook my hand with his "cyborg" hand and I was tempted to say something about "try not to crush my hand," but elected not to. Also during this entire exchange, the old man continuously farted in the background.

When CS professors are lazy to grade so they think they can just give you any grade without you questioning them...

Me: Hi Professor, I see I got a 94 out of 100 on my 2nd project. Your comments said, some of my functions didn't pass your junit test cases.

Prof: Yes!

Me: How come? I tested it several times before submitting and they all passed the test cases. You gave us the test cases to write the code for.

Prof: Yeah, but some of your functions aren't passing on mine.

Me: Since I'm in your office, can you please run it again so I can see?

Prof: Are you doubting me? I gave you the project and I'm telling you they're not passing my test cases.

Me: I just want to make sure because I did work really hard on this project to pass all the test cases. *Runs the code to show him on my laptop and they all pass*

Prof: Fine, let's run it together on mine again. *He runs it and they all pass on his laptop*..hmm, that's weird. They didn't pass when I ran them. Maybe, because of the IDE I used earlier.
Well, looks like you get your 100.

Me: Thank you but which IDE did you ran it in that failed? Just wondering..🤔

Prof: Doesn't matter now...they're passing. Just be ready for your next project...you guys will be writing the test cases yourself this time..

Friend sees me learning React js.

Friend: "Why are you always studying? Your exams are over and you already have a job."

Me: "Because I don't know it and it looks interesting?"

Friend: "What a waste of time..."

I try to upskill myself and friend gives me shit.

He's the type of guy that would watch a 5min YouTube video on a topic and suddenly become an expert in it.

I believe that a day without new knowledge is a waste of a day.

Dont know if that's normal or I'm just weird. But I still stand by it.

So I told my wife one week ago: "Yeah, you should totally learn to code as well!"

Yesterday a package arrived, containing a really beautiful hardcover book bound in leather, with a gold foil image of a snake debossed into the cover, with the text "In the face of ambiguity -- Refuse the temptation to guess" on it.

Well, OK, that's weird.

My wife snatches it and says: "I had that custom made by a book binder". I flip through it. It contains the Python 3.9 language reference, and the PEP 8 styleguide.

While I usually dislike paper dev books because they become outdated over time, I'm perplexed by this one, because of how much effort and craftsmanship went in to it. I'm even a little jealous.

So, this morning I was putting dishes into the dishwasher, and she says: "Please let me do that". I ask: "Am I doing anything wrong?"

Wife responds: "Well, it's not necessarily wrong, I mean, it works, doesn't it? But your methods aren't very pythonic. Your conventions aren't elegant at all". I don't think I've heard anyone say the word "pythonic" to me in over a decade.

And just now my wife was looking over my shoulder as I was debugging some lower level Rust code filled with network buffers and hex literals, and she says: "Pffffff unbelievable, I thought you were a senior developer. That code is really bad, there are way too many abbreviated things. Readability counts! I bet if you used Python, your code would actually work!"

I think I might have released something really evil upon the world.

I met my girlfriend cooking. She has no programming experience whatsoever and is quite computer illiterate. But that's fine as that's not something I need in a partner.

She regularly asks me what I'm working on. I'll try to explain it, and sometimes she definitely gets it, but sometimes she's clearly lost as fuck. She'll enthusiastically say things like "that's awesome honey!" To things that are just explanations. Sometimes it makes me laugh. Most of the time it leaves me in this weird confused state, like she's just pandering.

But I know she means well and wishes me the best. She's an amazing woman, and even if she doesn't get a single thing I try to explain, I'd much rather be with that than the "Why the fuck are you always playing on the computer?" Types of people I meet far more often.

Ever wanted cheat codes to devRant? Well, that's weird. But here you go, I guess.

Since the avatars do not use any external assets (Such as images), all avatars are generated. To be friendly to people who want to make third-party devRant clients (such as devRantron), avatars are generated server-side, so that the assets don't need to be distributed, and third-party programmers don't need to work out rendering avatars.

But this allows you to cheat a little.

The devRant avatars API works like this: you request a really long URL from the API, specifying the IDs of each cosmetic item the user has active, and it returns a PNG file. But you don't need an auth token to generate an avatar (which makes sense), so the avatar API is essentially a sandbox you can play around with if you have the time and patience.

You can write a really good avatar previewer with this knowledge, and see your avatar with a white tiger, even if you don't have the ++s

The Top 20 replies by programmers when their programs do not work:

20. "That's weird..."
19. "It's never done that before."
18. "It worked yesterday."
17. "How is that possible?"
16. "It must be a hardware problem."
15. "What did you type in wrong to get it to crash?"
14. "There is something funky in your data."
13. "I haven't touched that module in weeks!"
12. "You must have the wrong version."
11. "It's just some unlucky coincidence."
10. "I can't test everything!"
9. "THIS can't be the source of THAT."
8. "It works, but it hasn't been tested."
7. "Somebody must have changed my code."
6. "Did you check for a virus on your system?"
5. "Even though it doesn't work, how does it feel?
4. "You can't use that version on your system."
3. "Why do you want to do it that way?"
2. "Where were you when the program blew up?"

And the Number One reply by programmers when their programs don't work:

1. "It works on my machine."

Not my mom, but my wife's whole family. I'm a software developer.

So we're invited to her grandmother's 85th birthday celebration with pretty much every family member they could think to invite. 100+ people, and we all sit down in a circle in a huge room to watch a video that my wife's father and aunts/uncles put together.

They start the video and there's no sound. I'm a software developer, so I'm not an expert in hardware issues. I try to turn invisible, because every tech person knows what comes next, and this is in the center of a room of people I don't know.

After about 15 minutes of people struggling to get the audio working, one of the people remembers I "work with computer". Soon I have a dozen people calling me to the center of the room.

I begrudgingly make my way to the computer and projector. Upon inspection, I find that the computer is connected via VGA to the projector.

Me: "This cable only carries video. You need a different kind of cable, or you can hook up an AUX cable--the kind you use for headphones."
Other Guy: "I used this cable earlier and the audio was working."
Me: "...that's weird. Well, can we try plugging in an AUX cable?"
Yet Another Guy: "Will this help?" Holds up an HDMI cable
Me: "Oh, yeah! That should do it."
Other Guy: "I tried plugging that in, but it didn't change anything."
Me: "Hmmm..." Quickly unplug VGA and plug in HDMI, then click play.

The sound comes out in its full cheesy music glory. Everybody cheers, and I walk back to my seat. Throughout the rest of party, I'm approached by various other family members who ask me if I can fix X since I'm a "computer guy". Isn't it great to work in tech?

Hi there fellas,

I'm new to devrant and I'll like to share with you my first story.

It was my first payed job. A good friend of mine (media designer in print) called me "My customer needs a website, do you think you can do that?"
At this time I've never build a single page, so my answer was "Of course, easy-peasy".
She told me it was a family business and a nationwide player in finance sector.

I met the CEO, did my research and build a prototype. Well, the CEO and his staff liked it so I finished the website and prepared for the first review.

I booted the laptop and tried to connect to their network. There was none. They just never had a wireless connection not a single cable in the entire office. That was the time I realized that I work for a family business.
The CEO was an ancient guy who probably saw Jesus Christ hanging on the cross in personal and internet is weird thing controlled by the devil himself.

I took the laptop and went over to the CEOs personal office, plugged the network cable out of his Computer and into the laptop. Finally I could show them what I've done.

He took a look at it and called for his assistant. "Might you print that website for us?" That was my second wtf moment.

The assistant returned with a half chopped down and bleached rainforest that contained an image of their new website.

I tried to tell him that a website on paper can't show him the functions n shit, but he looked at me like I was talking two foreign languages at once.

So we reviewed the website on paper and his one and only problem was the size of the letters. "I can't read it well, please make the text bigger" At this moment I wanted to hit my forehead on the table and tell him that it is normal to have readings difficulties when you are walking the shores of Styx.

At the end everything went well, but I realized that dealing with customers is a lot more difficult than developing something for them. The future should prove me right.

That's it.
My first story about my first job.

Thank you for reading 😊

I go to unlock my car, but the button I usually use is gone. Instead now it unlocks by long-pressing the car handle.

Ok, got it.

Then my ignition isn't there? Oh, it's in the middle of the steering wheel now? Ok.. but it doesn't work? Oh I have to sign in with Google or Facebook, alright...

Wait, where's my odometer? Oh this is "card" view, and I guess I want "compact" view, huh. Is there a dark theme? Guess not.

Why can't I shift? Oh the stick is a hamburger button now, weird. Um, and reverse is in a sub-menu? That's going to get annoying.

Alright just need to look in the mirror to see if.. wtf? You call this "responsive" or something? I can't see out that tiny window.

I'm very disappointed in all this, I wonder if I can roll back. Oh WHERE ARE THE BRAKES OH GOD

UX DESIGNERS

HAVE

FUCKING

KILLED ME

WHY DID WE TRUST THEM AND THEIR GODFORSAKEN UPDATES

Storytime!

This customer comes in and practically throws a computer on the counter.

Customer: This computer isn't working. I've ran the diagnostics and it says it's software. *places a dvd case with a 32 bit Windows 7 disk in it on the counter* It had Windows 10 on it, but I want Windows 7 on it.

Me: Well, you may have issues with the drivers if you put Windows 7 on it--

Customer: I don't care, I just want Windows 7.

Me: You SHOULD care. That means no wifi, no display, no mouse... Windows 7 doesn't like Windows 10 hardware.

Customer: Then... check to see Windows 7 compatibility!

Me: Alright.... *makes notes to check for Windows 7 compatibility*

Me: So has this Windows 7 been used before?

Customer: Yes, it has.

Me: On how many computers?

Customer: I've installed it on two computers and it works just fine.

Me: That's weird because Windows license keys are for one computer only. Are both of them connected to the internet?

Customer: Yes.

Me: Well, okay then... *finishes up ticket*

Customer: I work in this field and I just don't understand why they don't come with the disks anymore. How much is a Windows 10 disk?

Me: *gives price*

Customer: And do you have any?

Me: Let me check *I go to where they are, find some and come back out*

Me: Unfortunately we're out at the moment and would have to special order some back in.

Customer: OK. So then how much to fix this computer?

Me: *price of installing Windows and backing up data*

Customer: That's halfway to the price of a new one of these!

Me: Well yes, an HP at Walmart... But you do have that option if you want to take it.

Customer: Well, why does it cost that much?

Me: Well, it's $labor1 to install Windows, $labor2 to do some basic setup and drivers, and $labor3 to backup and restore data.

Customer: Oh, well I don't want data.

Me: Okay, well then it would be $total - $labor3

Customer: ...Okay, fine

Me: *updates the ticket*

When she finally left I put it on the bench and the first message said "SMART ERROR." I then did 4 different tests that said "lol, the hard drive is failing."

If you "worked in this field," you would know that a SMART error is hard drive related.

If you worked in this field, you would know that Windows is only a 1PC license, so why are you lying about installing it with no issues on other computers?

If you worked in this field, you would know you would want a 64bit Windows on your computer.

If you worked in this field, you would know how to find a Windows 10 installation media online.

If you worked in this field, you would know that HPs are not good computers to get.

IF YOU FUCKING WORKED IN THIS FIELD YOU WOULDN'T BE SUCH A FUCKING CUNT.

The day I send myself about 76k mails
> be me
> be working on a rest api
> implement an error handler that would send me a mail with exception details
> use same error handler in mail send error handler
> Summoned the recursion devil by accident
> Test error handler
> Forgot port forwarding to SMTP server
> keep the debug session open
> throw new UnexpectedInterruptionException()
> get back to work
> Add the missing port forwarding rule to putty
> The error handler starts doing it's thing
> The handler chain starts to pop
> handler after handler executes
> PCFreeze.png
> WhatTheFuckIsGoingOn.gif
> VS finally accepts stop debugging
> PhoneVibrationSpam.mp3
> Peek into webmail
> WowFinallySomeFanMail
> Look into it
> Realizing what I have done
> Delete mailbox
> Remove recursion
> Wow that's how randy must have felt in southpark
> Feel weird
> Shutdown, go outside
> What's up anon?
> Nothing, really

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Seven months ago:
===============
Project Manager: - "Guys, we need to make this brand new ProjectX, here are the specs. What do you think?"

Bored Old Lead: - "I was going to resign this week but you've convinced me, this is a challenge, I never worked with this stack, I'm staying! I'll gladly play with this framework I never used before, it seems to work with this libA I can use here and this libB that I can use here! Such fun!"

Project Manager: - "Awesome! I'm counting on you!"

Six months ago:
====================
Cprn: - "So this part you asked me to implement is tons of work due to the way you're using libA. I really don't think we need it here. We could use a more common approach."

Bored Old Lead: - "No, I already rewrote parts of libB to work with libA, we're keeping it. Just do what's needed."

Cprn: - "Really? Oh, I see. It solves this one issue I'm having at least. Did you push the changes upstream?"

Bored Old Lead: - "No, nobody uses it like that, people don't need it."

Cprn: - "Wait... What? Then why did you even *think* about using those two libs together? It makes no sense."

Bored Old Lead: - "Come on, it's a challenge! Read it! Understand it! It'll make you a better coder!"

Four months ago:
==============
Cprn: - "That version of the framework you used is loosing support next month. We really should update."

Bored Old Lead: - "Yeah, we can't. I changed some core framework mechanics and the patches won't work with the new version. I'd have to rewrite these."

Cprn: - "Please do?"

Bored Old Lead: - "Nah, it's a waste of time! We're not updating!"

Three months ago:
===============
Bored Old Lead: - "The code you committed doesn't pass the tests."

Cprn: - "I just run it on my working copy and everything passes."

Bored Old Lead: - "Doesn't work on mine."

Cprn: - "Let me take a look... Ah! Here you go! You've misused these two options in the framework config for your dev environment."

Bored Old Lead: - "No, I had to hack them like that to work with libB."

Cprn: - "But the new framework version already brings everything we need from libB. We could just update and drop it."

Bored Old Lead: - "No! Can't update, remember?"

Last Friday:
=========
Bored Old Lead: - "You need to rewrite these tests. They work really slow. Two hours to pass all."

Cprn: - "What..? How come? I just run them on revision from this morning and all passed in a minute."

Bored Old Lead: - "Pull the changes and try again. I changed few input dataset objects and then copied results from error messages to assertions to make the tests pass and now it takes two hours. I've narrowed it to those weird tests here."

Cprn: - "Yeah, all of those use ORM. Maybe it's something with the model?"

Bored Old Lead: - "No, all is fine with the model. I was just there rewriting the way framework maps data types to accommodate for my new type that's really just an enum but I made it into a special custom object that needs special custom handling in the ORM. I haven't noticed any issues."

Cprn: - "What!? This makes *zero* sense! You're rewriting vendor code and expect everything to just work!? You're using libs that aren't designed to work together in production code because you wanted a challenge!?? And when everything blows up you're blaming my test code that you're feeding with incorrect dataset!??? See you on Monday, I'm going home! *door slam*"

Today:
=====
Project Manager: - "Cprn, Bored Old Lead left on Friday. He said he can't work with you. You're responsible for Project X now."

Navy story continued.
And continuing from the arp poisoning and boredom, I started scanning the network...
So I found plenty of WinXP computers, even some Win2k servers (I shit you not, the year was 201X) I decided to play around with merasploit a bit. I mean, this had to be a secure net, right?
Like hell it was.
Among the select douchebags I arp poisoned was a senior officer that had a VERY high idea for himself, and also believed he was tech-savvy. Now that, is a combination that is the red cloth for assholes like me. But I had to be more careful, as news of the network outage leaked, and rumours of "that guy" went amok, but because the whole sysadmin thing was on the shoulders of one guy, none could track it to me in explicit way. Not that i cared, actually, when I am pissed I act with all the subtleness of an atom bomb on steroids.
So, after some scanning and arp poisoning (changing the source MAC address this time) I said...
"Let's try this common exploit, it supposedly shouldn't work, there have been notifications about it, I've read them." Oh boy, was I in for a treat. 12 meterpreter sessions. FUCKING 12. The academy's online printer had no authentication, so I took the liberty of printing a few pages of ASCII jolly rogers (cute stuff, I know, but I was still in ITSec puberty) and decided to fuck around with the other PCs. One thing I found out is that some professors' PCs had the extreme password of 1234. Serious security, that was. Had I known earlier, I could have skipped a TON of pointless memorising...
Anyway, I was running amok the entire network, the sysad never had a chance on that, and he seemed preoccupied with EVERYTHING ELSE besides monitoring the net, like fixing (replacing) the keyboard for the commander's secretary, so...
BTW, most PCs had antivirus, but SO out of date that I didn't even need to encode the payload or do any other trick. An LDAP server was open, and the hashed admin password was the name of his wife. Go figure.
I looked at a WinXP laptop with a weird name, and fired my trusty ms08_067 on it. Passowrd: "aaw". I seriously thought that Ophcrack was broken, but I confirmed it. WTF? I started looking into the files... nothing too suspicious... wait a min, this guy is supposed to work, why his browser is showing porn?
Looking at the ""Deleted"" files (hah!) I fount a TON of documents with "SECRET" in them. Curious...
Decided to download everything, like the asshole I am, and restart his PC, AND to leave him with another desktop wallpaper and a text message. Thinking that he took the hint, I told the sysadmin about the vulnerable PCs and went to class...
In the middle of the class (I think it was anti-air warfare or anti-submarine warfare) the sysad burst through the door shouting "Stop it, that's the second-in-command's PC!".
Stunned silence. Even the professor (who was an officer). God, that was awkward. So, to make things MORE awkward (like the asshole I am) I burned every document to a DVD and the next day I took the sysad and went to the second-in-command of the academy.
Surprisingly he took the whole thing in quite the easygoing fashion. I half-expected court martial or at least a good yelling, but no. Anyway, after our conversation I cornered the sysad and barraged him with some tons of security holes, needed upgrades and settings etc. I still don't know if he managed to patch everything (I left him a detailed report) because, as I've written before, budget constraints in the military are the stuff of nightmares. Still, after that, oddly, most people wouldn't even talk to me.
God, that was a nice period of my life, not having to pretend to be interested about sports and TV shows. It would be almost like a story from highschool (if our highschool had such things as a network back then - yes, I am old).
Your stories?

Life Coach: "I want a website where I can charge $5,000 for 6 weeks of coaching for [weird life problem very few people have or think about].

Me: "That'll be $5,000."

Life Coach: "That's too expensive for a website."

Me (inner voice): "tHaT's ToO eXpEnSiVe FoR a WeBsItE."

Me (real voice): "Consider it not as a cost but as an investment necessary to obtaining your first customer. Once the first customer is realized, you've paid for the website and the future customers will make you profitable.

A quite normal Windows day:

Bios to Windows: "Go now! Get up!"

Windows to Bios: "Always slow with the young circuit boards."

"I've got something weird on screen."

Windows' answer: "Ignore it first."

Hardware assistant to Windows: "The user puts pressure. He wants me to identify this thing. Could be an ISDN card."

Windows: "Well, well."

Unknown ISDN card to all: "Will you please let me in?"

Network card to intruder: "You can't spread out here!"

Windows: "Quiet in the case! Or I'll cut both their support!"

Device Manager: "Offer compromise. The network card is allowed on Mondays, the ISDN card is on Tuesday."

Graphics card to Windows: "My driver retired yesterday. I'm crashing now."

Windows to graphics card: "When will you be back?"

Graphics card: "Well, not at first."

CD-Rom drive to Windows: "uh, I would have a new driver here..."

Windows: "What's ich´n supposed to do with it?!"

Installation software to Windows: "Leave it, I'll mach´ that already."

Windows: "That's nice to hear."

USB connection to interrupt management: "Alarm! Just been penetrated by a scanner cable. Request response."

Interrupt management: "Where are you coming from?"

USB connection: "I was in the computer right from the start. I'm joined by another colleague."

"You're not on my list." - "Say something."

Windows: "Hopefully there won't be another printer."

Graphics card: "The new driver twitches."

Windows: "We'll just have to get the old one out of retirement."

Uninstall program to new driver: "Go away."

Unwanted driver: "Fuck you."

Windows to Norton Utilities: "Kill him and his brood!"

Utilities to driver rests: "Sorry, we have to delete you."

Important system file: "Arrrrrrgghh!"

Windows on blue screen: "Gib´, the Norton Boys are over the top again."

Blue screen to user: "So, that's it for this week."

Excuse me for stealing your time

And I know it's way too long

Had this with a relative. His laptop wasn't turning on, with or without charger so he brought it back to the store to fix it. It ran elementary os by the way (detail for later). Then he got it back after a week and we booted it and it had windows 8 installed (wtf indeed). So we called the service desk to ask about it since the issue was a broken charger (!!!). Their reply: oh yeah there was a weird system installed on it so we thought we'd reset it as well for you.

SERIOUSLY, THAT'S NOT YOUR FUCKING JOB!!

He is not tech savvy and he didn't know much about backups so that was literally about one year of work GONE. Yeah, I setup a cloud backup sync thingy for him right after that.

I'm gonna be honest with you guys.

I need a friend. A real friend. And I'm looking for one (or many) among you.

Is any of you interested in being my friend?

I know, it sounds weird. My inner self bully is bringing to mind many adjectives for saying that: faggot, weak, snowflake, gay, pussy, clingy, demanding.

I know. But I'm at the edge of 30 and I think it's better if I cut the shit and just be very clear about the type of friend I'm looking for.

I need people that will be there when the shit gets tough.

I can joke with you,
I can laugh my ass off with you,
I can passionately argue about what's the better programming language.

But most importantly, I can be there when you're depressed, when you want to punch your boss in the face, when you're griefing a loved one that is gone.

And that exactly what I'm looking in a friend.

I used to have friends in life, but a variety of circumstances caused some distance: commitments, personality changes, physical distance, or just a feeling that they don't give two shits about me.

Am I the perfect friend? Not at all. I have a temper and am quite opinionated about my tools, but most of the times I try to be a not-asshole.

I might get angry and be very honest when I don't like something, but it would be very weird for me to turn my back on a friend.

It is impossible for someone to be friends with and to like everyone. But the least I can do is just give anyone a chance.

I think friendships are just things that take time and grow if there is enough care put into them.

Here's my discord chirptune#1829, so if you add me, please let me know your username here.

I think it'd be cool to have like a brotherhood on discord or slack of people looking out for each other (jesus christ, that sounds corny as fuck)

Not to rob people from devrant, I just think that the board style can't fulfill deeper social needs imo, that's all.

Let me preface this by saying I'm not a designer.

While I can make individual bits of a site look good, and I'm actually pretty skilled with CSS/Sass, overall design completely escapes me. I can't come up with good designs, nor do I really understand *why* good designs are good. It's just not something I can do, which feels really weird to say. but it's true.

So, when I made the Surfboard site (that's the project's internal name), I hacked everything together and focused on the functionality, and later did a branding and responsive pass. I managed to make the site look quite nice, and made it scale well across sizes/devices despite being completely new to responsiveness. (I'm proud, okay? deal.)

After lots of me asking (in response to people loudly complaining that the UI doesn't have X feature, scale properly on Y device, and doesn't look as good as Z site), the company finally reached out to its UI contractor who does their design work. After a week or two, he sent a few mockups.

The mockups consisted of my existing design with a darker background, much better buttons, several different header bars (a different color) with different logo/text placements, and several restyled steppers. He also removed a couple of drop shadows and made some very minor styling changes (bold text, some copy edits). Oh, he also changed the branding colors. Nothing else changed. It's basically the same exact site but a few things look a little better. and the branding is different.

My intermediary with the designer asked for "any feedback before finalizing the designs" -- which I thought odd because he sent mocks for two out of the ten pages (nine plus a 404 page). (Nevermind most of the mocks showed controls from the wrong page...).

So, I typed up a full page of feedback. Much of it was asking for specifics such as responsive sizing on the new header layout, how the new button layout would work for different button counts, asking for the multitude of missing pages/components, asking why the new colors don't match the rest of our branding, etc. I also added a personal nitpick about flat-looking controls because I fucking hate them. Everything I wrote was very friendly and professional.

... His response was full of gems. Let me share a few.

1. "Everything about the current onboarding site looks like a complete after-thought." (After submitting a design basically identical to mine! gg!)

2. "Yes [the colors match our current branding]." (No. They don't. I checked. The dark grey is different, the medium grey is different, the silver is different, the light blue is different. He even changed the goddamn color of the goddamn LOGO for fuck's sake! How the fuck is that "matching"?!)

3. "Appreciate the feedback [re: overlapping colored boxes, aka 'flat'], design is certainly subjective. However, this is the direction we are going." (yet it differs from the rest of our already-redesigned sites you're basing this off. and it's ugly as shit. gg again :/)

4. "Just looked at the 404 page. It looks pretty bad, and reflects very poorly on the [brand name] brand. Definitely will make a change here!" (Hey! I love that thing. It's a tilted, dotted outline of a missing [brand product] entirely drawn with CSS. It has a light gray "???" underlay and some 404 text inside. Everyone I showed it to, coworkers and otherwise, loved it. "Looks pretty bad". fuck you.)

I know I shouldn't judge someone so quickly, but what the fuck. This guy reminds me of one of those pompous artists/actors who's better than everyone and who can never be wrong, even while they're contradicting themselves.

just.
asfjasfk;ajsg;klsadfhas;kldfjsdl.

Guys, my unfortunately daily rant of my pm

I was told to create a docker env for our team. Good. Document the process so everyone can know what to do. Good.

My PM follows what he wants to instead of step by step and changes whatever he wants to.

I am asked for help because he doesnt know. No prob.

Me: "Do this, do this and.."
PM: "that doesnt matter, trust me, I could change it and.."
Me: "...and it wont work"
PM: "I know suff too, check" *does his changes aaaaaand doesnt work*
* awkward staring*

That happened a while ago.
This week, he crashed his git repo because he was doing things in docker team (including him) decided not to.

Took me more enough time explaining him "you are not supposed to do that in the container" funny fact he wanted to prove that his way was right and even if he did my way it would crash.

Sooooo he did my way just to prove how wrong I was. Everything worked flawlessly. Rage-still-awkward staring.

Plus the "aww that's weird. I dont know how this happened"

So I was at work and send to another location (distribution centers) and in the lunch break my guider for that day and I started a conversation about servers etc (he appeared to do loads of stuff with that). He recommended me all those programs but I didn't recognize anything so I asked him what kinda servers he ran. He runs a lot of Windows servers. No problem for me but I told him that I am into Linux servers myself.

Guy: "Linux guy, eh? That system is considered to be so secure but in reality it's insecure as fuck!".

Me: (If he would come up with real/good arguments I am not going to argue against that by the way!) Uhm howso/why would you think that?
Guy: "Well all those script kiddies being able to execute code on your system doesn't seem that secure.".

*me thinking: okay hold on, let's ask for an explanation as that doesn't make any fucking sense 😐*

Me: "Uhm how do you mean, could you elaborate on that?"

Guy: "Well since it's open source it allows anyone to run any shit on your system that they'd like. That's why windows rocks, it doesn't let outsiders execute bad code on it.".

Seriously I am wondering where the hell he heard that. My face at that moment (internally, I didn't want to start a heated discussion): 😐 😲.

Yeah that was one weird conversation and look on open source operating systems...

*reads JSON license*
"The Software shall be used for Good, not Evil."

Well that's actually a nice license.. if only nuclear research etc could be licensed like that.

Wait actually.. WanBLowS is using XML for its "diagnostic data", right? I always found it so weird that they don't use JSON for that.. but I guess that this is why 🙃

Here's the time an Amazon recruiter scheduled a call with me just to tell me I wouldn't be getting the job.

A few years ago, I left Uber after the seemingly non-stop public snafus they were getting themselves into (I have a lot of rants about Uber if anyone is interested, some of them mind-melting). I decided to take a two month break given that my financials looked decent for once and I was tired of 100 hour weeks.

During that time, I of course started perusing the typical job-seeking sites I had remembered from before. Somehow, from one of the profiles I set up, I caught the eye of an Amazon recruiter. They emailed me and I agreed to set up a date and time for an introductory chat.

They already had my CV. They already had my StackOverflow/Github information. This wasn't a technical interview, and the recruiter wasn't part of any of the tech teams. This is important information moving forward.

A few days later, I got the call from the recruiter. He introduced himself as the person from the emails, thanking my for my time, etc.. Things started out pleasant with the smalltalk and whatnot, but then the recruiter said "so I have some concerns about your resume".

Under one of the sections I had a list of things I was skilled with - one of which, regrettably, is PHP. Completely ignoring Java, Javascript, C# and C++ knowledge and all of the other achievements I have with those technologies, the recruiter really wanted to drill me about the PHP.

"Do you work a lot with PHP?"
"No, not anymore - from time to time I have to do something with it but it's not my main language anymore. I know it quite well, though."
"Oh okay well we aren't looking for any PHP roles right now, unfortunately."
"Okay, no problem."

Perhaps I could have said more, but from my end of things, I meant "I don't see a problem here, I don't write a lot of PHP and you don't need a lot of PHP".

After a pause that felt like an hour, the recruiter broke the silence and said "Okay well thanks for your time today, I'm sorry things didn't work out."

Bewildered, I asked which technology stack they were using on the team.

"Not PHP, unfortunately. Thank you for your time." and then an abrupt click.

The recruiter found me himself, looked at my resume (assumably), sought out to contact me, arranged a time for a call, and then called me, just to tell me I wouldn't get the position due to knowing PHP at some point in my career.

Years later, the whole interaction still shocks me. Somewhere in my drafts I have a long letter to the recruiter basically going over my entire career history explaining why his call was incredibly... well, fucking weird. Towards the end of writing it I realized it was more therapeutic for me to deal with whatever it was that just took place and that it probably wouldn't change my odds of working at Amazon.

So yeah. That's the story of the time Amazon set up a recruiting call just to tell me I wouldn't be working for them.

Following a conversation with a fellow devRanter this came to my mind ago, happened a year or two ago I think.

Was searching for an online note taking app which also provided open source end to end encryption.

After searching for a while I found something that looked alright (do not remember the URL/site too badly). They used pretty good open source JS crypto libraries so it seemed very good!

Then I noticed that the site itself did NOT ran SSL (putting the https:// in front of the site name resulted in site not found or something similar).

Went to the Q/A section because that's really weird.

Saw the answer to that question:

"Since the notes are end to end encrypted client side anyways, we don't see the point in adding SSL. It's secure enough this way".

😵

I emailed them right away explaing that any party inbetween their server(s) and the browser could do anything with the request (includingt the cryptographic JS code) so they should start going onto SSL very very fast.

Too badly I never received a reply.

People, if you ever work with client side crypto, ALWAYS use SSL. Also with valid certs!

The NSA for example has this thing known as the 'Quantum Insert' attack which they can deploy worldwide which basically is an attack where they detect requests being made to servers and reply quickly with their own version of that code which is very probably backdoored.

This attack cannot be performed if you use SSL! (of course only if they don't have your private keys but lets assume that for now)
Luckily Fox-IT (formerly Dutch cyber security company) wrote a Snort (Intrustion Detection System) module for detecting this attack.

Anyways, Always use SSL if you do anything at all with crypto/sensitive data! Actually, always use it but at the very LEAST really do it when you process the mentioned above!

My first job out of college I worked in the professional services of a dotcom. My company was a subcontractor to a major consultancy, so we worked alongside their engineers. There was one guy that only ever named his variables three letter initials of family members. If you tried changing the code he reverted them back. If that's not weird I don't know what is.

How my keyboard evolves:

0. Like any normal man, I started with a cheap standard Qwerty keyboard. As I began learning programming, I wanted something more elegant, so...

1. I've been using layout Dvorak (and then Programmer Dvorak) for like 5 years+ now. Anyone has intention to type on my machine soon gives up or even is blocked by me from the very start. It always takes a couple of minutes to explain to them what's going on here. They think I'm weird. I feel untouchable :)

2. My first mechkey was a 104-key Filco. Time flew by and I wanted my thing to be more compact so I went for a 66% and a TKL.

3. Recently I find out that though my keyboard is not a full-sized, there're yet some keys I've never touched (the bottom right modifiers, scroll lock, etc), so I look for a leaner one: HHKB and its alike but with slight remappings. Now I'm satisfied with the tiny, corners-trimmed keyboard but others look at it and ask how it is even possible to scroll the web page using the thing.

Prob 1: my boss can never type on my keyboard. Sometimes he still grumbles when he cannot correct my fouls right on my machine.

Prob 2: my keyboards at home and at work are not the same and some keymapping cannot applied to one of the two. That's async.

It's kind of neat knowing people who are famous for things I don't care about, and having their numbers / talking semi-regularly. They're a special person to so many others, but to me they're just some random person that's mildly annoying.

Like API Guy.
Freaking API Guy.
He's a millionaire musician who's adored by literally millions of people, but none of them know he writes absolutely terrible APIs, zero tests, rushes to the shiniest new things, and happily agrees to everything (often without listening) only to deny it later. Absolutely infuriating.

Or knowing one of Netscape founders as that strange and really terrible trumpet player with the great tequila. He did give me his copy of The C Programming Language (the bible) though. He was cool. Super weird, but cool.

It's just a strange feeling. I don't care, and yet others inexplicably think I should. I don't understand it. They're just people? idk.

Sorry for being late, stuffs came inbetween!

I have done a few privacy rants/posts before but why not another one. @tahnik did one a few days ago so I thought I'd do a new one myself based on his rant.

So, online privacy. Some people say it's entirely dead, that's bullshit. It's up to an individual, though, how far they want to go as for protecting it.

I personally want to retain as much control over my data as possible (this seems to be a weird thing these days for unknown reasons...). That's why I spend quite some time/effort to take precautions, read myself into how to protect my data more and so on.

'Everyone should have the choice of what services they use' - fully agreed, no doubt about that.

I just find one thing problematic. Some services/companies handle data in a way or have certain business models which takes the control which some people want/have over their data away when you communicate with someone using that service.

Some people (like me) don't want anything to do with google but even when I want to email my best fucking friend, I lose the control over that email data since he uses gmail.

So, when someone chooses to use gmail and I *HAVE* to email them, my choice is gone.

TO BE VERY CLEAR: I'm not blaming that on the users, I'm blaming that on the company/service.

Then for example, google analytics. It's a very good/powerful when you're solely looking at its functions.
I just don't want to be part of their data collection as I don't want to get any data into the google engine.

There's a solution for that: installing an addon in order to opt out.

I'm sorry, WHAT?! --> I <-- have to install an addon in order to opt out of something that is happening on my own motherfucking computer?! What the actual fuck, I don't call that a fucking solution. I'll use Privacy Badger + hosts files to block that instead.

Google vs 'privacy' friendly search engines - I don't trust DDG completely because their backend is closed/not available to the public but I'd rather use them then a search engine which is known to be integrated into PRISM/other surveillance engines by default.

I don't mind the existence of certain services, as long as they don't integrated you with data hungry companies/mass surveillance without you even using their services.

Now lets see how fast the comment section explodes!

*Opens a pack of tablets (8000) and start to prep them.*
WHAT THE ACTUAL FUCK.
SAME MAC ADDRESS.
Okay, that's just an er-
NOPE, ANOTHER ONE. HOLY SHIT. OKAY IT'S GETTING WORSE.
Is it my db?
Oh.
The db is just fine.
*Painfully getting in contact with the reseller*
Me: grumbles grumbles Mac Address grumbles
Reseller: Uh.. What?

It would be okay if we weren't using Mac Addresses as primary key in our databases.
They gave us some weird-looking software to "re-write mac addresses". It's working.

Something tells me that ipv6 is not for tomorrow.

Continuation of the story with Linux Mint 20 Cinnamon on the old Core2 Duo with 2 GB RAM and HDD. The guy has had that PC under Linux for 1.5 months now, had never had Linux before, has no IT background, and is over 70.

Upon visit, I checked how the machine was doing. OK, he had forgotten to apply the updates, so I highlighted paying attention to the red icon in the tray. Launched the updates, all ran through.

Otherwise, he had managed to install Skype all by himself (network effect because of his family...) and had bought a webcam plus a microphone. Linux had just recognised everything without any fuzz. Even his Skype buddies were impressed, he said.

On top of that, he likes how much faster that PC is compared to his much more current Win 10 laptop and actually uses the old Linux PC more than the laptop.

He also enjoys that Linux doesn't do weird things all by itself all the time. That's not his experience with Win 10.

This morning:
SLACK HAS A DARK THEME! ALL GLORY TO THE AMAZING SLACK TEAM! SLACK FOR PRESIDENT!

This afternoon:
OH GOD THIS THEME MAKES ME WANT TO SCOOP THE EYES OUT OF MY SOCKETS THE FONT LOOKS UGLIER THAN THE PILE OF SKINFAT I SCRAPED OFF MY MOUSE ITS AWFUL I NEED HUGS SEND HELP

Thanks, companies, for trying, I guess.

I love dark themes, but the ones provided are often even worse than the light themes.

They go overboard with extreme black/white contrasts, pick a super weird hue of puke-gray, or certain elements are unreadable.

So, please, instead of wasting the time of your designers on something that's clearly too difficult for them.... how about just making it easy to create community themes for your app?

Especially if it's an electron app, how hard is it to add a config option to import a CSS file, and provide one template as an example?

I swear I work with mentally deranged lunatics.
Dev is/was using TFS's web api to read some config stuff..

Ralph: "Ugh..this is driving me crazy. I've spent all day trying to read this string from TFS and it is not working"
Me: "Um, reading a string from an web api is pretty easy, what's the problem?"
Ralph: "I'm executing the call in a 'using' statement and cannot return the stream."
Me: "Why do you need to return a stream? Return the object you are looking for."
Ralph: "Its not that easy. You can return anything from TFS. All you get back is a stream. Could be XML, JSON, text file, image, anything."
Me: "What are you trying to return?"
Ralph: "XML config. If I use XDoc, the stream works fine, but when I step into each byte from the stream, I the first three bytes have weird characters. I shouldn't have to skip the first three bytes to get the data. I spent maybe 5 hours yesterday digging around the .Net stream readers used in XDoc trying to figure out how it skips the first few bytes."
Me: "Wow...I would have used XDoc and been done and not worried about that other junk."
Ralph: "But I don't know the stream is XML. That's what I need to figure out."
Me: "What is there to figure out? You do know. Its your request. You are requesting a XML config."
Ralph: "No, the request can be anything. What if Sam requests an image? XDoc isn't going to work."
Me: "Is that a use-case? Sam requesting an image?"
Ralph: "Uh..I don't know...he could"
Me: "Sounds like your spending a lot of time doing premature optimization. You know what your accessing TFS for, if it's XML, return XML. If it's an image, return an image. Something new comes along, modify the code to handle it. Eazy peezy."
<boss walks in from a meeting>
Boss: "Whats up guys?"
Ralph: "You know the problem with TFS and not being able to stream the data I had all day yesterday? I finally figured it out. I need to keep this TFS reader simple. I'll start with the XML configs and if we more readers later, we can add them."
Boss: "Oh yea, always start simple and add complexity only when you need it."

Frack...Frack..Frack...you played some victim complaining to anyone who would listen yesterday (which I mostly ignored) about reading data from TFS was this monumental problem no one could solve, then you start complaining to me, I don't fall for the BS, then tell the boss the solution was your idea?

Lunatic or genius? Wally would be proud.

My older brother just moved out today. For 18 years I've shared a room with him, and now he's gone. I have a ~30x10 foot room all to myself (it's the entire second floor of my house).

I do love that now I'm able to play music anytime, and with his stuff gone, it'll be less space taken up in general, that type of thing.

I've been in this room with him for over 8 years now, after my oldest brother moved out, and I've always had this feeling that one portion of the room was mine and the other portion was his. Now it's just...weird. I have both portions now. I have this whole big room to maintain myself. I don't have to worry about my stuff conflicting with his for whatever reason.

The past few weeks, when he's talked about moving out, I've always told him that I was looking forward to it, to having the whole room to myself. Now that he's gone, I just...can't. I can't bring myself to move his stuff that he hasn't taken over to the new house yet, or clean his part of the room.

When we were kids we didn't really get along, and I HATED sharing a room with him. But over time, as we grew up, we started to get along better, and for the past couple years, we've always just talked in the middle of the night when we were both awake. And now he's gone (the new house is maybe a 10 minute drive away), and I know he's not coming back. I know that this whole space is mine now.

I'm gonna miss the talks in the middle of the night, and us keeping each other in check (whenever one of us isn't home in the middle of the night we tend to text each other like "bruh where the fuck you at"), and waking up in the middle of the night (when I'm able to actually fall asleep kinda early) to see him playing Skyrim or Fallout. Hell, even coming home from work or wherever to see him passed the fuck out.

I know that I'm gonna have to clean the whole room soon, and that I'll just have to get over it. I've always been the one in my family that doesn't really show emotion very often, unless I get angry, so when people were crying earlier, I just sat there with an emotionless look on my face. But that's also because I wasn't really feeling much at the time, it didn't really hit until I got home and came upstairs to my room. Hell, right now I'm sitting here just expecting to hear his car alarm as he locks his car like I normally hear every night.

Worst meeting:
Boss: *calls everyone* URGENT MEETING. If you're on your lunch break, then stop and join the video call. Is it a weird time in your timezone? Wake up. But COME

Omg what happened? Is the server down? Are we getting a huge client? What is so urgent that it needs all of our attention right now?

Boss: I'm afraid that I won't be able to stay long in this meeting.

... then WHY the f did you call this meeting?

Boss: that's why we'll have a meeting next at *such hour*. In the meantime, talk to your respective departments about what you've been doing and what you need from each other. See you!

No comment

I starten when I was 12 years old. I got bullied and got interested in computers. One day I crashed my dads computer and he reinstalled it. After that my dad made two accounts. The regular user (my account) and the Administrator user (my dads account). He also changed the language from Dutch to English. Gladly I could still use the computer by looking at the icons :')

Everytime I needed something installed I had to ask my dad first (for games mostly because there was no cable internet at that time). Then I noticed the other user account while looking over my dads shoulders. So I tried to guess the password and found out the password was the same as the label next to the password field "password".

At that point my interest in hacking had grown. So when we finally got cable internet and my own computer (the old one) MSN Messenger came around. I installed lots of stuff like flooders etc. Nobody I knew could do this and people always said; he is a hacker. Although it is not.

I learned about IP-address because we sometimes had trouble with the internet. So when my dad wasn't home he said to me. Click on this (command prompt) and type in; ipcondig /all. If you don't see an IP-address you should type in; ipconfig /renew.

Thats when I learned that every computer has a unique address and I started fooling around with hacking tools I found on internet (like; Subseven).

When I got older I had a new friend and fooled around with the hacking tools on his computer. Untill one day I went by my friend and he said; my neighbor just bought my old computer. The best part was that he didn't reinstall it. So we asked him to give us the "weird code on the website" his IP-Address and Subseven connected. It was awesome :'). (Windows firewall was not around back then and routers weren't as popular or needed)

At home I started looking up more hacking stuff and found a guide. I still remember it was a white page with only black letters like a text file. It said sometime like; To be a hacker you first need to understand programming. The website recommended Visual Basic 6 for beginners. I asked my parents to buy me a book about it and I started reading in the holliday.

It was hard for me but I really wanted to hack MSN accounts. When I got older I just played around and copy -> pasted code. I made my own MSN flooders and I noticed hacking isn't easy.

I kept programming and learned and learned. When I was 16/17 I started an education in programming. We learned C# and OOP (altho I hated OOP at first). I build my own hacking tool like "Subseven" and thats when I understood you need a "server" and "client" for a successful connection.

I quit the hacking because it was getting to difficult and after another education I'm now a fulltime back-end developer in C#.

That's my story in short :)

writing library code is hard.

there are sooo many details that go into writing good libraries:

designing intuitive and powerful apis
deciding good api option defaults, disallowing or warning for illegal operations

knowing when to throw, knowing when to warn/log
handling edge cases
having good code coverage with tests that doesn't suck shit, while ensuring thry don't take a hundred years to run

making the code easy to read, to maintain, robust
and also not vulnerable, which is probably the most overlooked quality.

"too many classes, too little classes"

the functions do too much it's hard to follow them
or the functions are so well abstracted, that every function has 1 line of code, resulting in code that is even harder to understand or debug (have fun drowning in those immense stack traces)

don't forget to be disciplined about the documentation.

most of these things are
deeply affected by the ecosystem, the tools of the language you're writing this in:

like 5 years ago I hated coding in nodejs, because I didn't know about linters, and now we have tools like eslint or babel, so it's more passable now

but now dealing with webpack/babel configs and plugins can literally obliterate your asshole.

some languages don't even have a stable line by line debugger (hard pass for me)

then there's also the several phases of the project:

you first conceive the idea, the api, and try to implement it, write some md's of usage examples.

as you do that, you iterate on the api, you notice that it could better, so you redesign it. once, twice, thrice.

so at that point you're spending days, weeks on this side project, and your boss is like "what the fuck are you doing right now?"

then, you reach fuckinnnnng 0.1.0, with a "frozen" api, put it on github with a shitton of badges like the badge whore you are.

then you drop it on forums, and slack communities and irc, and what do you get?

half of the community wants to ban you for doing self promotion

the other half thinks either
a) your library api is shitty
b) has no real need for it
c) "why reinvent the wheel bruh"

that's one scenario,

the other scenario is the project starts to get traction.

people start to star it and shit.
but now you have one peoblem you didn't have before: humans.

all sorts of shit:

people treating you like shit as if they were premium users.

people posting majestically written issues with titles like "people help, me no work, here" with bodies like "HAAAAAAAAAALP".

and if you have the blessing to work in the current js ecosystem, issues like "this doesn't work with esm, unpkg, cdnjs, babel, webpack, parcel, buble, A BROWSER".
with some occasional lunatic complaining about IE 4 having a very weird, obscure bug.

not the best prospect either.

!dev

This is the one thing about Spotify that annoys the living hell out of me (yes, I use spotify, if anyone knows a good/working self hosted alternative, let me know! I've tried quite a few including funkwhale but they all failed for me).

I'm a raw hardstyle/rawstyle lover and listen to the raw duo Malice a lot. Now, what would the problem be here? Sometimes, there are several artists in different scenes with the same name. This is completely fine.

Spotify, however, mixes up music of the raw duo Malice and the rock/metal band Malice. I keep getting release notifications/news regarding new music/events from Malice but 90 percent of the time this is about the rock/metal band and NOT the raw duo.
It's also very weird to suddenly hear rock music while listening to my daily mix; the wrong malice is mixed in once again.

Yesterday I got an email saying "Check out Malice's newest release on Spotify!"

*OH FUCK YEAH*
*opens Spotify release radar*
*YAAA....FUCK*
That's the other malice 😡

Is it so hard, Spotify? Entirely hiding the artist results in the right one being hidden as well for me 😞

Well now, I wouldn't want to mention anyone specific since talking about someone behind their back and calling them 'weird' isn't very nice. 🙄 But absolutely HYPOTHETICALLY speaking, if I HAD a weird coworker, they would probably...
- ... strut about the office, telling all how great yet underpaid their work is
- ... write lots of 'concepts' because coding is for lowly programmers
- ... insist that the code they have to do when boss is looking is simply too complicated for unit testing, and 'that's great!'
- ... brag about their/wear to work a ridiculous array of ties in every colour imaginable, when everyone else shows up casual

- ... trap people into listening to them talk for hours about...
-- ... ties
-- ... their misspent youth
-- ... how awesome they are/were/will be
-- ... why it's a good idea to eat cheese

- ... never let me forget I'm female, coz *insert BS reasons why all devs must by nature be male here*
- ... send me little unsolicited notes and mails with funny (sexist) jokes *har har*

- ... be let go, at which point everyone else discovers why they had so much time that they could spend chatting away at the watering hole
- ... earn the eternal hatred of anyone picking up the pieces of their 'work'
- ... try to steal our customers away who will laugh in their bloody face

Just my theory, of course..

WHAT THE ACTUAL FUCKING FUCK MICROSOFT?!!
I go to log into my laptop:
me: *enter the pin*
Windows: Error
me: Ok let's try the password...
Win: WRONG PASSWORD!
me: *checking my password manager* Nope, pretty sure that's correct... Ok, whatever let's try to reset it.
me: *generates new password and resets the password for the account*
Windows: You can now log in
me: *enters the new password*
Windows: WRONG PASSWORD!
me: that's weird... let's try that again
Windows: WRONG PASSWORD!
me: Ok... reset once more *I enter the same password I generated before*
Windows: ThAt Is An OlD pAsSwOrD
me: *getting really pissed* FINE, GODDAMIT, HERE, NEW PASSWORD
Windows: You can now log in
me: *enters the new new password*
Windows: wRoNg PaSsWoRd!

jdjsjcjj+3+@!o(€;#@!(&(1!!#((#(€_"jsjeucjcjfdjosdifhshabxnfnxjsosoguwqlqqlall#7@+1(
aaaaaáaaaaaaaaaaaaaaaaaaaaaaaaaa

FUCK FUCK FUCK FUCK FUCK FUCK FUCK
YOU FUCKING INCOMPETENT CUNTS AT MICROSOFT!!!!!1!!!!!!!

I'M GONNA FUCKING TEAR YOU INTO THOUSAND PIECES AND THEN RUN YOU THROUGH A SHREDDER!!

YOU MOTHERFUCKING IDIOTIC CUNTS
FREAKING DEGENERATES

I've been lurking for a while but I had it up to here with these goddamned "js sucks" posts.

I'm not gonna deny js has severe design problems,
or that chromium is a motherfucking vampire
or that it's a goddamn pain in the ass to understand how to babel webpack + plugins correctly

that is all true.

the problem is that it's just a lazy damn circlejerk at this point where no learning is gained, with no outlook on any possible solution of these problems, let alone ANY type of actual collaboration to help the situation.

sometimes people don't even care to specify what is specifically wrong with js. It's just "js sucks" and that's it, farm ++.

slack is a ram hog, yes, yes, we know... WE KNOW.
every 5 days someone has to remind that!

is there any solution? why is it a ram hog? is electron the problem, or is the slack source code doing weird shit?
are there any lightweight alternatives to electron?

That's actual good conversation, but no, apparently it's impossible to drop the snarky tone for 2 seconds.

I think it's fine to point out defficiencies in applications, but it's not ok to shitpost on and on.

I would very ok with someone shitcomplaining about js is if they were doing something about it.

I'm still ok with people letting of some steam, I'm fine with people expressing frustration from direct work experience with js. I'm not ok with people and their ignorance and snarky comments and non helpfulness while comfortably laughing from their own camp of totally unrelated technologies.

Hearing sysadmins or people that code exclusively in c shit on js makes me feel my insides twirl.

Imagine I didn't do shit for linux, but I went around forums pointing out the defficiencies, like the lack of standards, and saying that mac is way better.

Or I if yapped on and on about openvpn and having an obscure as fuck api, meanwhile not doing a single fucking thing about it, or not even using it in a day to day basis.

do you hate slack's ram usage? me too and js isn't going anywhere in the next 5 years, so either do something or provide smart conversation, diagnosis of the problem or possible alternstives/solutions, otherwise stfu

Dynamically typed languages are barbaric to me.

It's pretty much universally understood that programmers program with types in mind (if you have a method that takes a name, it's a string. You don't want a name that's an integer).

Even it you don't like the verbosity of type annotations, that's fine. It adds maybe seconds of time to type, which is neglible in my opinion, but it's a discussion to be had.

If that's the case, use Crystal. It's statically typed, and no type annotations are required (it looks nearly identical to Ruby).

So many errors are fixed by static typing and compilers. I know a person who migrated most of the Python std library to Haskell and found typing errors in it. *In their standard library*. If the developers of Python can't be trusted to avoid simple typing errors with all their unit tests, how can anyone?

Plus, even if unit testing universally guarded against typing errors, why would you prefer that? It takes far less time to add a type annotation (and even less time to write nothing in Crystal), and you get the benefit of knowing types at compile time.

I've had some super weird type experiences in Ruby. You can mock out the return of the type check to be what you want. I've been unit testing in Ruby before, tried mocking a method on a type, didn't work as I expected. Checked the type, it lines up.

Turns out, nested away in some obscure place was a factory that was generating types and masking them as different types because we figured "since it responds to all the same methods, it's practically the same type right?", but not in the unit test. Took 45 minutes on my time when it could've taken ~0 seconds in a statically typed language.

I try as hard as possible not to be judgemental towards incompetent colleagues, motivating myself with the knowledge that we were all incompetent at some point, and that people need a chance to learn, and that sometimes too much pressure will lead you to believe that they're bad. Or sometimes, people just aren't good at the stuff you want them to be good, and you just need to discover that niche where they will be very useful.

Mostly that goes well.
I've had the incompetent late bloomer who was a family man who started too late to dev, and wasn't really serious. A bit of harsh talk, some soul searching over a few beers, made him into a really valuable asset. Not the brightest rock, but reliable, steady-paced developer who earned his stay.
Then there was the girl who wasn't really good at coding, but saved our team from disaster many times by keeping things into account, and realizing what must be developed or tested at every step.

However, there are exceptions. I've worked with people who have been nothing but a menace, through their incompetence AND attitudes.

The most noteworthy example was an intern that we sought out, by talking to professors to point us to their best students. So we got that intern on board. He seemed strange at first. Kind of perfectionist. Talked serious, with an air of royalty, and always dressed sharply. He really gave the impression that one must be worthy to receive his blessing. The weirdest part was his handshake. It was as if he was touching an iron hand heated to 3000 degrees. It was over before you even knew it. Leaves you kinda offended. Especially when he always took a wet wipe after that and wiped his hands. Am I really that gross?
But that's fiiiine. I mean we're all different and weird in our own ways, right? So he's a germophobe, so fucking what? We just gotta find a way to work together, right?
WRONG.
As soon as he started (and remember, he's a paid intern, who barely knows how to code, and has zero industrial experience), he started questioning my architecture solutions, code implementations, etc. I don't mind discussion and criticism, which is why I welcomed his input. But it seemed like he wasn't willing to accept any arguments, so I started looking for excuses not to talk to him.
Meanwhile, the most productive team member we had, to whom you could just give and describe an idea, with architecture and stuff, well, and you'd see it implemented the next week, with only the most well placed questions asked, started going into fights with this intern for the same reasons I was avoiding him.
.....
And here's the kicker.
Get this:
This intern comes to me (I was the team lead), while that guy is not in the office, and with a straight face, dead serious, starts telling me that that guy was making stupid decisions and being a bad team member because he doesn't ... I quote him almost verbatim... "follow my indications". He said that I had to do something because he refused to work with him together.
I was stunned.
This good for nothing imagined superhuman, who was completely useless and an amazing annoyance to pretty much everyone in the team, came to me, telling me that the most capable and productive developer in the team is bad, because he doesn't follow his orders, and that I had to pick between the 2.

I couldn't believe what I had heard.
I had so much emotion in me right then. I was angry, but at the same time I could barely abstain from laughing.
I just told him calmly that he was wrong, and that I wouldn't mind if he never came back. I didn't see him for 5 years after that.

Anyway, later that week our team went for a dinner + beer, and the stories from all the team members started pouring in. They didn't want to talk him down either, but now that he was gone, it was a weight off, and everybody could tell their story.

What a fucking asshole.

So 5 years after I stumbled on him as he was entering a church. Still an arrogant bitch. Barely exchanged 10 polite words and I continued on my way as he was disinfecting his hands from my filthy handshake.

Real fact: 1999

IT: IT, how can I help?
MrB: I'm Butcheek. This program is shit, I can't even log-in!
IT: oh.. Ok Mr. Butcheek, let’s see if I can help...
MrB: of course you can: fix this shitty program and made me log in!
IT: I’ll try to do my best to assist you, can you...
MrB: I just want to log in! Can you speak my language? This new program is ridiculous, I wonder why you IT guys changed the old one, it was a mess but at least I could log in...
IT: I'm sorry you are experiencing this problem, but to assist you I need to know exactly what's the problem
MrB: I CANT LOG IN!!!
IT: ok, I understand this, but can you please provide some more information? Do you receive any particular error messages?
MrB: it says “wrong password” but it's not true!
IT: Ok, that's strange. Look, I'm resetting your password and then you will try again. At the first log in you will be asked to change it again, ok?
MrB: just be quick, I can't waste any more time on this!
IT: sure... Ok done. Please, can you try again? The password is “butcheek”
MrB: it asks for the username. What am I supposed to write here?
IT: “butcheek”
MrB: oh... Ok. And what's the password?
IT: “butcheek”
MrB:... No... Wait... Ok, “butcheek” is the password but what's the username?
IT: “butcheek”!
MrB: you don't understand, I have to put both username AND password!
IT: I know! “butcheek”! For both username AND password!
MrB: so I have to write “butcheek”-”butcheek”?
IT: yes, “butcheek”-”butcheek”!
MrB: so... “butcheek”...twice? Sounds weird... are you sure?
IT: yes I'm sure! However, you can choose either to write “butcheek” twice or “ASS” once, if you prefer...

Recently been lurking more and apart from the new plagues the community is going through at the moment, I swear this app goes through literal anime arcs with random entities that rise up and cause problems, kinda hilarious in hindsight. I will say it's been nice seeing y'all's names and rants again. I know I also see everything in the discord but that's got a different vibe. It doesn't help I just fucking hate discord.

It's also been a weird experience looking at my old rants. I literally found this app as I was getting my start in development and it's crazy to see the progress and put everything into perspective. Holy shit was I CRINGE. Regardless pretty nice.

Another real-world argument for why I always say git is worth learning properly.

Had to track a really weird bug down today. Had no idea where it came from, how long it'd been in the code and hadn't the foggiest what was causing it. Realistically it could have been introduced any time in the last year or two, and that's tens of thousands of commits in this repo.

Git to the rescue. Knocked up a quick script to test the case in question, fed it into "git bisect run", and 30 seconds later git found the exact (small) commit that caused the issue.

It's a brilliant part of git, yet it seems like almost no-one I know uses it. Some use "git bisect", but using "git bisect run" and passing a script to it seems to be alien to most - yet it's probably my most used tool when it comes to tracking down bugs like these.

So here is my week 72 as a reviewer. But first, let me ask y'all. Am I weird to think that you should finish coding the thing and testing the thing before kicking it out to review? Cuz that's how I do it. And that is the process at my work place.

So anyway, I was doing this review. And it was very wrong. Like really, really wrong. We give a thorough intro to our product (perhaps too thorough) so this guy should have known every test case he had to cover. Or at least, if he was unsure, asked. It was all documented.

Anyway, he kicks out this peer review. First thing I notice, it is not following the standard. Fair enough, we didn't give him the coding standard. BUT HE DIDN'T EVEN MAINTAIN THE FORMAT OF THE ORIGINAL FILE. HE JUST DID HIS OWN THING!!! So I email him the coding standard and make a comment in the review. He denies the finding. No reason. Just turns it down. Strike 1.

Then, I'm going through and he didn't even cover all of the core cases. I found several core cases that he missed. And every edge case. Make a not of it. He fixes only the couple of examples I gave him. Strike 2.

Guy decided to redesign a major chunk of our interfaces. Our interfaces are not just used by us (hence interfaces). We designed them the way they were for a reason. It was not a fun design process. Myself, the architect, one of our customers, and the guy that did the implementation all told him to roll back his change. Especially since it wasn't in the scope of what he was doing. He wouldn't. Strike 3.

I go to the lead and bring him in. He has a talk with him. All of the sudden he is putting out multiple builds per finding. Like most times I will put out like 2 to 4 for the whole peer review. No he kicks out minimum one per finding and chokes the review queue. Strike 4.

Strike 5: he tells me, a former DBA, that I didn't know what I was talking about when I told him to move something into a new table, even after I told him that "while in database terms it doesn't make sense, this is for product robustness".

Strike 6: he was just a condescending asshole. Bragging about how he did this job and that job over his career. His longest position held was about 18 months. Bragged about working at my company and being some hotshot at the company: only worked here for 8 months and that was 5 years ago.

You know. I have never really wanted to fight someone after about undergrad. But he came close.

Who the fuck came up with the idea of using SharePoint? What it even is?! Is it a website, wiki, document repo...?

Our version seems to be a broken wiki with no info content, old links, illogical navigation. And somehow word documents are integrated into it. Sometimes you see some weird calendar and timelines (from old projects). You can navigate into a folder, but you cannot get back. There's no ".." button?? You can map it like OneDrive to yourself, but Windows doesn't support any document version control. Where's the check in/out option from explorer menu??? I sure as shit have those for SVN, GIT etc. Is there a new version created everytime I press ctrl-s or only when I close the document?

Well, I could open the document in "online" mode. Ok, the formatting goes weird and everything is super slow. But at least I can fuck up someone elses document by accidentaly copy/pasting stuff, deleting lines, hitting my face into keyboard etc. There's automatically new version added!

Somehow you can enable the forced check in/out for documents. Obviously only the library admin can do that. And since he's just a program manager, he has no clue what the fuck is version control or document management. So he has this thing on his "things to do" list. For him, document management means sending various spec versions as email attachments. And the developers can figure out together who has the most recent one.

How did M$ push shit piece of shit to corporations? They even use this crap for the intranet making it slower than creation of galaxies. Though it's ok, since you cannot find anything from the intranet. It's all just head honchos blogs, seasonal greetings and stock market statuses. Nowhere is seen the downstairs cafeteria menu for the day. Or where to report for broken toilet. You know, stuff that 99% of people would like to see.

I complained to M$ about the SharePoint, but apparently there's no problem. You can code it yourself? Yeiii! So, instead of just updating some line in design spec, I have to take a 3 month class and get a MS sertificate, code some class-based-web-shit for 6 months and maybe, maybe then I can make the page/document look normal?

I am thinking, that I will just start writing my specs on paper. I will put them on the shelf and if you want to read it, you will check it out manually. And if someone else tries to edit it while you are editing it, you just cover the paper with your hands. There might be a requirement to make the document look more like MS Word, but that's easy to do. Just go to WC with the paper and wipe with it a couple of times.

Chinese powerbanks are so fucking dangerous. Cheap price = cheap quality. Alright, I get it, but that's not my point.
Today my dad gave me his powerbank and wanted me to upgrade it.
A 50k mAh powerbank, but it is far away from 50k mAh. He bought 12 6000mAh rechargeable batteries.
Before I started replacing it and resoldering the powerbank, I decided to open up the Chinese 50k mAh battery. A lot of aluminum foils covering the batteries. That's not great. A very high chance for a short circuit to happen.
Anyways, I carefully took the aluminum cover halfway out.
I took a (plier?) with plastic handles and grabbed the pack of batteries with it to not put myself into danger.
And BOOM! A short circuit.

Btw. It smelled very weird when I took the aluminum cover off of the pack.

When defining a range, let's say from 1 to 3, I expect:

[1, 2, 3]

Yet most range functions I come across, e.g. lodash, will do:

_.range(1, 3)
=> [1, 2]

And their definition will say: "Creates an array of numbers ... progressing from start up to, but not including, end."

Yet why the fuck not including end? What don't I understand about the concept of a frigging range that you won't include the end?

The only thing I can come up with that's this is related to the array's-indexes-start with-0-thing and someone did not want to substract `-1` when preparing a for loop over an 10 items array with range(0,10), even though they do not want a range of 0 to 10, they want a range from 0 to 9. (And they should not use a for loop here to begin with but a foreach construct anyway.)

So the length of your array does not match the final index of your array.

Bohhoo.

Yet now we can have ranges with very weird steps, and now you always have to consider your proper maximum, leading to code like:

var start = 10;
var max = 50;
var step = 10;

_.range(start, max + step, step)
=> [10, 20, 30, 40, 50]

and during code review this would scream "bug!" in my face.

And it's not only lodash doing that, but also python and dart.

Except php. Php's range is inclusive. Good job php.

!dev

So, I've been talking to this girl for a couple weeks now, and she fucking makes me happy guys. I kinda mentioned her once or twice on here, but I didn't really want to say much cause I wasn't sure how stuff was gonna go with her.

But basically now, we're just "talking" if that makes any sense to any of the younger, more social audiences here. For those who may not get what I mean, it's like we're not really looking for anyone else, but we're not really official or anything. Just somewhere in between like friends and dating (she confirmed this for me cause I've made assumptions before and got hurt so I wanted everything to be crystal clear)

I actually met her because she has a class with one of my friends. I mentioned their class in my contribution to the weekly rant this week, where the graphic design class was doing some basic webdev. I skipped my anatomy class to go there one day, started talking to her (actually the day of my rant where I said I'd been up for like ~30 hours or however many it was. LIKE EVERYTHING I POST ENDS UP REFERENCED IN ANOTHER POST), and just kept skipping mainly to see her. Then my friend gave me her Discord and we started actually talking to each other.

Within like 2 hours of us first messaging we had one of those like cute couple arguments. It was over who had prettier eyes, cause I have blue eyes (that people usually say are beautiful, I posted a couple pictures here once), and she has really pretty green eyes. I said that hers looked better, but she said that mine do....She won the argument.

Since then, it's just been fun and cute and I fucking love it. SHE EVEN SAID A PICKUP LINE TO ME A FEW NIGHTS AGO THAT I JUST LOVED. It was "your eyes are more gorgeous than any source code I have ever seen". She found it online, but like at the time, that really touched me.

I'm just so excited about all this guys. She's adorable and I love talking to her. The one thing that's KINDA weird is that she has the same name as my younger sister, but we call my sister a shortened version of the name, so it's not THAT weird.

And I'm just rambling at this point, like I generally do with my rants. She actually knows my profile name and everything (but she isn't on here, she does art, not computers), so she could possibly see this, but I'll likely end up sending it to her at some point anyways.

I had security reopen our test-user last week. I could run the tests once, then they started failing with "blocked user due to too many attempts at logging in". Huh, that's weird. I go through everything, every script, every scheduled task, every nook and cranny of every drive on every machine I could reach, and make sure the password is updated everywhere. Reopen account. Same shit.

I email around to some people, they don't use it, one guy asks if I checked x, y and z, I did. Then he's sure we don't use it anywhere else.

It's one of our fucking contractors that took one of our scripts (that they're supposed to have duplicate copies of) and forgot to change to their own credentials. That's literally the agreement, take our scripts and change the user and run them on your machines.

Afhfjdkdhdjdbd stop locking me out of everything with your incompetence. I email them, some cunt gets back to me asking for the new password. NO. USE. YOUR. OWN. CREDENTIALS. I KNOW YOU HAVE THEM, THEY'RE HERE IN THE LIST AND BEING USED IN ALL OTHER SCRIPTS AAAAAAAAAHHH

Life is hard.

You are born. DNA gets determined. You go through infancy.

Puberty comes and DNA is like
"uh from now you'll pretty much have strong sexual urges, a huge desire to be sexually prolific, nothing weird like being pedo or into rape though".

me: Uh ok.
dna: oh, also, you're gonna be one of those late bloomers, you know, you talk like shit, you dress like shit, you smell like shit.
life: that's true and also you don't have anyone in your life to teach you about that shit, so forget about kissing, having sex, let alone being in a relationship for a long time.

*a lot of years go by with a lot of missed opportunities, mistakes and regrets*

life: ok, you seem to have become a decent sex partner out of a lot of scarring experiences, but there's one problem: you've fallen in love with somebody.

and you're married

and you have kids

me: well, does that mean I can't fuck other people?
life: yeah, no. I'm surprised I even have to explain that, it's called cheating. It will pretty much ruin your marriage, and fuck up your kids.

me: ok, I guess no then. I'm still fortunate enough to have sex with my wife right?

life: yeah... but you still want to fuck other people
me: what???
life: yeah, did you think that falling in love would make you not want to fuck other people? fuck no

me: ok, well I'm very grateful that I get to experience sex at all.
life: yes... there's a thing though, your partner has a much much lower libido than you.

me: ok, well maybe if I exercise and dress better that might change
life: that will definitely help, you'll feel more confident and have more stamina, but every time you retry exercising, you remember how much you hate it and how little stamina you have.
oh, I'm sorry, I forgot you had kids and work, yeah no time or energy for that.

me: ok, then should I just embrace a more liberal lifestyle, like becoming a swinger?
life: ha, fat chance, it's a very taboo thing and you're not that liberal, neither is she.

me: uhhh, i guess i can sometimes watch porn then...
life: watching porn regularly will make the only sex that you have worse, according to statistics.

me: ok, I guess I should get ripped

Managed to make myself look like a fucking moron again today...

Can't mount NFS share, get "permission denied". Huh, that's weird... It's correctly exported.

Well it's correctly exported and rpcinfo -p $HOST times out... Must be firewall rule.

Firewall rule is changed but still no joy "permission denied"... Fuck sake networks, can't you do anything right first time?!!!

Firewall rule is correct I am reliably informed... Go about proving that it's not fucking correct and provide "evidence" to show this, I was a little bit more blunt than was strictly required.

Networks say they will take another look.

I turn NFS logging to verbose for my own interest and notice the line "path/to/directory is not a valid directory".

I, as a moron, had missed a "/" at the start of the path. That's why I still couldn't mount after the firewall change.

Go over and apologise in person and explain how I'm a total idiot.

"four million dollars"

TL;DR. Seriously, It's way too long.

That's all the management really cares about, apparently.

It all started when there were heated, war faced discussions with a major client this weekend (coonts, I tell ye) and it was decided that a stupid, out of context customisation POC had that was hacked together by the "customisation and delivery " (they know to do neither) team needed to be merged with the product (a hot, lumpy cluster fuck, made in a technology so old that even the great creators (namely Goo-fucking-gle) decided that it was their worst mistake ever and stopped supporting it (or even considering its existence at this point)).

Today morning, I my manager calls me and announces that I'm the lucky fuck who gets to do this shit.

Now being the defacto got admin to our team (after the last lead left, I was the only one with adequate experience), I suggested to my manager "boss, here's a light bulb. Why don't we just create a new branch for the fuckers and ask them to merge their shite with our shite and then all we'll have to do it build the mixed up shite to create an even smellier pile of shite and feed it to the customer".

"I agree with you mahaDev (when haven't you said that, coont), but the thing is <insert random manger talk here> so we're the ones who'll have to do it (again, when haven't you said that, coont)"

I said fine. Send me the details. He forwarded me a mail, which contained context not amounting to half a syllable of the word "context". I pinged the guy who developed the hack. He gave me nothing but a link to his code repo. I said give me details. He simply said "I've sent the repo details, what else do you require?"

1st motherfucker.

Dafuq? Dude, gimme some spice. Dafuq you done? Dafuq libraries you used? Dafuq APIs you used? Where Dafuq did you get this old ass checkout on which you've made these changes? AND DAFUQ IS THIS TOOL SUPPOSED TO DO AND HOW DOES IT AFFECT MY PRODUCT?

Anyway, since I didn't get a lot of info, I set about trying to just merge the code blindly and fix all conflicts, assuming that no new libraries/APIs have been used and the code is compatible with our master code base.

Enter delivery head. 2nd motherfucker.

This coont neither has technical knowledge nor the common sense to ask someone who knows his shit to help out with the technical stuff.

I find out that this was the half assed moron who agreed to a 3 day timeline (and our build takes around 13 hours to complete, end to end). Because fuck testing. They validated the their tool, we've tested our product. There's no way it can fail when we make a hybrid cocktail that will make the elephants foot look like a frikkin mojito!

Anywho, he comes by every half-mother fucking-hour and asks whether the build has been triggered.

Bitch. I have no clue what is going on and your people apparently don't have the time to give a fuck. How in the world do you expect me to finish this in 5 minutes?

Anyway, after I compile for the first time after merging, I see enough compilations to last a frikkin life time. I kid you not, I scrolled for a complete minute before reaching the last one.

Again, my assumption was that there are no library or dependency changes, neither did I know the fact that the dude implemented using completely different libraries altogether in some places.

Now I know it's my fault for not checking myself, but I was already having a bad day.

I then proceeded to have a little tantrum. In the middle of the floor, because I DIDN'T HAVE A CLUE WHAT CHANGES WERE MADE AND NOBODY CARED ENOUGH TO GIVE A FUCKING FUCK ABOUT THE DAMN FUCK.

Lo and behold, everyone's at my service now. I get all things clarified, takes around an hour and a half of my time (could have been done in 20 minutes had someone given me the complete info) to find out all I need to know and proceed to remove all compilation problems.

Hurrah. In my frustration, I forgot to push some changes, and because of some weird shit in our build framework, the build failed in Jenkins. Multiple times. Even though the exact same code was working on my local setup (cliche, I know).

In any case, it was sometime during sorting out this mess did I come to know that the reason why the 2nd motherfucker accepted the 3 day deadline was because the total bill being slapped to the customer is four fucking million USD.

Greed. Wow. The fucker just sacrificed everyone's day and night (his team and the next) for 4mil. And my manager and director agreed. Four fucking million dollars. I don't get to see a penny of it, I work for peanut shells, for 15 hours, you'll get bonuses and commissions, the fucking junior Dev earns more than me, but my manager says I'm the MVP of the team, all I get is a thanks and a bad rating for this hike cycle.

4mil usd, I learnt today, is enough to make you lick the smelly, hairy balls of a Neanderthal even though the money isn't truly yours.

That's it. I've had enough.

I lost my job yesterday (again) and the Irish cumstain who lives in the room next to me got pissed last night and kicked my door in because he thought I had his phone(?) and was ignoring him, when I was at work.

Long story short, he ripped my friends back door apart, tried to fight me (which ended with me chasing him down the street with a plank).

Police came and did a wonderful job as always by making us shake hands and 'promise' to leave each other alone.

THIS ISN'T FUCKING PRIMARY SCHOOL. DRAG HIM AWAY BEFORE I DO, YOU IGNORANT FUCKING PIGS.

Oh, and my 'friend' then had a schizophrenic episode and blamed it all on me(?!?). I then went to buy 2 bottles of vodka and decided to get pissed before trying to kill myself.

Ah, I love humans. Dirty, ignorant, blood sucking bags of sweaty meat and delicate bone. I really want to turn this Irish cunt into a skinsack of blood and guts, but I'm waiting patiently. He's going to wake up one night tied up and gagged, with me dragging him to a forest somewhere far far away...

Is it weird that I want to make him scream, cry, and shit himself at the same time?

No crazy prep, ever.

I always go in with a 'this is me, these are my skills, that's all you're going to get' mindset.

I of course do some research (about the company, their culture, technologies and stuff like that) but I find it kinda weird to spend a big amount of time on interview prep when there is a chance of rejection. (personal opinion)

how often does it happen that you have to prevent terrible architectural decisions from being made, because people who are in charge but obviously have no clue, make really weird suggestions and are really confident that this is a good idea?

PM: so please analyze functionalities X with dev Y, since module Y that dev Y develops shall provide these functionalities.
me: as i said yesterday, module Y will use my module X and shouldn't care about how this is going to be implemented.
PM: yeah, but module Y shall be able to... (lists some functionalities)
me: yes, that's what i'm currently working on in module X. my current state of the API can be used in a way that... (lists different low level functions and how a combination of them can be used to provide these functionalities)
PM: okay, hmm... i just realize that module Y will actually be a user of module X...

well.... yeah?!!
i always thought that was crystal clear?? 🤦‍♀️

In my unenlightened youth, when programming was a module in my college diploma that didn't seem to be taking me where I wanted to go, I had a couple of guys guy in my class that could arguably be the weird ones.

Jonny, although he asserted that he was to be called "Jonhty", whatever, we never did. He was pretty much top of the high school food chain and for some reason elected to study computer science, none of us was prepared to put up with his shit. He was always boasting about some fanciful claim or another, famously entering the classroom and exclaiming he'd "fucked an absolute milf" and seemed somewhat evasive about the answer, turns out he was 17 and she was 35, the age difference was greater than his own age. We burst out laughing. He would also turn up late and state the college bus was late (it wasn't I got the free bus every day, he'd just not got out his wanking chariot early enough).

One valentine's day we got him a card from a mysterious stranger which was accompanied by a package containing a cucumber and Vaseline, the inside of the card read "to assist you in the following request: please go fuck yourself".

Before you think we were being unduly harsh, we had a centre table where we'd be taught from with computers around the outer rim of the room. He'd come up behind people while at the centre desk, quietly press ctrl+P and slowly walk back to the printer. I saw him do it to my machine and I got to the printer first, to which he shouted "that's MY work" which was amusing because unbeknownst to him I had put headers on all my documents so he really didn't have an answer for why my name was at the top of every page.

To top it all off he had dead eyes, there didn't appear to be much going on but the rent, there was no spark of intelligent life, and while I thought it, I never said it out loud, but other students did and I had to agree. He was just copying his way to graduation. However, he ultimately didn't graduate when people refused to allow him to copy.

Another guy, Richard I believe his name was, which is just as well because he was a right dick. In the UK our word for white trash is "chav" (that's a very naïve explanation for it but that's another rant best left for "socialsciencerant") and he was an complete idiot who was gifted with more brain cells than he ever needed to use. He actually studied hard and got reasonable grades, probably on par with me, but he boasted about smoking weed all the time, he was forever playing dark side of the moon via his loud mp3 player. I kinda left him alone generally until he was high in class one time and while we we're watching a documentary he'd shake my chair and make a weird noise in my ear every few minutes, the first couple of times startled me, the remaining multi-dozen times pissed me off.

It all came to a head with this guy when I'd been hearing about his uninteresting bs on drugs, music and how best to spend my time ("you need to lighten up man, come round my house, take a joint and relax man", that sorta thing), well this guy walked like he was mid way through shitting himself so I personally think that perhaps he is too chilled. Anyway he's arguing with me and after the exchange of him making his point, me disagreeing and expecting the end of it, he made the mistake of saying two words to me:

"Listen, mate..."

And I had him in check mate.

"Listen, I ain't your fucking mate , I don't even like you, you're a disruptive annoying twat that thinks he knows it all, we're all 17, none of us know anything, so shut the fuck up, sit the fuck down and stop boring me with your drugs, I ain't interested, and for the record I think pink Floyd ruined prog rock!"

He looked at me with sad puppy dog eyes, and started with the "but, why?", However I was interrupted and had to leave the class for unrelated reasons, I returned to be told he'd put safety pins up right on my chair so I'd sit on them, and mutual friends who TD me I'd been cruel and that he doesn't was hurt, so I should apologize, he overheard and said he was sorry for bring a bit of a dick.

However, you just know when you don't get on with someone? Yeah, that. So I said I wasn't sorry for what I said, for while it was harsh, I am not his mate, nor did I want to be his mate and that was all I had to say on the subject, and that if he wants to take offensive to a nobody not liking him then he's in for a very rough time in life.

Unsurprisingly I don't keep in touch with anyone from college!

When I launch my startup, I'm gonna insert all kinds of very stupid and weird error messages in place of the actual errors just so the people can have a chuckle instead of being annoyed
maybe someone's gonna post it on reddit or something, I don't mind, that's actually a good thing

Today on forgotten movies – Chronicle.

A very grim, very dark movie about accidental superpowers discovery, but with some school-shooter vibes.

Don't you find it predictable how in regular movies a hero saves the world against all odds in the very last moment? Well, forget about it here – this movie is not "cinematic" at all, and that's what I like about it.

A horror in regular movies doesn't usually scare because the image itself is too perfect – you don't usually see the world like this. It doesn't seem real, that's the problem. By adopting the "found footage" screen language, Chronicle delivers the horror perfectly, because the world in it seems perfectly real, just like you see it through obscure youtube videos named MOV_0115 or IMG1014.

I like it that the characters actually look like real people, not like stereotypical superheroes and not even like enhanced versions of people that try to sell you an idea of what "success" looks like.

People in the movie also act real. They're weak, they're scared, they're irrational, and you really start to believe that yeah, this is what probably gonna happen when a human faces something as unbearable as superpowers discovery. And, as weird as it sounds, the superpower itself also looks totally real – raw, unpolished, uncontrollable force that requires getting used to and probably is too much for a regular human. Definitely not a perfect, tailored thing that turns anyone into Mary Sue.

Overall, this movie is the most immersive one I've ever seen. If you want to see what would really happen if you discover a superpower, this movie is for you.

Swear to god, I'm worse than a cat.. my fascination & curiosity will get me killed someday.. o.O

12:19 - Magnitude 6,4 earthquake 3 km from Petrinja, Croatia..

Felt it in Ljubljana..and my stupid ass was fascinated.. :/

Yup, you read it right, not scared or whatever the hell should people feel when earthquake happens..just fascinated..and curios...and in full analysis mode..

Oh tremors?! Yup, something's definitely shaking.. Eartquake? Yup, earthquake! Woow, huge earthquake.. Where is epicenter?! Also long one.. nice, never felt it like this before.. hm.. x, should we go out? How?! I know an elevator is a no go, stairs also do not look promising..better stay in I guess.. hm..still going...feels weird.. Ok, look for shelter I guess.. wow..that's a long one.. ok, doorways should be safe-ish?! Where's x? He went silent..go check up on x.. x is fine, he's not stupid like me, and unlike me also has preservation instinct to not stand under the doorway that has glass components in it.. DumbAss.. Shaking stops... Well that was weird..also I didn't have time to analyze everything..or record it! Stoopid! How did I not think of this before?! Recording would be awesome!! shame..

I know panic doesn't help anyone, but FFS, sometimes I do wish my head would panic at least for a second instead of trying to analyze everything..

I mean, WTF is wrong with me?! Most people would be scared, I just estimated that it's not that dangerous for us and no use/not smart to try to go out of the building so I just took shelter (not a good one, I know now for next time?! o.O what next time?!idiot!!) and started observing.. DumbAss.. :/

When your home's infrastructure runs better and is more stable than some of the shit that's actually running enterprises because you actually do care about industry best practices and product quality.. it's a weird feeling. A very disappointing one, if anything.

Post-meritocracy, it very much seems to be a thing. And when you call people out for it because yes I do want to *be* the change that I want to see, they get all defensive and shun you. Yeah, let's make the world burn in inefficient, dysfunctional bullshit. That's a much better idea.

Are we humans really that far apart from the chimps that we descended from?

Worst part of it all, those incompetent bastards that can't possibly admit and work to improve their mistakes are the ones that are behind the companies' steering wheel. That too is such an excellent idea. I bet that half of them got employed only because they took the lowest wage and could (barely) turn on a computer. Fucking morons...

I don't know if I'm being pranked or not, but I work with my boss and he has the strangest way of doing things.
- Only use PHP
- Keep error_reporting off (for development), Site cannot function if they are on.
- 20,000 lines of functions in a single file, 50% of which was unused, mostly repeated code that could have been reduced massively.
- Zero Code Comments
- Inconsistent variable names, function names, file names -- I was literally project searching for months to find things.
- There is nothing close to a normalized SQL Database, column ID names can't even stay consistent.
- Every query is done with a mysqli wrapper to use legacy mysql functions.
- Most used function is to escape stirngs
- Type-hinting is too strict for the code.
- Most files packed with Inline CSS, JavaScript and PHP - we don't want to use an external file otherwise we'd have to open two of them.
- Do not use a package manger composer because he doesn't have it installed.. Though I told him it's easy on any platform and I'll explain it.
- He downloads a few composer packages he likes and drag/drop them into random folder.
- Uses $_GET to set values and pass them around like a message contianer.
- One file is 6000 lines which is a giant if statement with somewhere close to 7 levels deep of recursion.
- Never removes his old code that bloats things.
- Has functions from a decade ago he would like to save to use some day. Just regular, plain old, PHP functions.
- Always wants to build things from scratch, and re-using a lot of his code that is honestly a weird way of doing almost everything.
- Using CodeIntel, Mess Detectors, Error Detectors is not good or useful.
- Would not deploy to production through any tool I setup, though I was told to. Instead he wrote bash scripts that still make me nervous.
- Often tells me to make something modern/great (reinventing a wheel) and then ends up saying, "I think I'd do it this way... Referes to his code 5 years ago".
- Using isset() breaks things.
- Tens of thousands of undefined variables exist because arrays are creates like $this[][][] = 5;
- Understanding the naming of functions required me to write several documents.
- I had to use #region tags to find places in the code quicker since a router was about 2000 lines of if else statements.
- I used Todo Bookmark extensions in VSCode to mark and flag everything that's a bug.
- Gets upset if I add anything to .gitignore; I tried to tell him it ignores files we don't want, he is though it deleted them for a while.
- He would rather explain every line of code in a mammoth project that follows no human known patterns, includes files that overwrite global scope variables and wants has me do the documentation.
- Open to ideas but when I bring them up such as - This is what most standards suggest, here's a literal example of exactly what you want but easier - He will passively decide against it and end up working on tedious things not very necessary for project release dates.
- On another project I try to write code but he wants to go over every single nook and cranny and stay on the phone the entire day as I watch his screen and Im trying to code.

I would like us all to do well but I do not consider him a programmer but a script-whippersnapper. I find myself trying to to debate the most basic of things (you shouldnt 777 every file), and I need all kinds of evidence before he will do something about it. We need "security" and all kinds of buzz words but I'm scared to death of this code. After several months its a nice place to work but I am convinced I'm being pranked or my boss has very little idea what he's doing. I've worked in a lot of disasters but nothing like this.

We are building an API, I could use something open source to help with anything from validations, routing, ACL but he ends up reinventing the wheel. I have never worked so slow, hindered and baffled at how I am supposed to build anything - nothing is stable, tested, and rarely logical. I suggested many things but he would rather have small talk and reason his way into using things he made.

I could fhave this project 50% done i a Node API i two weeks, pretty fast in a PHP or Python one, but we for reasons I have no idea would rather go slow and literally "build a framework". Two knuckleheads are going to build a PHP REST framework and compete with tested, tried and true open source tools by tens of millions?

I just wanted to rant because this drives me crazy. I have so much stress my neck and shoulder seems like a nerve is pinched. I don't understand what any of this means. I've never met someone who was wrong about so many things but believed they were right. I just don't know what to say so often on call I just say, 'uhh..'. It's like nothing anyone or any authority says matters, I don't know why he asks anything he's going to do things one way, a hard way, only that he can decipher. He's an owner, he's not worried about job security.

Ohh man i fucked up bad. 5 days as intern, and i fuck up really bad with my ego and ignorance.

I love my this company. A great environment, lots of people to learn from , i am given reasonable tasks and i feel happy to complete them. But what happened today was weird and fucked up.

I have never worked at a place with seniors designers tech leads and more people with positions. I have also worked with a lot of competitive people who are always in a race to be first.
And how do we come first? Have a lot of knowledge, hear the smallest of detail and sprint towards goal (because the combination your knowledge, assumptions and speed is enough to make you reach to the top). You don't ask for specific details, because they are obvious. And that's me in short.

Today i fucked up.
Mistake #1 ) first i was given a small task by my senior. It was a 20 mins task max if i had done it the normal noobie way . But i am a pro in mind , i have to do it with all the architecture , even if i don't understand why. So i asked for 50 mins. They gave it and did not had a problem with my time, but with the way i wrote my code.

He was like "who told you to make it like this ? Why did you made it like this?" And was visibly irritated. And i was like super chill saying "i don't know the why, but i know its correct way of using it" , pissing him even more. In my eyes he's just a super friendly sr, more like a bro and wouldn't mind some cheeky answers. And he didnt show any
consequences for that time.

Mistake #2 this is super fucked up. Our office is going under some renovation & interns were asked to sit in the co-working spaces (outside of the office). It was already very disturbing and i had to go to office every few minutes.

So after lunch this happens : We are working on a new module that already has a tonne of screens and logics. I have made a small part which is from the middle and now we can go both in the forward or in the backward direction.(Also, its quite a new module whose idea was recently discussed and decided. And weirdly i am also being treated like a core member as the ceo once himself asked what would he my flow for doing things in this. i am in direct contact and under direction of backend , designers , ceo and My senior and many ppl are giving me tasks ) And... Aagh fuck it. .. its a long story and i don't feel like repeating it but

inshort :

got a task,

didn't understood it completely and thought its my task to figure it out, took a long time figuring it my self ,

techlead/designer somehow changed my and my sr. direction of flow even tho we were taking a different approach

I sit in a noisy and irritating place

Techlead/designer comes during the time when i am figuring out the solution(already overtime the one in point #2) nags for result.

I get in an argument with him, justifying for my time and arguing that it's difficult to think technical logics for that design
( truth be told, it WAS a difficult logic which he thought was too easy. It consisted of 3 variables and 8 states we were doing different works for 4 of them and rejecting 2 and ... I don't know, i had got that wrong . But that shouldn't had been my problem to solve. I should have gone to my senior and didn't get into argument with tech lead ). It think i might have offended him too.

After he left, i am so angry on him that after sometime my senior comes and i misbehave with him. He just asks to meet me before i go, and i do so. During the meeting we discuss this whole fuck up and how many times i showed him my ego and indiscipline. And then i realise what a fuckup i did due to my ego and lack of asking, blindly following my own over confidence and blindly following or arguing with others.

Fuck fuck fuck

Today on "How the Fuck is Python a Real Language?": Lambda functions and other dumb Python syntax.

Lambda functions are generally passed as callbacks, e.g. "myFunc(a, b, lambda c, d: c + d)". Note that the comma between c and d is somehow on a completely different level than the comma between a and b, even though they're both within the same brackets, because instead of using something like, say, universally agreed-upon grouping symbols to visually group the lambda function arguments together, Python groups them using a reserved keyword on one end, and two little dots on the other end. Like yeah, that's easy to notice among 10 other variable and argument names. But Python couldn't really do any better, because "myFunc(a, b, (c, d): c + d)" would be even less readable and prone to typos given how fucked up Python's use of brackets already is.

And while I'm on the topic of dumb Python syntax, let's look at the switch, um, match statements. For a long time, people behind Python argued that a bunch of elif statements with the same fucking conditions (e.g. x == 1, x == 2, x == 3, ...) are more readable than a standard switch statement, but then in Python 3.10 (released only 1 year ago), they finally came to their senses and added match and case keywords to implement pattern matching. Except they managed to fuck up yet again; instead of a normal "default:" statement, the default statement is denoted by "case _:". Because somehow, everywhere else in the code _ behaves as a normal variable name, but in match statement it instead means "ignore the value in this place". For example, "match myVar:" and "case [first, *rest]:" will behave exactly like "[first, *rest] = myVar" as long as myVar is a list with one or more elements, but "case [_, *rest]:" won't assign the first element from the list to anything, even though "[_, *rest] = myVar" will assign it to _. Because fuck consistency, that's why.

And why the fuck is there no fallthrough? Wouldn't it make perfect sense to write

case ('rgb', r, g, b):
case ('argb', _, r, g, b):
case ('rgba', r, g, b, _):
case ('bgr', b, g, r):
case ('abgr', _, b, g, r):
case ('bgra', b, g, r, _):

and then, you know, handle r, g, and b values in the same fucking block of code? Pretty sure that would be more readable than having to write "handeRGB(r, g, b)" 6 fucking times depending on the input format. Oh, and never mind that Python already has a "break" keyword.

Speaking of the "break" keyword, if you try to use it outside of a loop, you get an error "'break' outside loop". However, there's also the "continue" keyword, and if you try to use it outside of a loop, you get an error "'continue' not properly in loop". Why the fuck are there two completely different error messages for that? Does it mean there exists some weird improper syntax to use "continue" inside of a loop? Or is it just another inconsistent Python bullshit where until Python 3.8 you couldn't use "continue" inside the "finally:" block (but you could always use "break", even though it does essentially the same thing, just branching to a different point).

I don't get all the amazement etc people show when they find out that I don't use services like WhatsApp, Instagram, Gmail, Outlook, Google etc, why would it be 'weird' to want control over who has/owns your data? That's not being fucking paranoid, that's being conscious about who you give your data to.

I'm out of my mind bored. I'm an unemployed person with a great job. You'd think this would be awesome. It's torture.

I work for a consulting company. I get paid whether or not they have work for me. They haven't for several months. I'm not hearing anything. I don't know when it will change.

I'm a skilled developer in a few very popular languages - nothing remotely in the ballpark of old or obsolete. I hear that's in demand. I spend most of my time answering questions on Stack Overflow. I really like to help people, but it boggles my mind that the people struggling with the stuff I help them with all have actual work to do and I don't.

I like to learn about new stuff, but I'm just not interested in learning another framework or anything else to add to the giant pile of stuff I'm already not using. It's not fun anymore.

I don't want to do another side project, either. I have a job as a software developer. That should, at some point, involve developing some software.

This is sucking the life out of me. It's harder and harder to get out of bed and come to work. I've held off looking for another job because I'm hoping this will change. The people here are great. I could go somewhere else and it could suck for completely different reasons.

Ironically, this is close to the reason why I left my last job. Ten years ago I went through a spell where I just gave up and stopped coming to work for over a month. No one noticed. Other people were stressed about getting laid off. Some of them were. Not me.

Am I part of some weird experiment to see how insane someone can go in this totally screwed-up circumstance? Are people following me around with cameras?

I'd love to find something else, but by all outward appearances I had already found an awesome place to work. There's only one thing missing - the work.

Thanks for listening. I'm just going to put my head on my desk for a while and despair. What is wrong with this industry? We're a mess on so many levels.

Boss: so, problem x happened
Coworker 1: huh weird, what database is being used?
Boss: *adds Coworker 2 to the call*
Boss: so, problem x happened
Coworker 2: oh 😳 i forgot to tell everyone i changed the names of the tables and everything is now here
Me, just listening: 🤦‍♀️

Dude... he's nice, but c'mon, that's a dick move

Worst thing you've seen another dev do? Here is another.

Early into our eCommerce venture, we experienced the normal growing pains.

Part of the learning process was realizing in web development, you should only access data resources on an as-needed basis.

One business object on it's creation would populate db lookups, initialize business rule engines (calling the db), etc.

Initially, this design was fine, no one noticed anything until business started to grow and started to cause problems in other systems (classic scaling problems)

VP wanted a review of the code and recommendations before throwing hardware at the problem (which they already started to do).

Over a month, I started making some aggressive changes by streamlining SQL, moving initialization, and refactoring like a mad man.

Over all page loads were not really affected, but the back-end resources were almost back to pre-eCommerce levels.

The main web developer at the time was not amused and fought my changes as much as she could.

Couple months later the CEO was speaking to everyone about his experience at a trade show when another CEO was complementing him on the changes to our web site.
The site was must faster, pages loaded without any glitches, checkout actually worked the first time, etc.
CEO wanted to thank everyone involved etc..and so on.

About a week later the VP handed out 'Thank You' certificates for the entire web team (only 4 at the time, I was on another team). I was noticeably excluded (not that I cared about a stupid piece of paper, but they also got a pizza lunch...I was much more pissed about that). My boss went to find out what was going on.

MyBoss: "Well, turned out 'Sally' did make all the web site performance improvements."
Me: "Where have you been the past 3 months? 'Sally' is the one who fought all my improvements. All my improvements are still in the production code."
MyBoss: "I'm just the messenger. What would you like me to do? I can buy you a pizza if you want. The team already reviewed the code and they are the ones who gave her the credit."
Me: "That's crap. My comments are all over that code base. I put my initials, date, what I did, why, and what was improved. I put the actual performance improvement numbers in the code!"
MyBoss: "Yea? Weird. That is what 'Tom' said why 'Sally' was put in for a promotion. For her due diligence for documenting the improvements."
Me:"What!? No. Look...lets look at the code"

Open up the file...there it was...*her* initials...the date, what changed, performance improvement numbers, etc.

WTF!

I opened version control and saw that she made one change, the day *after* the CEO thanked everyone and replaced my initials with hers.

She knew the other devs would only look at the current code to see who made the improvements (not bother to look at the code-differences)

MyBoss: "Wow...that's dirty. Best to move on and forget about it. Let them have their little party. Let us grown ups keeping doing the important things."

Most upsetting interview rejection?

Back when I graduated college, I did the usual rounds of interviews with insurance companies, banks, various other institutional businesses set up by the college's career center.

One local insurance company interview I thought went great. Usual 'Where do you see yourself in 5 years?' type questions, told her about my job history, very high level type stuff.

Couple of weeks later I get a letter in the mail and after the usual 'It was great to meet you blah blah blah', it ended with
'State Farm will never consider you for a position with our company.'

Never?! My then fiance (now wife) yelled "WHAT DID YOU DO?!!!" and I racked my brain for anything I might have said or done. The HR lady was attractive, but I didn't stare at any body parts and I didn't make any weird sexual advances (I was nervous enough without *that* going thru my mind).
The college career center floods the local companies with graduates and I was #5 in the waiting room that day. My only guess was they got me confused with someone else.

My fiance wanted me to call them immediately to straighten out any misunderstanding, but I knew what was done, was done. It's not like they would realize "Oh, that's right, it was Bob that kept looking at Karen's breasts, not you...come work for us!" Besides, why would I want to work someplace that didn't know/care who I was?

Yeah. Kinda late to the WK 227 party.

Thing is: I've read a lot of rants and honestly, some of the rants were ... touchy.

Like that weird emotional thingy you don't like but that just kind of happens cause I'm human too.... And have that shitty emotional feature integrated, which feels most of the time like a heisenbug.

Me and my parents. Specifically mom. Are like ... Matter and antimatter.

You don't want them in a room. Bad things happen TM. My mom is responsible for ... Let's say severe psychological trauma starting with age 4 to age 17.

In 17 I moved out and lived on "my own" (truth: on heavy support, cause I wasn't what you'd called "psychologically stable" at that time).

I fucked up university and - as shared before - thanks to an math teacher who made my life an even more living hell and my parents, I'd started in IT mostly out of "resisting" certain assertations being made over my life.

The support I got from my family can be put together in one sentence:
"I survived, I tolerated - but will never forgive".

Thing is: Be it IT support or anything else. If your gut feeling tells you that family / coworkers / friends are not good for you.

Stay the fuck away from them till you've sorted yourself out.

I can tolerate my parents nowadays. Took > 10 years and a lot of hardships to "achieve" that.

It's not peachy. It's not loving. It's tolerance. (Yeah. That bit is muey importante to me).

The thing is: I cannot deny the fact that my parents tried to support me by money. That's what they still do _nowadays_ even though my income is like 60 % of the income my father and mother has combined... It's a bothersome detail.

There's a certain thing in this rant that I would like "to pass on": Emotional support matters.

When you let someone feel like an empty shell, you cannot fix it with money.

It will - severely - destroy the person.

TLDR: We all have rough edges, can be hard to deal with and be a pain in the arse, but all of us need emotional support sometimes. That's what matters the most. ;)

I dropped my kid off at preschool and went my way home.

She's 2 so I transport her on a stroller.

While coming back, I came across an old lady sweeping the sidewalk of her house, and it got narrow to pass through because there was a tree next to her.

I carefully slowed down as to not collide with her, and while going through, we noticed each other.

I did a tiny smile as a way of saying "hi" like I usually do to people on the street.

To which she gave back the most innocent and sweet smile I've ever seen a stranger give on the street.

I could honestly feel my heart crack as it happened.

I guess the stroller must have caused her sympathy thus that reaction.

(which is why I like going around with the stroller, because people tend to treat you nicely which feels nice, like butterflies)

I know it might seem like an ordinary story without a punchline, but let me explain that I walk this city everyday.

And even though the people here is very nice compared to other cities I've lived in, it is very rare to get smiled at with such joy.

You might still think that is not a good story. But I can explain its relevance.

As some of you know, I post triggering content on this account, closeted parts of me that I normally hide,

Such as sexual stuff, some people think I'm a degenerate but I like to think I just have normal sexual thoughts that don't affect others in real life AT ALL.

And I'm also very argumentative, again, some people might see it as troll behaviour. On my side though, I just don't like bullshit and call it out when I see it.

But with this post, I'm not trying to be more likable or negate all the weird shit I said. This post is just another closeted part of me, being emotional.

And the reason I hide that is because it is not generally well accepted when a man is sensitive, at least where I'm from.

For example, if a female friend at work had a nice haircut, sometimes I feel the urge to be like "omg girl you look so prettyyyy!!!!".

But if I did that I know what will happen based on DIRECT experience: people will assume I'm gay or weak, and will make fun of that.
Or the actual friend will think I'm hitting on her.

No, fucking thank you, not having that shit.

But even if people accepted that, they just can't conceive I'm also very direct and honest, so when they do get to know me better, they get shocked.

So what do I do? I just hide that. That might change in the future, but I don't have the energy right now to deal with some people's simplemindedness.

I'm not making any sort of political statement, like "people should be treat me correctly or else get fired because of offending my gender".

But I'm not gonna lie, it would feel very nice if I was around more progressive people. I wished I had just just standard male behaviour and thoughts.

I guess some people in progressive cities are more accepting of the whole gender fluid thing, so I wished I lived in one (let me clarify though, I'm not a mindless gender fanatic).

I'm also not perfect and sometimes the line between "I love your haircut" and "I'm into you" blurs the fuck out, so that's on me... I don't know if it's something I can change though...

Hopefully all this shit I'm saying doesn't make me look like a lunatic. Veeeery hopefully.

Though, If you think for real I'm a lunatic or bad person, you can suck donkey dick.

This is my first post. I felt like if I'm wrote this I'll just be a big fat crybaby, but i need to release this pressure from me.

I've been pretty burnt out past 6 month.

So a little bit backstory here, I've come from broken family, and currently on my 7th semester of college. But I've been part of small startup as mobile apps developer for a year and a half now.

6 month ago, it just a year of recovery from a toxic relationship that basically ruins my college life. I have really bad GPA (bad score for being absent from classes), basically no friends, and a barely passable (or even bad) skill in Android Dev. Then I got new girlfriend that really supportive for me. But after 2 months, her parents ask me if I would marry her or not. because if not, I have to broke up with her (We're in Indonesia and both of us is Muslim, so outside marriage relationship is kinda in "grey area" depend on who you ask). So I have to choose to marry her or not, and I choose the marriage. I think I have enough saving and just enough income to support both of us.

Then it's been a downward spiral from there.

The startup that I've been working on were in a pretty bad shape. I've been underpaid since the beginning (and that's not really a problem for me at that time, that's my choice and I blame no one) but abysmal growth and some miss management force us to scale back and makes me basically in a non-paying jobs.

So I take college break for a semester and been trying to find projects here and there for marriage savings, but because the weak employee protection here, lots of the projects I have completed have yet to pay the fee (even until today). And even if they paid me, most of it were really low paying jobs (we're talking $200 per 3 weeks project here, to be fair, for our average GDP, it's not bottom-low).

And the deadline is approaching, our marriage date is settled in (very) early January 2019, and i've been in this "not yet graduated but needs job" limbo. Most of employer here still has the old "Degree Based" Job specs, and not "Skill Based" one. so because de-jure I've still a "College Student" no Job listing is willing to take me in. I've apply to almost 30 Job Listing and just get interview once, and still failed because I can't move to the company area, too far and have too expensive living cost vs the salary ($300 living cost vs $450 salary, while i need to give money to my girlfriend back home for a living).

So I switch my direction to Competitions with Extra Job offering as a Bonus, and I've been pretty close to winning one, held by CIMB Bank, but still failed. It's little bit better now because CIMB came interested with me but there is red flag which I need to graduate with decent GPA before July 2019, and in current GPA? it's practically impossible.

Can it getting worse? oh it can. Remember I come from broken home family? it's inherently hard to keeps communication with both of my parents that to this day still despise each other. And while my mother is still supportive to my marriage, my father isn't. He even basically disowned me last week because my one-sided decision to marry my girlfriend, and blame my mother for being the "bad influence" for me.

And now, today, December 16th, and I'm still in this weird Limbo and have nowhere to go. with $0 in my pocket (have spent all of my savings for marriage preparation) And our marriage is approaching. I almost given up.

Only around 700 lines of code and I finally have my first working Vulkan drawcall! Can't wait to integrate it into my engine for all the parallel rendering goodness (not to mention better architecture and asynchronous-ness)

One thing that's a bit weird about Vulkan is the way everything is very static and tightly linked together. You basically need a different renderpass for each stage of rendering (scene-hdr-no-aa, scene-hdr-msaa4, scene-hdr-smaa1, scence-shadow, post-bloom, post-resolve, etc.), a different pipeline object for each distinct pipeline configuration (!!) and both framebuffers and pipeline objects are only valid within the single renderpass they've been created for (roughly speaking)

Oh, and each time the window is resized you have to recreate *all* of these objects from scratch because they also depend on viewport size

No wonder `pipelineCache` is the first argument of `vkCreateGraphicsPipelines` lol

I once agreed to maintain and develop an application used in a different section of the school to keep inventory and make sure everything is where it is supposed to be.

At first there was enthusiasm, together with 2 of my classmates we agreed and git clone-d the .NET application that now graduated students built and maintained for the past few years. What could go wrong right?!

It became clear that the original students that worked on it followed an older curriculum, meaning they still got taught .NET instead of the core variant that we get now, not only that but it also seemed that they either did not fully grasp the Clean/Onion architecture or didn't get it in class since there were infrastructure components in the 'Domain' project of the solution. Think of 2 DBContexts in the domain model, yep.

One of us bailed in the first week, the other one and I felt bad for the people using the app so we went on and tried to work on the first bugs that were described in a document. One of these bugs was 'whenever I filter on something in the list, everybody gets to see that filter on their screen instead of only me'. Woah that's weird! Let's see how they put that together!

Oh god, they are using a _static_ variable to store filters, no wonder that it doesn't work properly. Ever heard of sessions?!

Second bug: Sometimes people can't create an account when we sign them up from the admin panel. Alright that is weird, let's figure that one out! Wait a second it seems to work in development? What's this about.

Oh wait I can't create an account on production either? Oh that's weird, wait a second... Why do I have to put my e-mail in a form that was sent to me through e-mail? Why is my address not filled in already? OOH, if someone types in the wrong e-mail address (which is easy since our school has 4 variants of the same f*cking e-mail address) it won't work since it can't recognize the user! Brilliant! Remove e-mail input box and make a token/queryparam determine the user account.

Ah that seems good, it's a mess but it seems a tiny bit better now, great! We're making progress and some sweet buck.

Next bug, trillions of 50x errors on random pages, that's a weird one.

Hm everything works in development, that's odd. Is the production data corrupted?

DID I MENTION that in order to get into the system in development we have to load in a f*cking production database backup ON OUR DEVELOPMENT MACHINE and then ask one of the users' password to login to it and create an account for ourselves? Seeding? What's that, right?!

Anyway, back to bug fixing. I e-mail the the people responsible for the app and get a production admin account, oh I also can't ssh into it because of policies so I have to do everything over e-mail and figure out what's causing the errors. I somehow also wonder if they have any kind of virtualization in place, giving students a VM to do that stuff in doesn't seem so weird does it ? Even with school policies?

Oh btw, 'deploying' means sending a .zip file to a guy in another building and telling him how to configure it, apparently this resulted in a missing folder that the application needed to work and couldn't make on its own. This after 2 weeks of e-mailing back and forth.

After 3 months i quit out of despair and sadness, and due to the fact that I just couldn't do it anymore. I separated everything into logical subprojects and let the last guy handle it, he was OK with that and understood why I left.

Luckily, around that time I already had an actual job at a software development company :)

I present to you the rubber duck I use for debugging.

that's right I dont have one. I just to talk to myself really. but what's curious is that when I do this, I tend to cock my head to a side, or turn slightly in my chair as if I was talking to someone just behind me. I didnt realize I was doing this until my cousin pointed it out to me coz it was creeping her out.

let me also mention that I used to have an imaginary friend growing up. his name's Jesse. I dont know if it really is just a weird mannerism or maybe I was still subconsciously talking to him.

I used to work with a teacher in my last uni year.

The job consisted on doing a kinda-like management system for a business. It all began kinda "right", we agreed upon a price for 6 months of my work (a very lowball price, but it was just right because I was learning stuff that we were going to be using).

Fast-forward first six months, all I do is code frontend, mockup screens and whatsoever because this "business" hadn't give us proper requirements (Yeah, I told him to ask for them, but nothing came through).

So I was like well, I'll keep working in this project because I really want to finish it. Sidenote: I was doing all the "hard work", he didn't know how to code, and he calls himself a teacher... wtf).

Months go by, and a year goes round, in between these months, he spoke to me, that he wanted me that we kept working together, that we could renegotiate the payment (I asked him to give me my payment once the job was done). I agreed, but my uni residence period was coming along and I got an oportunity to go abroad to another country.

So there I was, in the need of money to buy my passport, plane tickets and other stuff, so I asked him for the payment.

Needs to be noted, that the last 6 months work was me doing tutorials on how to fucking use Linux, how to use PostgreSQL, how to fucking use CSS! He told me he would pay me extra for it.

The day came, and I received my payment... the exact amount we talked a year ago, I was like "Seriously dude?", but well, I needed the money and I didn't have time to argue, so we talked a little bit about me helping him and I told him "As long as I have time, I'll help, but remember that I'm going abroad to work for a small startup, so maybe I'll be up to my head with work" he agreed, we nod and then I left.

First week abroad came in and I was doing a shit-ton of stuff, then his first message comes around "Hey, I need more tutorials! ASAP! Before 6PM"

What.The.Fuck. I told you, son of a bitch, that I wouldn't be able to do them until weekend.. and it was monday!

So I ignored it, weeks went throught and my "angry mood" was fading away so I said to myself "Well, it's time to pick up that stuff again", I open Slack and I find a week old message with a document attached, it was a "letter", I just skimmed by it and read some keywords "deceptioned... failed me.."

Sure dude? Was I the failure? Becase, as far as I remember, you were the fucktard that didn't know how to fucking install a VM!

A week went by, and then randomly a friend of mine talks to me through Facebook:

E: Hey, how are you?
M: I'm fine, what's up?
E: What did you do to TEACHER?
M: Nothing, <explains all situation>
E: Well, It seems weird, that's why I wanted to talk with you, I believe in you, because I know you well, but TEACHER it's thrashing shit about you with all his students on all of his classes
M: Seriously?
E: Yeah, he's saying that you are a failure, irresponsible, that you scammed him

That moment, I for sure, lost all moral responsibility with him and thought to myself "He can go fuck himself with my master branch on his ass"

So when I got back to my country, I had to go around in school, avoiding him, not because I was ashamed nor anything by the way, just because I knew that If i ever had the disgrace to meet him face to face, my fists would be deep into his nose before he could say "Hey".

Moral of the story:
If you overheard that a teacher has a bad rep, not by one, nor two, but more than +100 people, maybe it's true.

Good thing my friends and others know me well and I didn't have repercutions on my social status, I'm just the guy that "fucked up TEACHER because I had the right and way to do it"

You know what really grinds my gears? When people criticize a programming language but uses edge cases and stuff that can be avoided by using the tried and true "don't be an idiot". Take for instance JavaScript, a language I like and a language that has a lot you can criticize. But I feel like a lot of peoples criticism isn't warranted.

What's that? No ints? Use parseInt or Math.floor.

What are you saying? == works in strange ways? Yes, that's what we have === for.

Type coercion is wonky? Think it's weird how string + int works differently than string - int? Wanna string with number + - + - - + - - etc? Don't! Don't add strings and ints, don't subtract strings and ints. You can't in statically typed languages and you aren't supposed to in dynamically typed

Adding arrays and objects, arrays and arrays, objects and objects etc. is inconsistent? Why are you trying to do that?

Adding floats together gives odd results? Now we're getting somewhere! And Mozilla responded to that with a method called toFixed.

Declaring variables with var doesn't always work that well? Use let and const

Then there's this weird attitude that some people I've met have, where they will complain about the module system and how "well you rely on the community for those packages" as if it's a bad thing. And then coming with the "well you don't know what the (open source) packages do internally" as if I (for the most part) give a shit. Then they'll swear by companies like Zend or Microsoft as if they can't just stop supporting the languages they use. Maybe it's just because I like community content more because of video game mods.

Wanna criticize JS, then there's plenty to talk about. Like the built in date object is basically shit. Or how in NodeJS you can have node_modules in your node_modules. Or how classes don't really have the best syntax. Left-Pad. And so on (it's too late for me to be able to remember much more).

I am a weird dev. No urge to rant really, mostly internal frustrations if any.

Today I had my first meeting with the client and it went smoothly - I showcased demo in the current state, they approved, asked a bit more about the technology and that's pretty much it...

I know, I know... I'm just starting and it's gonna change but, idk why, I think I'm in a good work environment.

So here's is the thing.
For some weird reason I decided to work at a VC funded startup. For 15k year,(I live in a really poor country).

So, let me describe the hell I'm in now, and if for some good grace you happen to be hiring, please consider saving me from the horror that's ahead.

Company got funded 5 months ago, main owners are, an economist and a civil engineer with no programming habilities whatsoever.

They took 1 month to assemble "a killer team", with no hiring expertise they handpicked a CTO that came in 1 month later and took a month of vacation in his first month of work.

He didn't do any specification of the system that needs to be built.

The 2 naive owners hired the rest of this "killer team".

The team is good, but have no appreciation of planning.

They've built and rebuilt the backend system twice, once in graphql and the second with plain http (is not real rest, just a http api), in front of, guess what a mongo database.

This mongo DB is not only one, but 7, because we have 7 microservices, and each has its own database.

After some time, they decided to fire their CTO, and hire one more programmer(that's me), because the CTO wasn't doing anything.

The app has 3 parts, the app per se, a business version, and a help desk, guess what the helpdesk just appeared last week on the radar.

Long story short, we have one month to deliver what couldn't be built in 5.

When I decided to work for these people, I did not imagine the kind of clusterfuck that I was getting into.

It took me 1 month to realize the whole situation, now, I really would like to see some help from the deities of any religion, not for the project, that project is doomed.

It's how I'll pay the bills after that clusterfuck collapses that worries me.

Now in the startup no one is talking about how stupid the whole situation is. Or how far back we are. And at this point there's very little that could be done about it, I have a feeling that it could still be accomplished, but it's fading day after day.

I will do my best to live the best of this experience, and do as the musicians in the Titanic and keep playing the music even after knowing the Titanic is sinking.

PR reviews, people leave great comment, some suggestions and there could be a discussion.

But please don't be the person who goes there and add those weird and useless comments such: "CI failed, your PR is behind dev branch..."
That's the role of the provider(Github, Bitbucket.....) and adding that comment is just a waste of time.

This start to happen more often and I had to rant about it :D

At a previous job I bumped heads with the IT person a lot because he would spread misinformation about technology so the owners would never replace him. This was conversation with the VP:

VP: Hey I just got a new security setup at my house and I can monitor everything with my phone.
Me: That's cool.
VP: I'm rethinking it because [IT guy] said it was very dangerous to have, what do you think?
Me: ....? What did he say was dangerous about it?
VP: He said hackers could then gain access to cameras and plan the perfect time to rob me since it's in the cloud.
Me: I seriously doubt anyone is planning an Ocean's 11 heist to steal your TV.
VP: Yea I thought it sounded weird when he told me.

Ice King. Lonely, weird, has a penguin for a debugger and doesn't do as he commands... Yup, that's a Linux guy alright.

Client: my video player has two play buttons.
Me: ok that's weird let me check yes it does have two play buttons your right so turns out the client has taken a screenshot of another video player with the play button still on it and used that as their poster image hence two play buttons.

Finding it impossible to explain this to them arrrrggggghhh why why why

Absolutely not dev-related.

Blah, blah, weird conversation and shit. I'm too tired and lazy to write this crap again, but let's do it.

The guy is a dev I randomly found on some chatting service, he was interesting to talk with until this conversation. I'll write this out of memory, so yeah.

Him: So by the way I wrote an app that you give your penis size to to get measurements and stuff about it.
Me, thinking it was dev humor: That's hilarious. Tell me more, I'm interested.
Him: So the idea behind all of this was to gather some big data style info about people's penis size and habits and all that stuff.
Me: Man that's awesome. Can I see the source?
Him: No, it's proprietary. You can buy a license though.
Me: You went that far for a joke?
Him: What joke?
Me: The whole software you just told me about.
Him: That's not a joke, I'm being very serious about it.
Me: Oh well. What did you get from the stats?
Him: I got some tips from people's habits! I never thought that shaving it could make it look bigger, but that's awesome!
Me: Do you really care about it that much?
Him: Studies have proven that size correlated with confidence. Since I started doing it, I've been more confident than ever!
Me: Great.
Him: I'm a bit disappointed to see that I'm in the lower percentiles though.
Me: Well of course you are.
Him: Why would you say that?
Me: Well since people with a big dick tend to go more willingly into the subject and might even buy a fucking app for it, of course you'd have the higher average in your stats.
Him: You're only saying that because you have a small cock.
Me: Why the fuck would you say that? You're the one that's concerned about it, not me.
Him: Go on, what's your size?
Me, because I don't care about discussing that stuff: *Tells him*
Him: [stats, comparisons and stuff]
Me: Well I never gave a fuck and your stats won't make me change my mind.
[ ... Some other shit about my size compared to his ... ]
Him: Would you want to work with me for the database maintenance?
Me: You must be joking?
Him: I'm serious.
Me: *Deletes account*

Seriously, fuck that guy. I rewrote that quickly so you only had the best, but it was a whole fucking conversation.

Laying cozy on sofa, watching yt from phone. Decide there's a need for a bigger screen but too cozy to adjust position to watch from TV. Grab trusty old chromebook running Debian from arm's reach instead. Haven't used that thing in a while. Try to connect bt headphones. Notice that the Bluetooth module is not detected according to the UI. Weird, never noticed that. Wonder what that's about. Apparently someone had fixed it in kernel already long ago, I'm on a much newer kernel. Too lazy to pick up wired headphones from across the room. Maybe I'll update the firmware, I haven't done that in a while. Oh, the script doesn't run because it requires newer glibc. Wait, I'm still on Debian 11, maybe it would be worth it to upgrade to 12. Wow, upgrading Debian is a surprisingly manual process. Wonder what I'll be doing tonight. Wait, what was I doing again?

Can someone help me understand?

I subscribed to a nifty IT-releated magazine, and on its back, there's an ad for "Dedicated root server hosting", nothing unusual at a first glance, but after I read the issue, I decided to humor them and see what it is that they offered, and... It just... Doesn't make sense to me!

An ad for "Dedicated Root Server" - What is a dedicated root server first of all? Root servers of any infrastructure sound pretty important.

But, the ad also boasts "High speed performance with the new Intel Core i9-9900K octa-core processor", that's the first weird thing.

Why would anyone responsible enough want to put an i9 into a highly-reliable root server, when the thing doesn't even support ECC? Also, come on, octa-core isn't much, I deal with servers that have anywhere between 2 and 24 cores. 8 isn't exactly a win, even if it has a higher per-core clock.

Oh, also, further down the ad has a list of, seeming, advantages/specs of the servers, they proclaim that the CPU "incl. Hyper-Threading-Technology"... Isn't that... Standard when it comes to servers? I have never seen a server without hyperthreading so far at my job.

"64 GBs of DDR4 RAM" - Fair enough, 64 gigs is a good amount, but... Again, its not ECC, something I would never put into a server.

"2 x 8 TB SATA Enterprise Hard Drive 7200 rpm" - Heh, "enterprise hard drive", another cheap marketing word, would impress me more if they mentioned an actual brand/model, but I'll bite, and say that at least the 7200 rpm is better than I expected.

"100 GBs of Backup Space" - That's... Really, really little. I've dealt with clients who's single database backup is larger than that. Especially with 2x8 TB HDD (Even accounting for software raids on top)

This one cracks me up - "Traffic unlimited"
Whaaaat?! You are not gonna give me a limit to the total transferred traffic to the internet for my server in your data center? Oh, how generous of you, only, the other case would make the server just an expensive paperweight! I thought this ad was for semi-professionals at least, so why mention traffic, and not bandwidth, the thing that matters much more when it comes to servers? How big of a bandwidth do I get? Don't tell me you use dialup for your "Dedicated Root Server"s!

"Location Germany or Finland" - Fair enough, geolocation can matter when it comes to latency.

"No minimum contract" - Oooh, how kiiiind of you, again, you are not gonna charge me extra for using the server only as long as I pay? How nice!

"Setup Fee £60" - I guess, fair enough, the server is not gonna set itself up, only...

The whole ad is for "monthly from £55.50", that's quite the large fee for setup.

Oh, and a cherry on top, the tiny print on the bottom mentions: "All prices exclude VAT and are a subject to..." blah blah blah.
Really? I thought that this sort of almost customer deceipt is present only in the common people's sphere!

I must say, there's being unimpressed, and then... There's this. Why, just... Why? Anyone understands this? Because I don't...

Sorry, need to vent.

In my current project I'm using two main libraries [slack client and k8s client], both official. And they both suck!

Okay, okay, their code doesn't really suck [apart from k8s severely violating Liskov's principle!]. The sucky part is not really their fault. It's the commonly used 3rd-party library that's fucked up.

Okhttp3

yeah yeah, here come all the booos. Let them all out.

1. In websockets it hard-caps frame size to 16mb w/o an ability to change it. So.. Forget about unchunked file transfers there... What's even worse - they close the websocket if the frame size exceeds that limit. Yep, instead of failing to send it kills the conn.

2. In websockets they are writing data completely async. Without any control handles.. No clue when the write starts, completes or fails. No callbacks, no promises, no nothing other feedback
3. In http requests they are splitting my request into multiple buffers. This fucks up the slack cluent, as I cannot post messages over 4050 chars in size . Thanks to the okhttp these long texts get split into multiple messages. Which effectively fucks up formatting [bold, italic, codeblocks, links,...], as the formatted blocks get torn apart. [didn't investigate this deeper: it's friday evening and it's kotlin, not java, so I saved myself from the trouble of parsing yet unknown syntax]

yes, okhttp is probably a good library for the most of it. Yes, people like it, but hell, these corner cases and weird design decisions drive me mad!

And it's not like I could swap it with anynother lib.. I don't depend on it -- other libs I need do!

So I just recently had the pleasure to set up a Rails environment for a friend on Windows. I haven't used Windows in about 5 or 6 years, and the person I had to set it up for doesn't know much about programming at all.

I all went fine at first, install database, devkit thingy and git. Then set up the project itself. And there is where the problems started.

First windows would refuse to use SSL, because of some weird bug in the Windows version of rubygems. The suggested upgrade did not work so I had to switch some gem sources to insecure connections, but at least it did install everything correctly.

Alright, I thought, that's not _that_ bad, everything is running now.

He sent me a screenshot some time later. Something was wrong with the JavaScript runtime, and I could not figure out for the life of me what the issue was.

Later again he sent me another screenshot.
His Antivirus spyware was messing with the asset pipeline. (╯°□°）╯︵ ┻━┻

This was the point where I just said "FUCK IT, i'll just put everything into a fucking VM and let him use that".
I should have done that in the first place.

Long story short:
Setting up a development under Windows is painful.
Do yourself a favor and just use a VM.

A few months ago I bought an e scooter to get from home to work.

The backstory to this:
My car broke down on the highway, my sister's car broke down on the highway and we didn't have another car apart of my dad's anymore.
Which means I had to look for another car. The cars between 1k-5k € are dogshit and when you want to register the car you have to have an appointment at a government building which happens to be closed when I'm getting out of my 8-5 job.
I had enough and bought an e scooter.

Now back to now:
In the beginning it was cool.
Could get anywhere I wanted to in combination with the Germany ticket. Except for the Netherlands where my beautiful girlfriend is.
There I can legally not use it but that's ok lol.

The German government is hyping e mobility and public transportation up, but for what?
E mobility currently sucks ass with all the shit laws for e.g. e scooters and when you want to transport it in public transport, people give you weird looks, the bus driver wants you to buy a bicycle ticket even if I can fold the e scooter and more. The scanners in the bus of the German buses cannot read my German ticket for some reason and every bus driver in my city knows that and they just look at it and are like "Ok, you're cool. Continue moving", but this old grandma looking ass bitch is like "No, according to the law you need to show it to the scanner and not to me". I fucking know. I've been doing this shit for a year and you know that but it doesn't work. It says to me that I need to show it to you instead of to the scanner bc this machine is fucking dumb and apparently I'm holding the people because I started a discussion with her. This driver ... ugh. The buses in my city come whenever they want as well.
Like sometimes 5 minutes earlier, sometimes up to 30 minutes later.
Inconsistent motherfuckers and I am the one making everyone wait? Suck my donkey kong balls.

German trains... well you know how that goes. It doesn't. It sucks ass.
Every single fucking train line has a problem. Either a previous train has something, or staff is missing, or a technical error or the train driver's ass is itchy and needs scratches from his assistant. There's always something.

When I want to travelled home from my gf I spent not lying 8 fucking hours on the trains on Sunday.
Normally it takes max. 5 hours with a train and 3-4 hours with a car.
I can also go on a rant because of the Dutch train system because it also sucks, BUT they are reliable. They are there when they say they are gonna be there. 99% of the times.
In Germany it is somewhere at 10%.

Now I realized that e scooters are uncomfortable and expensive toys who need maintenance just like a car but nonetheless they are reliable unlike the public transport.
In the winter it will be even worse.

Electrical cars are way expensive and affordable electrical cars you need to keep charging every few baby steps.

I also looked at 125ccm motorcycles which you can drive if you upgrade your existing car driver's license, but ngl that's a scam. Not worth it at all.

And that's why I am looking for a traditional car now. E mobility is not there yet in Germany and public transport is not doable at this moment.

Microsoft Fake? That's really weird

not sure if this totally classifies as a rant, but here goes:

so my Pi is giving a lot of problems. can't install software, keep getting weird error messages. so I try DD a new image onto the card. does not work at all. tried on three different machines :D
next I try run rm -rf /
it's obviously totally fucked. nothing works. pull the plug and plug it in again to see what happens.... it boots up again :D all the commands are back. no files are gone.

and that's when I was like fuck this and I returned the sd card :D

PM: This is broken.
Me: What? It works locally. That's weird...
PM: ...............
Me: (5 mins later) ok try again.
PM: still broken.
Me: Bangs head on desk. Why is this working locally?!?!!?
Me: (3 hours later) I'm missing a semi colon, and it wouldn't minify. Awesome.

Anyone else have people that seem to constantly try to "prove" themselves to you in this weird, competitive way that only makes them seem... very annoying? I'll call him Bob here, but it's always something like:

Bob: Hi Almond, how's it going?
Almond: Ah not bad thanks, PSU blew up in the PC over the weekend though so that was a bit of a faff!
Bob: Ah no! How old's your PC?
Almond: Oh, like 7-8 years old now. I don't replace it often.
Bob: Really?! I replace mine completely every year.
Almond: Ah, cool.
Bob: Yeah, I'm a dev so I feel I need to. It's like my tool, you know.
Almond: Sure thing!
Bob: I actually spend quite a lot on it. I make sure it's got the fastest memory I can afford. Like, DDR5 stuff. That's really important, you know.

...etc., while I try to get out of said conversation for the next eternity.

Or:

(while in a conversation about a frontend bug I was looking at in Chrome devtools)
Bob: Hey Almond, you know Firefox actually had a plugin that did all this stuff before everything else?
Almond: Err, yeah, I think so. Used it back in the day.
Bob: It was called firebug. It was really good. Revolutionary.
Almond: Certainly was.
Bob: It was launched in January 2006 you know.
Almond: Right...
Bob: I used it back then.

...I mean damn, I'm all for being civil, but no-one cares you replace your PC every year, or that you know the year firebug was released, or that you once set up 5 identical PCs with different versions of Linux to run some benchmarks...

I am pretty much a designer.
I hope I didn't give others bad experiences~

Oh well I always loudly rant and get insulting when I see comic sans (in wrong usage) or ugly websites (not old or weird but old looking AND overdesigned 😓).
Probably that's what's most annoying when you're talking about me as a designer.

Today's rant: JavaScript's type system.

I realized halfway through that I can't happily call JavaScript a "programming language" so just assume
alias programming="scripting"

I'm sure it's not actually as frustrating as it seems to me. Thing is, I'm used to either statically-typed languages or dynamically-typed languages that actually make sense. If I were to try to add an integer to something I'd forgotten was a string in Python, it'd immediately tell me "look, buddy, do you want me to treat this as a concatenation or an addition? I have no idea the way you've got this written." I've found that mistakes are a common thing with dynamic typing. Maybe I'm just not experienced enough yet, maybe it's really as stupid as it looks. JavaScript just goes "hey look I'm gonna tack all of these guys together and make a weird franken-string like '$NaN34.$&' because that's absolutely what we want here!" Then I run my webpage and instead of a nice numeric total like I wanted, good old JavaScript just went "Yep, I have no idea what I'm doing here I'm just gonna drop this here and pretend it's right." Now absolutely I do not expect my programming language to make correct assumptions and read my mind, otherwise JavaScript would be programming me and not the other way around. But it could at least let me know that I had incompatible types going on rather than just shamelessly going along with what it's doing. Good GRIEF, man, some of the idiosyncrasies of the EMCAScript language definition itself just make me want to punch a horse.

Writing x86 assembly code in VS Code feels so weird. I mean, I'm using something that's built using crazily high level languages (JS, HTML, CSS), on top of a mammoth runtime environment (Node, V8), which is itself sitting on a modern and sophisticated operating system (Antergos), and I'm writing code that shifts bits and bytes around in memory in order to get one part of my C program to run just a little faster. Wow.

!rant

so the other day i was programming and suddenly i wanted to learn haskell. (i don't know why it hit me so suddenly, maybe because it's a 'pure' functional programming language and these 2 terms i knew nothing about)

and to be honest it's really hard coming from an imperative programming language (C/C++, yes, i know they are different in their ways). it's like learning to program again! you really have to get a different mindset and for me honestly it's hard to grasp the idea that 'variables' are immutable! like, that's soooo weird it still stucks to me. for example how did they define the max or min function without using a while loop? what are monads?

I am just 2 days in but it'll be a fun ride!

I hate dev politics...

PM: Hey there is a weird error happening when I upload this file on production, but it works on our test environments.

Me: After looking at this error, I don't find any issues with the code, but this variable is set when the application is first loaded, I bet it wasn't loaded correctly our last deployment and we just need to reload the application.

Senior Dev: We need to output all of the errors and figure out where this error is coming from. Dump out all the errors on everything in production!!

Me: That's dumb... the code works on test... it's not the code.. it's the application.

Senior dev: %$*^$>&÷^> $

Me: Hey I have an idea! If test works... I can go ahead and deploy last week's changes to prod and dump those errors you were talking about!!

Senior Dev: OK

Me: *runs Jenkins job the deploys the new code and restarts the application*

PM: YAY you fixed it!!

Senior Dev: Did you sump put those errors like I said.

Me: Nope didn't touch a thing... I just deployed my irrelevant changes to that error and reloaded the application.

I really gotta stop accepting food from other people

my birthday was the other day and my roommate wanted to get me something special to eat for free

I said I keep dreaming of the samosa salad from Indian places he would get and I would keep stealing a spoon full of to try (this was after I got sick and insensitive to food so I was cautious)

he insisted it was from this fast food place... that's weird. I don't think it was. he insists all Indian places have it on their menu but he just didn't know. and he was getting this fast food's place one and that's the one I liked. ok. I consent.

I go running, come back, shower, hungry and food arrived, so I scuff down half the samosa salad thing
now I feel like trash
and it tastes nothing like it
it has fucking BBQ sauce in it. no yogurt. it's supposed to be Indian. what the fuck, sweet-ass bqq sauce? the spiciness is some retarded white people taste. this isn't the punch of Indian food.
30% of the mass is cucumber. wat. there's fucking pomegranate seeds in it so you can't even chew it. what am I even eating. the samosa pieces are all soggy and not crunchy like I remember. the spiciness sucks. there's no yogurt to counteract it either. just pathetic

and now I feel like garbage. I feel sick to my stomach. because that BBQ sauce was a lot more sugar than you could taste.

I fucking hate my life. I hope I don't get sick from the food, cuz I have food insensitivities... and I knew before when I took spoonfuls of what he ordered they didn't effect me... but that wasn't this.

this fucker literally lied and used me to order food guilt-free under the pretense of "hey it's your birthday and I wanna get you a meal". and he orders disgusting fast food that isn't even food. "for me". while lying to me. me who can't even eat the damned cherries I love without my brain degrading because those are too much sugar. what the hell is wrong with this guy

I know I got downvoted for this before but fuck I hate fat people. I don't want to eat fast food. I want real food. I don't want to get sick off fake fucking BBQ sauce infused with disgusting sugar. all this guy does is make excuses for the food he wants to eat. maybe I'm just literally food insensitive watching him eat himself to death I don't know. I feel like puking

I swear nothing good anyone ever does for you is ever for you. people are rotten.

A software had been developed over a decade ago. With critical design problems, it grew slower and buggier over time.
As a simple change in any area could create new bugs in other parts, gradually the developers team decided not to change the software any more, instead for fixing bugs or adding features, every time a new software should be developed which monitors the main software, and tries to change its output from outside! For example, look into the outputs and inputs, and whenever there's this number in the output considering this sequence of inputs, change the output to this instead.
As all the patchwork is done from outside, auxiliary software are very huge. They have to have parts to save and monitor inputs and outputs and algorithms to communicate with the main software and its clients.
As this architecture becomes more and more complex, company negotiates with users to convince them to change their habits a bit. Like instead of receiving an email with latest notifications, download a csv every day from a url which gives them their notifications! Because it is then easier for developers to build.
As the project grows, company hires more and more developers to work on this gigantic project. Suddenly, some day, there comes a young talented developer who realizes if the company develops the software from scratch, it could become 100 times smaller as there will be no patchwork, no monitoring of the outputs and inputs and no reverse engineering to figure out why the system behaves like this to change its behavior and finally, no arrangement with users to download weird csv files as there will be a fresh new code base using latest design patterns and a modern UI.
Managers but, are unaware of technical jargon and have no time to listen to a curious kid! They look into the list of payrolls and say, replacing something we spent millions of man hours to build, is IMPOSSIBLE! Get back to your work or find another job!
Most people decide to remain silence and therefore the madness continues with no resistance. That's why when you buy a ticket from a public transport system you see long delays and various unexpected behavior. That's why when you are waiting to receive an SMS from your bank you might end up requesting a letter by post instead!
Yet there are some rebel developers who stand and fight! They finally get expelled from the famous powerful system down to the streets. They are free to open their startups and develop their dream system. They do. But government (as the only client most of the time), would look into the budget spending and says: How can we replace an annually billion dollar project without a toy built by a bunch of kids? And the madness continues.... Boeings crash, space programs stagnate and banks take forever to process risks and react. This is our world.

I think the sleep deprived me is finally cracking under the weight of incompetent assholes.

We just launched a major project in some weird cocktail of Agile slapped with MVP and release to the wild in a waterfall, but it was premature, premature in the sense QA hasn't even finished their side of things, but because some fuck with with "manager" in their title decided they have burnt through the budget with incompetence and scrapped an entire element of the project and outsourced just so they could make a shittier version that doesn't even fucking work.

How hard do you want to fail before you will start listening to the people that now have to work around the fucking clock to clean up this horse shit of a mess.

I'm literally arguing over field mapping with multiple 3rd parties, when the fucking requirements state WTF this is suppose to look like. All because they didn't validate or test their own shit.

Why is EVERY FUCKING cock head in this industry a waste of space and cash! Is it really to much to ask for 1 fucking project to fucking go live that actually fucking works where I don't need to work 2 weeks straight (including weekends) after going live just to be sure that what shit does hit the fan isn't going to create a SEV 1 issue...

Sorry, I'm pissed at the incompetence of others I need to deal with on a daily basis. It's not like this field is insanely hard. A little attention to detail and self validation, verification goes a long way. But clearly that's a rarity.

Once this shit is stable and actually works, I'll be pulling out the mop to clean up half this shit just so it actually works.

Oof, I'm getting to old for this bullshit.

!!!rant

Most exited I've been about some code? Probably for some random "build a twitter clone with Rails" tutorial I found online.

I've been working on my CS degree for a while (theoretical CS) but I really wanted to mess with something a bit more practical. I had almost none web dev experience, since I've been programming mostly OS-related stuff till then (C). I started looking around, trying to find a stack that's easy to learn since my time was limited- I still had to finish with my degree.

I played around with many languages and frameworks for a week or two. Decided to go with Ruby/Rails and built a small twitter clone blindly following a tutorial I found online and WAS I FUCKING EXITED for my small but handmade twitter clone had come to life. Coming from a C background, Ruby was weird and felt like a toy language but I fell in love.

My excitement didn't fade. I bought some books, studied hard for about a month, learned Ruby, Rails, JavaScript, SQL (w/ pg) and some HTML/CSS. Only playing with todo apps wasn't fun. I had a project idea I believed might be somewhat successful so I started working on it.

The next few months were spent studying and working on my project. It was hard. I had no experience on any web dev technology so I had learn so many new things all at once. Picked up React, ditched it and rewrote the front end with Vue. Read about TDD, worked with PostgreSQL, Redis and a dozen third party APIs, bought a vps and deployed everything from scratch. Played it with node and some machine learning with python.

Long story short, one year and about 30 books later, my project is up and running, has about 4k active monthly users, is making a profit and is steadily growing. If everything goes well, next week I'll close a deal with a pretty big client and I CANT BE FKING HAPPIER AND MORE EXCITED :D Towards the end of the month I'll also be interviewed for a web dev position.

That stupid twitter clone tutorial made me excited enough to start messing with web technologies. Thank you stupid twitter clone tutorial, a part of my heart will be yours forever.

Pentesting for undisclosed company. Let's call them X as to not get us into trouble.
We are students and are doing our first pentest at an actual company instead of assignments at school. So we're very anxious. But today was a good day.
We found some servers with open ports so we checked a few of them out. I had a set of them with a bunch of open ports like ftp and... 8080. Time to check this out.
"please install flash player"... Security risk 1 found!

System seemed to be some monitoring system. Trying to log in using admin admin... Fucking works. Group loses it cause the company was being all high and mighty about being secure af. Other shit is pretty tight though.

Able to see logs, change password, add new superuser, do some searches for USERS_LOGGEDIN_TODAY! I shit you not, the system even had SUGGESTIONS for usernames to search for. One of which had something to do with sftp and auth keys. Unfortunatly every search gave a SQL syntax error. Used sniffing tools to maybe intercept message so we could do some queries of our own but nothing. Query is probably not issued from the local machine.

Tried to decompile the flash file but no luck. Only for some weird lines and a few function names I presume. But decompressing it and opening it in a text editor allowed me to see and search text. No GET or POST found. No SQL queries or name checks or anything we could think of.

That's all I could do for today. So we'll have to think of stuff for next week. We've already planned xss so maybe we can do that on this server as well.

We also found some older network printers with open telnet. Servers with a specific SQL variant with a potential exploit to execute terminal commands and some ftp and smb servers we need to check out next week.

Hella excited about this!

If you guys have any suggestions let us know. We are utter noobs when it comes to this.

I'm considering quitting a job I started a few weeks ago. I'll probably try to find other work first I suppose.

I'm UK based and this is the 6th programming/DevOps role I've had and I've never seen a team that is so utterly opposed to change. This is the largest company I've worked for in a full time capacity so someone please tell me if I'm going to see the same things at other companies of similar sizes (1000 employees). Or even tell me if I'm just being too opinionated and that I simply have different priorities than others I'm working with. The only upside so far is that at least 90% of the people I've been speaking to are very friendly and aren't outwardly toxic.

My first week, I explained during the daily stand up how I had been updating the readmes of a couple of code bases as I set them up locally, updated docker files to fix a few issues, made missing env files, and I didn't mention that I had also started a soon to be very long list of major problems in the code bases. 30 minutes later I get a call from the team lead saying he'd had complaints from another dev about the changes I'd spoke about making to their work. I was told to stash my changes for a few weeks at least and not to bother committing them.

Since then I've found out that even if I had wanted to, I wouldn't have been allowed to merge in my changes. Sprints are 2 weeks long, and are planned several sprints ahead. Trying to get any tickets planned in so far has been a brick wall, and it's clear management only cares about features.

Weirdly enough but not unsurprisingly I've heard loads of complaints about the slow turn around of the dev team to get out anything, be it bug fixes or features. It's weird because when I pointed out that there's currently no centralised logging or an error management platform like bugsnag, there was zero interest. I wrote a 4 page report on the benefits and how it would help the dev team to get away from fire fighting and these hidden issues they keep running into. But I was told that it would have to be planned for next year's work, as this year everything is already planned and there's no space in the budget for the roughly $20 a month a standard bugsnag plan would take.

The reason I even had time to write up such a report is because I get given work that takes 30 minutes and I'm seemingly expected to take several days to do it. I tried asking for more work at the start but I could tell the lead was busy and was frankly just annoyed that he was having to find me work within the narrow confines of what's planned for the sprint.

So I tried to keep busy with a load of code reviews and writing reports on road mapping out how we could improve various things. It's still not much to do though. And hey when I brought up actually implementing psr12 coding standards, there currently aren't any standards and the code bases even use a mix of spaces and tab indentation in the same file, I seemingly got a positive impression at the only senior developer meeting I've been to so far. However when I wrote up a confluence doc on setting up psr12 code sniffing in the various IDEs everyone uses, and mentioned it in a daily stand up, I once again got kickback and a talking to.

It's pretty clear that they'd like me to sit down, do my assigned work, and otherwise try to look busy. While continuing with their terrible practices.

After today I think I'll have to stop trying to do code reviews too as it's clear they don't actually want code to be reviewed. A junior dev who only started writing code last year had written probably the single worst pull request I've ever seen. However it's still a perfectly reasonable thing, they're junior and that's what code reviews are for. So I went through file by file and gently suggested a cleaner or safer way to achieve things, or in a couple of the worst cases I suggested that they bring up a refactor ticket to be made as the code base was trapping them in shocking practices. I'm talking html in strings being concatenated in a class. Database migrations that use hard coded IDs from production data. Database queries that again quote arbitrary production IDs. A mix of tabs and spaces in the same file. Indentation being way off. Etc, the list goes on.
Well of course I get massive kickback from that too, not just from the team lead who they complained to but the junior was incredibly rude and basically told me to shut up because this was how it was done in this code base. For the last 2 days it's been a bit of a back and forth of me at least trying to get the guy to fix the formatting issues, and my lead has messaged me multiple times asking if it can go through code review to QA yet. I don't know why they even bother with code reviews at this point.

Some avatar around here just reminded me of the bazillion Europeans living the hipster life in India (I interned there).

context : In India fair skin is a very desired feature, every face washing product has "whitening" on it, god damn it even the shaving foam!
So they tend to treat white people very distinctively : free entry and alcohol in clubs, lots of money in media gigs and the like, strangers inviting you to their marriages just because you're white..
So some white folks would abuse this. And they develop some kind of clothing taste that's weird to say the least.
Maaan they must be trashier than the fucking original hipster God.
I just can't fathom their ways..

Sorry I had to lash out 🙄

I have noticed I have had great success using another co-worker as a metaphorical rubber duck (sometimes intentionally, sometimes unintentionally). It improves my productivity vastly. However, I know that it probably distracts others when I am using them in that way.

That's why I want to buy a literal rubber duck and talk to it. I could do it very quietly and most of my close co-workers use noise-cancelling headphones 80% of time while sitting at their desks. My only concern is other people passing by my desk would think that I am weird. My desk is in an open space and several people pass by it every hour. (however on my floor besides developers we have HR, marketing and people from high up who might be unfamiliar with the rubber duck method).

Is it unprofessional to talk to a rubber duck at the office?

Ok this is a weird story.

So myself and two friends were working on a chrome extension several years ago, probably late high school/early college years.

So before any of us had seen the ballmer peak xkcd, I had discovered it on my own. I was telling my friend that we should start drinking because a)it's Saturday night, and b) I code better buzzed. So he decided to push the limits. He poured my drink super heavy, then another, then didn't finish his and insisted I did. He ended up getting me super drunk. I started going off on how they were doing it wrong, then took over the keyboard. What I wrote cannot even be considered code. I went on an incoherent rant, puked in a trash can, and then woke up in the bathroom with a towel as a pillow.

And that's the story of why my friends are convinced the ballmer peak is definitely not a thing.

Don't know.

All I know is that I suck at calculus but I write good code.
Weird.

If I would have to decide, early on I wrote random stuff 'til it worked.
Then I attempted to comprehend what I just did and started reading books.

That's probably when I first understood what I was doing.

ARE YOU F*CKING KIDDING ME, WINDOWS?

I finally give in and install your stupid ass update, and what happens? let's just skip the part where i sit around for 30 minutes because apparently it takes 30 fucking minutes to install 300MB - by stallman's underpants, that's 150KB per second!
and when windows FINALLY feels like it has finished fondling it's binary-balls, what is waiting for me?

about 10 stupid-ass data-consent notices straight from satans anus, more weird yes-or-maybe settings for cortana (bill gates' ex or whatever that is) which i don't even USE, my browser speed dial has been complemented by about 7 links to SHOPPING SITES and once i sort that mess out i get a notification that the german language pack has successfully been installed.
SUCK MY FUCKING D*CK MICROSOFT, the ONLY thing i want to do with that language pack is SHOVE IT UP YOUR ASS. i can't even uninstall that moronic piece of shit. FUCK YOU.

Why!!!
Why must some devs make life complicated!!!!!!

So, here I am enjoying my day (well enjoying the meetings that are taking me away from working) when I get a bug report that script X isn't sending out emails anymore.

Ok that's weird, this as far as I know uses the same email class as every other email being sent out from this project, and they all work.

Let's go have a quick dig...

function sendEmail(){
/*do a bunch of stuff*/
}
Is being used, well that's odd, it should be $emailService->send()
But what ever, it's probably an old wrapper for legacy sake since this script was written years ago. But nope, I almost cried, it's a wrapper for mail() isolated into this script.

Like for fucks sake, why in the hell would this be used when there's an entire fucking class that's tried and tested and only looses 1 email every few months, coz shit happens.

Errrrr.... sometimes i really wonder why people can't just do what they need to do the first time round.

T_PAAMAYIM_NEKUDOTAYIM

This is how PHP refers to :: internally, it's the only fucking token with such a weird name, what is this fucking language?

Who is writing this shit? OOP but it's completely optional? Where is the goddamn sheriff? I'm done, off to Ruby, Python, Go or anything that's not fucking PHP. Sick of this shit. Fuck this language.

How can such a massive language be so poorly designed!?

Joined a new startup as a remote dev, feeling a bit micromanaged. So this week I joined an established startup as a senior mobile dev where I work remotely.

Previous two devs got fired and two new guys got hired (me as a senior dev and another senior dev as a teamlead, also third senior dev will join next week).

Situation is that codebase is really crappy (they invested 4 years developing the android app which hasn't even been released yet). It seems that previous devs were piggybacking on old architecture and didn't bother to update anything, looking at their GIT output I could tell that they were working at 20-30% capacity and just accepting each other MR's usually with no comments meaning no actual code reviews. So codebase already is outdated and has lots of technical debt. Anyways, I like the challenges so a crappy codebase is not really a problem.

Problem is that management seems to be shitting bricks now and because they got burned by devs who treated this as a freelance gig (Im talking taking 8-10 weeks pto in a given year, lots of questionable sick leaves and skipping half of the meetings) now after management fired them it seems that they are changing their strategy into micro managament and want to roll this app out into production in the next 3 months or so lol. I started seeing redflags, for example:

1. Saw VP's slack announcement where he is urging devs to push code everyday. I'm a senior dev and I push code only when I'm ready and I have at least a proof of concept that's working. Not a big fan of pushing draft work daily that is in in progress and have to deal with nitpicky comments on stuff that is not ready yet. This was never a problem in 4-5 other jobs I worked in over the years.

2. Senior dev who's assigned as the teamlead on my team has been working for 1 month and I can already see that he hates the codebase, doesn't plan on coding too much himself and seems like he plans on just sitting in meetings and micromanaging me and other dev who will join soon. For example everyday he is asking me on how I am doing and I have to report this to him + in a separate daily meeting with him and product. Feels weird.

3. Same senior dev/teamlead had a child born yesterday. While his wife was in hospital the guy rushed home to join all work meetings and to work on the project. Even today he seems to be working. That screams to me like a major redflag, how will he be able to balance his teamlead position and his family life? Why management didn't tell him to just take a few days off? He told me himself he is a senior dev who helped other devs out, but never was in an actual lead position. I'm starting to doubt if he will be able to handle this properly and set proper boundaries so that management wouldn't impact mental health.

Right now this is only my 1st week. They didn't even have a proper backend documentation. Not a problem. I installed their iOS app which is released and intercepted the traffic so I know how backend works so I can implement it in android app now.

My point is that I'm not a child who needs hand holding. I already took on 2 tickets and gonna push an MR with fixes. This is my first week guys. In more corporate companies people sit 2 months just reading documentation and are not expected to be useful for first few months. All I want is for management to fuckoff and let me do my thing. I already join daily standup, respond to my teamlead daily and I ping people if I need something. I take on responsibility and I deliver.

How to handle this situation? I think maybe I came off as too humble in the interview or something, but basically I feel like I'm being treated like a junior or something. I think I need to deliver a few times and establish some firm boundaries here.

In all workplaces where I worked I was trusted and given freedom. I feel like if they continue treating me like a junior/mid workhorse who needs to be micromanaged I will just start interviewing for other places soon.

Yeah, handouts create lazy people I'm not impressed with
You want something in life, then why don't you go and get it?
Actions speak louder than words do, it's pretty quiet, isn't it?
Look at the world we live in, defined by comment sections
Surround yourself with people that challenge how you think
Not people that nod their head and act like they agree
Those people will cut you open just to watch you bleed
Always be yourself, not the person that you pretend to be, no!
These people gon' tell you that you will never make it
Then when you do, they gon' say they knew you were goin' places
That's just how it works, next thing you know you'll be overrated
Hearing people say they miss the "old you, " it's crazy, ain't it?
And perfect people don't exist, so don't pretend to be one
I don't need pats on the back from people for my achievements
When I die I wanna know that I lived for a reason
Anyone can take your life, but not what you believe in, no

Just remember this

Yeah, don't take opinions from people that won't listen to yours
If money's where you find happiness, you'll always be poor
If you don't like the job you have, then what do you do it for?
The cure to pain isn't something you buy at liquor stores, nah
The real you is not defined by the size of your office
The real you is who you are when ain't nobody watchin'
You spend your whole life worried about what's in your wallet
For what? That money won't show up in your coffin, woo!
Yeah, anger's a liar, he ain't got no respect
I fell in love with my pain and I slept with my regrets
Happiness saw it happen, maybe that's why she up and left
Joy called me a cheater, said she ain't coming back
I've always had a problem with relationships
But that's what happens when you see the world through a broken lens
Mistakes can make you grow, that doesn't mean you're friends
Who you are is up to you, don't leave it up to them, no

Just remember this

Yeah, they say you got into music, you signed up to be hated
That's kinda weird cause I don't remember signing my name up
Coming from people that give advice but never take none
I like my privacy, but, lately, I feel it's invaded
I heard that life's too short, don't let it pass you by
We waste a lot of time crying over wasted time
It's not about what people think, it's how you feel inside
My biggest failures in life are knowing I never tried, woo!
I look at the world from a different angle
People change, even Satan used to be an angel
Think twice before you're bitin' on the hand that made you
Don't believe what you believe just 'cause that's how they raised you
Think your own thoughts, don't let them do it for you
Say you want a drink, don't wait for people to pour it on you
Cut out the liars, stay close to the people you know are loyal
Grab your own glass and fill it, don't let your fear destroy you, woo!

This week I had an interview via Zoom and the HR asked me "How would you feel positive/comfortable as an "apprenticeship person"?".

I asked them to repeat the question because it sounded weird and I thought it was maybe just my mind imagining things.

They said the same thing to which I asked why they ask me such a question thinking that this might be a new HR trap.

She (HR) felt that I was suspecting something and explained this is not a trap, but just to improve the company.

I don't think that's the case lol.

If I were to demand material things, it would not be in the company's favor.
+ how the hell am I supposed to know before even having worked with them for let's say a week?

That was strange

God damnit!!

Just got a team assigned for the course I follow and the codebase they work looks like someone shit on the floor and dragged it all over place. No consistency, no clear structure.

The project has to be built in PHP (which is fine by the way) following the principles of MVC. Did I say the codebase looks like shit all over the place? Well that's exactly what it is!!

They use $_SERVER['DOCUMENT_ROOT'] everywhere!! In every fucking file!! Why the FUCK would someone possibly want to do that??

I know I'm not perfect, but what the fuck!!

Now comes the most weird thing. They have to work on a remote server without SSH access, so working with FTP is mandatory. This is because the school won't setup ssh. That's fine by me, but because of that they don't use git!! They upload files directly to the production server. They merge everything manually. I asked why they didn't use git and the answer was so fucking SHIT!! "Because the teacher wants to see who uploaded to the server.."

First off all: what happened to git blame? Second: Later I heard that there is only one FTP account, so all the things they said where just bullshit!!

The fuck.

Tomorrow I'm going to try and convince them to use git..

This week was one of those weeks were it feels like it's never ending
Monday, delayed trains and the legacy project's new update went live

Tuesday, not a lot of work so I did some self study (best day of the week)

Wednesday, again train delay, and some funny little sh*t ripped the valve from my bike... I mean sure if you let the air out, haha little fun but completely removing the valve? That's just f'n low...

Thursday, the legacy project had a weird bug that I can't reproduce but has to be fixed before the end of this week...

Friday... To be continued... I hope it will be a quiet quick and easy day... 😟

I really hate PHP frameworks.

I also often write my own frameworks but propriety. I have two decades experience doing without frameworks, writing frameworks and using frameworks.

Virtually every PHP framework I've ever used has causes more headaches than if I had simply written the code.

Let me give you an example. I want a tinyint in my database.

> Unknown column type "tinyint" requested.

Oh, doctrine doesn't support it and wont fix. Doctrine is a library that takes a perfectly good feature rich powerful enough database system and nerfs it to the capabilities of mysql 1.0.0 for portability and because the devs don't actually have the time to create a full ORM library. Sadly it's also the defacto for certain filthy disgusting frameworks whose name I shan't speak.

So I add my own type class. Annoying but what can you do.

I have to try to use it and to do so I have to register it in two places like this (pseudo)...

Types::add(Tinyint::class);
Doctrine::add(Tinyint::class);

Seems simply enough so I run it and see...

> Type tinyint already exists.

So I assume it's doing some magic loading it based on the directory and commend out the Type::add line to see.

> Type to be overwritten tinyint does not exist.

Are you fucking kidding me?

At this point I figure out it must be running twice. It's booting twice. Do I get a stack trace by default from a CLI command? Of course not because who would ever need that?

I take a quick look at parent::boot(). HttpKernel is the standard for Cli Commands?

I notice it has state, uses a protected booted property but I'm curious why it tries to boot so many times. I assume it's user error.

After some fiddling around I get a stack trace but only one boot. How is it possible?

It's not user error, the program flow of the framework is just sub par and it just calls boot all over the place.

I use the state variable and I have to do it in a weird way...

> $booted = $this->booted;parent::boot();if (!$booted) {doStuffOnceThatDependsOnParentBootage();}

A bit awkward but not life and death. I could probably just return but believe or not the parent is doing some crap if already booted. A common ugly practice but one that works is to usually call doSomething and have something only work around the state.

The thing is, doctrine does use TINYINT for bool and it gets all super confused now running commands like updates. It keeps trying to push changes when nothing changed. I'm building my own schema differential system for another project and it doesn't have these problems out of the box. It's not clever enough to handle ambiguous reverse mappings when single types are defined and it should be possible to match the right one or heck both are fine in this case. I'd expect ambiguity to be a problem with reverse engineer, not compare schema to an exact schema.

This is numpty country. Changing TINYINT UNSIGNED to TINYINT UNSIGNED. IT can't even compare two before and after strings.

There's a few other boots I could use but who cares. The internet seems to want to use that boot function. There's also init stages missing. Believe it or not there's a shutdown and reboot for the kernel. It might not be obvious but the Type::add line wants to go not in the boot method but in the top level scope along with the class definition. The top level scope is run only once.

I think people using OOP frameworks forget that there's a scope outside of the object in PHP. It's not ideal but does the trick given the functionality is confined to static only. The register command appears to have it's own check and noop or simply overwrite if the command is issued twice making things more confusing as it was working with register type before to merely alias a type to an existing type so that it could detect it from SQL when reverse engineering.

I start to wonder if I should just use columnDefinition.

It's this. Constantly on a daily basis using these pretentious stuck up frameworks and libraries.

It's not just the palava which in this case is relatively mild compared to some of the headaches that arise. It's that if you use a framework you expect basic things out of the box like oh I don't know support for the byte/char/tinyint/int8 type and a differential command that's able to compare two strings to see if they're different.

Some people might say you're using it wrong. There is such a thing as a learning curve and this one goes down, learning all the things it can't do. It's cripplesauce.

I've been out of the loop with websites and frontends for a while. Now, is it me or is it just overengineered to make a static website that's not a blog these days?

I mean, I need to make a landing page. 6 sections + footer. And I don't want to end up with a 600+ lines html file. With tailwind possibly.

JEKYLL
I've used it a few times, and after 3 years I still get some weird error when installing everything. Maybe it's trivial, but I know shit about ruby. Plus, I don't need ruby for anything else, and the official Docker image just doesn't work, exactly like the quickstart tutorial. 3 years later, same issues.

HUGO
I like this guy but god, the docs are just unreadable, it's not compatible with tailwind 3.x (or smth) and it's been a pain to build a user-configurable homepage. Plus, it does more than half of the work by itself, Fair enough, it's supposed to be used for blogs.

ANY OTHER "JAMSTACK" BULLSHIT
Anything is either a blogging engine or delivers some crappy javascript blob from hell. I just need an html document, that weird thingie the whole World Wide Web was built upon, broken into pieces so I can keep my sanity.

Looking forward to get the fucking AWS Solutions Architect. Looking even more forward to build my farm.

Multi User, One Account, and other shit

I'm gonna rant about something as a user, and someone who makes stupid web stuff.

My bank has been updating their web banking over time and they decided that every individual on an account, should have their own login. They really want to push this on their users, I suspect specifically folks like me and my wife who share one login for the joint accounts we have at the bank together.

Why share one login, because it's the only sure fire way I know that I and my wife can see all the same shit no doubt about it.

The banks never tell you what you can see or can't with joint accounts, I doubt it is even documented on their end, but in every damn case something is hidden or different in some weird way.

Messages to the bank people? If I send it, my wife often can't. I get that for security reasons that's a thing, but it makes no sense for a joint account.

ANY difference to me breaks online banking ENTIRELY. Joint accounts are supposed to be... well one account that is the same.

Other banks we used where we had different logins for the joint account, each login actually had separate bill pay accounts per user. So if I went to bill pay and scheduled something to be paid, my wife had no idea, same if she did.

Right fucking there, banking is just broken entirely!

So no Mr. Bank, fuck you we're both logging in via the same login.

Fast forward to N00bPancakes making a thing.

So my employer has a customer (Direct Customer). Direct Customer wants a thing that makes communication with their customer (Indirect Customer) easier.

The worst thing about making something for your customer's customer is that Direct Customer always imagines that Indirect Customer is gonna be super ninja power users....

But no, that's not the case... in fact almost nobody is a power user, and absolutely nobody WANTS to be a power users.

Worse yet in my case the only reason this tool exists is because Direct Customer and Indirect Customer can't communicate well enough anyway... that should tell you something about the amount of effort Indirect Customer is willing to expend.

So with that tool, this situation constantly comes up:

Direct Customer thinks it would be great if every user from Indirect Company had some sort of custom messaging, views, and etc in of Cool Communication Tool. The reason is because that's what Direct Customer loves about Ultra Complex Primary Tool that they use ....

Then I have to fight the constant fight of:

NOBODY WANTS TO BE A POWER USER, NOBODY EVEN WANTS TO DO MUCH OF ANYTHING ON THE INTERNET THAT ISN'T SCREAMING AT OTHER PEOPLE OR POST MEMES OR WATCH SHITTY VIDEOS. THE MOMENT ANYONE AT INDIRECT COMPANY LOGS IN AND SEES ANY INFO THAT IS DIFFERENT FROM THEIR COWORKER THEY'LL SHIT THEMSELVES, FLOOD EVERYONE WITH 'OH GAWD SOME NON SPECIFIED THING IS WRONG' AND RESPOND TO EMAILS LIKE A JELLYFISH DROPPED OFF IN NEW MEXICO... AND NOTHING WILL GET DONE!!!

God damn it people.

Also side rant while I'm busy fighting the good fight to keep shit simple and etc:

People bitch about how horrible the modern web is and then bitch at web devs like we're rulers of the internet or something.... What really pisses me off about that is other devs who do that.... like bro, do you make policy at your company? You decide not to sell some info or whatever shit your company sells? Like fuck off with your 'man I miss html' because you got scared by some shitty JS error and ran back to your language of choice and just poked your head out of the the basement and got scared... and you shit on another developer about that? Fuck you.

It feels weird now. I don't really have much to rant about. That's partially cause I haven't been doing much dev work lately (but the bit I have done, everything's been fine). My personal life is going fucking great for once, so nothing to worry about there (the girl I'm talking to is so fucking sweet, and just amazing overall)

Life is fucking good guys. I hope everyone that might have had a bad day or a bad week or whatever feels better soon.

I am going to rant about this being the exam week, it being hot as hell, and us having had a messed up semester study-wise... And I still managed to do good-ish in subjects somehow... Good as in, relatively good. I am no 4.0 GPA person by any means and could never be one if I studied only (if that's even realistic at all). Recently I applied to a job at Andersen Lab for a Trainee position. Got turned down because I lack experience. A TRAINEE POSITION. I could retake the interview but I feel weird with how I got rated a whole level lower than my IELTS score and two levels lower than my score at Epam (which is the more recent one!) and the questions were mostly so easy I could answer while half asleep. Just yeah. Also, while I understand the whole knowledge required thing... I don't get the need for THREE whole interviews only to then proceed to turn me down. I am continuously applying and still seeing no results. If I'm "lucky", I guess, I will get training from a bank. And then get employed there... Mentally doing very bad right now, just barely wanting to MOVE. Which is basically me being this close to giving up. Today's exam is in Linux Security and I swear, this was such a waste of a good sounding subject... Imagine, I could have learnt how to set up a server at home and all that but instead we did... The more basic stuff in Linux. And for the whole semester outside of two or three cases I was the only one in attendance. Anyways, I have been feeling like I just can't program anymore and stuff... Even though we did a Python subject this semester. And in that subject I just felt like we were going way too quickly considering a lot of the students there come from non-IT or close to that background...

I may need to put effort into learning 3D Environmental art, I have this feeling I would like doing that as a job in game dev. Oh, and I also wanna design this house that I have in mind for me. It's shaped like an Amanita Muscaria and instead of the white dots it has windows that are round, as well as a spiral staircase connecting the lower and upper floors. Need to figure out how to model that in something like AutoCAD (I have a bit of experience with it and that's why I'd like to try there... But I may have to learn other programs to do it for free), but it will take me a long time to execute since I am not the most organised in how I learn...

Anyways, I will only sporadically be there, so I may not see things here. I am somewhat busy with exams and then this NGO I recently became a founding member of (and I have to say, I kinda don't wanna be there, but there are things that have to be done). Also filling the documents for a Canadian visitor's visa to go finally see the family over there and all that. But the latter will probably not happen until next year...

Finally, I am wishing you all a sound mental health and happiness. I hope you do well in whatever you are doing at the moment or are planning to. Until next time!

Why I chose computer science?
I simply played GTA vice city when I was a kid , and that's how I became a fan of cs!
SEEMS WEIRD I KNOW:/

"You broke the build"

o.O

Me checking the build.

Oh. There's a weird 500 from github.

Oh yeah:

Error 503 first byte timeout

on the package.json of some node dependency.

That's what you get for relying on the cloud.

I wanted to suggest a functionality (keyboard shortcut) to a website. I see that their feedback button was pretty visible, which is weird because most websites I've visited first take you through 3 layers of "have you googled your question first?" before they let you send a question or feedback. Alas, I fell into the trap. First they asked me for the typical intrusive demographic info, and then they asked me marketing questions, and then... that's it. They didn't let me submit any feedback. They just took my info and left. great

I'm sure this has been ranted about before because I can hardly be the only one.

Android development and the upgrade dance.
Things were worse in the bad old days of eclipse but it's not like they're peachy now, either. Android is one of many platforms I'm developing for - c++ back-end, running on lots of different platforms through a thin bit of platform specific glue.
That's all I care about - that this thin bit of glue just works. I want to write this stuff, forget about it and get on with solving what I feel are real problems, for me, in my code.
The trouble is, I'm never finished writing this and android is one of the worst. With every revision change, google changes *something*. New build system? Why not, you indie developers have *loads* of time and resources to waste on that, don't you? Some weird thing just stops working for no apparent reason? You guys love to drop whatever it was you were working on to figure out what the hell ' android.app.Instrumentation' does and why it can't talk to my main class any more, or why I even need it but nothing in that error message about what I might do to fix this arcane random error.
Google have all the resources in the world, I do not. Yet I have to dance for them, every time I upgrade.
Can you guys please funnel some of your practically infinite resources in to making this stuff 'just work'?

Why do I make everything so expensive. I'm not a hardcore enthusiast, but at the same time I wont settle for "mainstream" and so I do weird unique things that end up costing more than they should

My mech keyboards are all DIY, I've spent $150-200 on 3 different occasions for 3 different keyboards. I think I'm settling down, but boy that was rough on my wallet.

Now I'm working on a custom workstation build, but I can't just use any normal tower because I ain't no normie. I want it to be SFF/portable so I'm planning on spending $250 just on the shoebox case (DAN A4-SFX). That's probably the most expensive part, besides maybe the GPU. Current plan is R7 1700 or 2700 with 16GB, RX 580 8GB, and 1TB NVMe, around USD$1200 total maybe

why is it everybody wants to hire a head of a department all the time

like that's just super weird to me

wouldn't it make more sense to hire someone into a lower position, have them learn from head of a department, then get promoted because you know they'll head the department to your standards then?

but most posts want you to already be head of a department... and it's like, I don't know your department. what the hell happened to the last head of department? why do so many people need heads of department? why the hell are they choosing to get them from outside the company?

somehow none of this makes any sense to me
like I'm literally just so confused why people hire seniors and expect them to automatically know the way the company does things
it just literally doesn't make sense

promote your underlings? then hire more underlings to sus them out?
WHY ARE YOU HIRING SENIOR STAFF FROM OUTSIDE YOUR COMPANY, LITERALLY NOBODIES, AND GIVING THEM TONS OF AUTONOMY AND CONTROL OVER OTHERS IN YOUR COMPANY, THATS SO CONFUSING

worse yet I hear most people just lie when they apply so it's like... are you rotating irresponsible lying people through senior positions at your company over and over again, as they attrition your underlings and eventually get fired for incompetence?

WHAT IS THE STATE OF THIS ECOSYSTEM

Tldr: no router, almost not work.

Ok I recently moved into a new house, and I signed a contract for an Internet line.

Problem is that the router has been sent at the ISP shop, where I was supposed to get it personally. But guess what? Covid emergency happened two days after, and the shop closed.

So, after spending two days calling customer service of both ISP and Postal office without being able to speak to anybody, I received a Sms saying that the pack was not delivered because the receiver was closed.

After some more unsuccessful calls to the same two entities I managed to find the actual shop's phone number, that was actually thw owner's house (he's working from home). I spoke to him, told the problem, and he changed the router destination to my house.

Today I checked the package status on the postal website and I saw that it seems that they tried every day, at 7:02 am, to deliver the bloody package again at the shop! I truly hope this was a bug on their tracking system. It's weird that the hours were always 7:02am, because the package delivery office opens at 8:30 am, so again I'm praying any existent and non-existent god that that's just a bug. I'm kinda tired of being stuck with my phone hotspot with limited GB and with ISP public routers with about 5Mbps.

I wish I had @netikras skills with router building.

semi dev related(later half)
A common and random thought I have:

A lot of units that humans use are either needlessly arbitrary or based on something weird. Like Fahrenheit. That shit is weird! 0°F is the freezing point of a water and salt solution. What a weird fucking thing to use!

But also, I like Fahrenheit more. Probably because it's what I was raised with and switching is tedious (though I'm trying. I'd like to use metric more), but also because one degree F is a smaller, more precise change. You can describe more accuracy without decimals.

On the other hand I prefer metric for length. Centimeters, and centimeters are way more precise and way less confusing than inches and .... 1/8th inches? Who the fuck decided on 1/8ths?!

Which brings me to my common thought:

If you look at a Unix timestamp, you can approximate somewhat when it happened. Knowing the current timestamp and a few reference points you can see RELATIVELY what a epoch stamp translates to. A few days ago, an hr ago, 2014ish.

This leads me to think that if we actually taught from a young age to think in epoch as a unit (not as a replacement to normal date formats but as a secondary at first) that we could just naturally read epoch time in the same manner we read dates like "28/01/2006 14:24:10 UTC"

In your brain you automatically know how old you were when that timestamp happened. What grade/job and where you lived at the time. What season it was. You know how far into the day it was, a little before lunch (or after or whatever, your time zone will vary). Now try with 1138458250. I can usually get roughly the year, and month if I really think about it, but that's it. And it takes much more effort

I'm sure there's other units we could benefit from but epoch is the one that usually brings this to mind for me.