Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "not that hard"
-
Friend: Man you're a programmer why aren't you a billionaire already like the others??
Me: It's not that easy believe me.
Friend: I have a great idea for an app something like facebook...can be that hard?
Me: :/
Friend: you could do that instead of your no pay opensource shit...
Me: FUCK YOU AND YOUR STUPID BULLLLLSHIT GO FUCKING DIE YOU PIECE OF SHIT !!!! YOU HAVE NO FUCKING CLUE ..STUPID SON OF A BITCH.32 -
UPDATE: I have my dream job.
About a year ago I commented on Devrant that I was having some hard luck interviewing for development jobs.
Shortly after my post I decided to lower my expectations and took a job at a tech support call center.(3 month contract)
After getting a little experience(Not just a degree) I was able to land a hardware support job at a fortune 500 company.(Not what a programmer really wants 😂)
I worked hard and started writing tools at home to help with the job. I started giving them out to the other techs and put them on a little internal website for easy access.
About 3 months ago I just became a software engineer within the company.(after 6 months of hardware repair.) The main reason I got the job was because I showed them how much overtime and extra work I had done and that the techs relied on my software to do there jobs and that I was dependable.
It was hard work but it was worth it. And I built software that I never would have done if I hadn't taken this "lower job"
So keep your chin up and your fingers on the keys, I was in your shoes a year ago. 😉12 -
Cleaning lady just asked me what OS I use. "Well, Linux" I replied. Oh, she said, I'll ask my husband if he knows about it. He's also good with computers (probably tech support chap or something like that).
I figured that she might not remember the name "Linux", so I thought about writing it down. But it was so hard to resist the thought of instead writing down "btw I use Arch Linux"! 😆15 -
Guy: dot net dev (C#) on windows. (desktop + server)
Team(not his team, he just happened to sit next to us): php/frontend devs and Linux (server) people.
Team: starting a new project! We'll have to see what framework to use and what server :D
Guy: i know it's none of my business...... but I'd recommend dot net and windows server!
Me: respectfully, that hardly makes sense, you know our skillset/field... i understand that it works for you but it doesn't really for us :).
Next to that we'd rather not use windows for security reasons.
It's fine if that happens once.
When it happened for the 1748472823'th time, I had a real hard time controlling myself.10 -
*tries to convert a Windows drive into btrfs*
*copies the whole 1.4TB of data back from server*
Windows: Wait, you expect me to do more than browsing the Phasebuk and playing games? Over a million files?! No no no, can't do that.
*reboot after BSOD*
Ehm, a hard drive you say? A drive that I just fucked up? What are you talking about? I don't see any hard drive :/
Piece of shit.
Crappy Arch Linux laptop: ah, I see a new hard drive connected here. Limme mount it real quick for ya :3
Me: eh, not now. I want to format it first.
Linux: oh, cool! Your wish is my command <3
*formats hard drive to btrfs*
Me: alright, now please copy all that 1.4TB onto the drive and please don't overheat _/\_
Linux: Gotcha! On your commands sir!
See the difference? The mental communication level? Windows is like talking to an obnoxious grade schooler that just does whatever the fuck they want to. Linux on the other hand is so much more mature and capable. Guess which one I like the most.20 -
A lot of the people are complaining about working in inhumane conditions. I want to debunk some bullshit that I think is causing this.
Devs are hard to find. That makes you valuable. A good dev that actually works for 30-40 hours per week is extremely hard to find.
The relationship with your employer / client should be simple: you work, they pay. What you do NOT:
1. Do not take responsibility for other people's decisions
2. Do not internalize other people's problems (you've got your own, better stick to them)
3. Do not let ANYONE guilt trip you into anything that you're not indeed guilty of.
4. Do NOT work for an effective rate that's significantly lower than you know you can get elsewhere.
There are indeed some utterly evil assholes out there that will try to manipulate you, into thinking that you're "part of the project", or that "you're all a team". Yeah, you are, but when it comes to making money, you'll only get the salary, regardless of how successful your work will be. THEY have a motivation to stay up late, to work extra hours, etc. You DO NOT. If you do that, and don't get paid extra, you're working for free, which means that you're not a professional.
Are you a professional? Then have respect for yourself, and bill for every fucking second of your time. Don't let the assholes think they own you.
As a professional, you MUST do EXACTLY what you're paid to do. No more, no less. Well, if you're feeling good about it, then you can do slightly more. And anyone that's demanding more, basically has no respect for you, and doesn't consider you a professional. That is the plain truth. See it as it is, and handle those scumbags accordingly.5 -
WHY THE FUCK IS IT SO FUCKING HARD FOR THESE CUM SUCKERS TO UNDERSTAND THAT CHANGING REQUIREMENTS 2 DAYS BEFORE THE DEADLINE IS JUST GONNA BREAK EVERYTHING!?!?
I DOUBLE DARE ANYONE TO TELL ME ITS NOT WORKING TOMORROW...
STUPID MOTHER FUCKER PMS CANT PLAN ANYTHING6 -
Rekked/insulted a client so hard today in a way which was obvious for me/colleagues but not for the client that the colleague sitting next to me completely fucking lost it. (client did not detect/notice it)
That's entirely fine as he was not too loud but his laughter is so fucking contagious that he went outside to make sure that I wouldn't catch it any worse while on the phone.
God damn it took some serious self control to not completely lose my shit xD (it only partly worked 😅)18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
The best part of being a dev?
You can be a nerd, you can dress lousy, you got all those fancy tech you can work with, it's diverse, it's fun. And on top of that, it's not even remotely hard to find a job and get payed well.8 -
*pops open some Chinese USB Bluetooth dongle*
*finds a chip inside that seems to be a controller*
"Google, what's the datasheet for this thing?"
> Your search - 653uw1f1 - did not match any documents.
I'm doomed... 😟
Finding Easter eggs is hard you say? Try a datasheet 😑35 -
Anyone else notice this trend:
1. Don't go to uni / drop out (who needs education).
2. Get a job in IT, it pays well (who cares you don't have a structured logic).
3. Learn need-to-know stuff only (I only need to know my code).
4. Tell others they should get into programming, it's not that hard.
5. Get asked about the workings of a computer, but that's not in your domain of work. "I only code".
Millennial much ?13 -
It was only a while ago that I realized that “firm” was not quite “hard”, but also not “soft”, hence “firmware”, it's in between hardware and software.27
-
Long rant ahead.
Holy shit is this hard.
I'm not a dev, but I'm working really hard to become one. I come home from work every day at 7:00pm and study between 3 and 5 hours of coding, and finally I'm starting to make decent responsive web pages. I got excited, finally the studies are paying off and I guess I got carried away and told a "friend" about it.
"What?, But making web pages its fucking easy anybody can do web pages! I did mine with dreamwiever, is that even considered development"
And there goes my self steem holy shit..I know, I know its not development, Im not a programmer neither do I pretend to be one but holy shit.
I guess I wish some people would anderstand the amount of effort that can go into an app or web..21 -
PM: Please get this done by tomorrow. It's just a small change.
Dev: No its not that simple.
PM: Why is it not simple? Please explain so I can understand.
Dev after a hard thought finally explains: blah blah blah
PM: Well, we have promised the client so please do this by tomorrow, thanks.
Dev: *bangwall9 -
Not sure if this would be true since I find it very hard to judge this one myself but I hope that some people on here see me as some kind of mentorish person when it comes to either Linux, privacy of security.
Parenthesis on "hope"😅20 -
Dear backend dev:
No data is not an error for fuck sake. Don't want 404, or messages if the search criteria filters out all values. Give me a empty array.
Is this hard to understand that we need a team meeting to discuss?
Godamit12 -
"Updates were installed successfully"
No Windows, you got stuck at 83% and I had to hard reset you, we tried again and you got stuck at 91% so I had to hard reset you again... That is not what I call "successful" updates...5 -
Spoke to a programmering student who insists on writing his Java and python code in PARAGRAPH format, like an essay (the teachers do not teach this). Tried to explain why this is a bad idea. He explains to me that if others can't read his code that it is their problem and that he would never make a silly syntax error like missing a semicolon or a bracket. Called me stupid and walked off.
Life will be hard for him.10 -
No boss... For the fucking millionth time: unit tests are not a waste of time.
You keep testing everything manually and hoping that you tested everything every time and praying that there are no bugs IS THE FUCKING TIME WASTE
My boss just can't fucking wrap his head around automated tests... I'm trying hard... Gonna try harder...6 -
You're a flippin bank, and your public website has an invalid cert!? WTF. No, I'm done, and I don't trust you with my money either.10
-
C is not that hard:
void (* (* f[ ]) () ) () declares f to be array of unspecified size, of pointers to functions, which return pointers to functions which return void.
By the way, I am uncomfortable with the fact that I am comfortable with this statement.6 -
Me: Taking online course for programming. Think it's not that hard.
PC: Coded programm runs good like in the tutorial.
Me: Wow I can code now.
Just printed "Hello World"4 -
"To use the clock you need Adobe Flash"
Really 1&1? You really need flash to show a fucking clock? Its not that hard to do this in javascript, or? Even if it is an analog clock :D There is even a tutorial of the "quality content page" w3schools about implementing this in javascript ... just whyyyyyyy? it 2018, not 2004.
(1&1 is an german ISP. This message occured in their webmailer using it without flash.)6 -
Being different is not a crime, and people who tell you it is are jealous that you've picked up a skill they never in their wildest dreams could acquire.
You can code. They cannot. That is pretty damn cool.
-learn python the hard way3 -
Mom: "What's this thing?" *hands me her phone*
Me: *sees dialog saying something about com.google.gms or so draining battery with obvious okay button*
Me: "...just press Okay."5 -
The keycap of the control key of my keyboard just popped of and fell under the table.
My colleague then said while I was looking for it: I think you've lost control!
And we both laughed way to hard and so loud that our boss came over to ask why we where laughing. xD
it's not even that funny but we couldn't pull ourselfs together xD5 -
Most painful dev learning experience?
Learned that no matter hard you work, no matter how big the dragon you slain/slew, there are individuals out there waiting to tear you down. Not immediately, certainly not in front of you, and capable of going to extremes just to make themselves feel/look better.7 -
Finally graduated only to realize that my degree did not provide hard skills, only outdated practices and student loans.2
-
// LEARN TO READ, FOR FUCKS SAKE
I've been working with a teacher developing a web application for some business that rents stuff.
Long story short, he's so damn incompetent! I mean, for fucks sake, he sent me this picture asking me "what to do"... dude, just fucking read, it says that the VM will capture input and to escape just press right control!!!
I can't believe this guy is a CompSci Engineer...15 -
TLDR; My 2TB HDD got wiped in one fell swoop by a 9-year old child.
You know... I've never been too great about keeping backups. Even to this day, I only keep one or two local backups and nothing on the "cloud".
So this was about 5 years ago. At the time, I was living together with my girlfriend - who would later become my wife. She had a son from a previous relationship, who at the time was 9 years old.
I had a small desk in the living room of our one-bedroom apartment, that I used for my computer, which has been a laptop for a long time now. One unfortunate thing about the layout of the apartment was that the wall plug near my desk was attached to a light switch.
I had a 2TB external hard drive - with its own power cable - plugged into my laptop. Then, things started to move in slow motion... The GF's son comes inside from playing, my GF asks him to turn off the light. He reaches over, and shuts off power to my laptop - and the external hard drive.
He must have hit that switch at JUST the right fucking time. The laptop ran on battery, no big deal. The hard drive, when I powered it back up - was wiped clean. I tried data recovery on it, but the HDD was encrypted, which makes things more complicated.
Needless to say, I was not happy. I never got that data back, but I did learn not to expose my hard drives to 9 year olds. Very dangerous little creatures.
You want to know the best part? He destroyed another hard drive of mine, a few years later. Should I tell that story?5 -
nVidia, fuck you
Just fuck you!
FUCK YOU!!
WHY CAN’T YOU JUST DO LIKE ALL THE OTHER MANUFACTURERS!!
WHY CAN’T YOU JUST PUBLISH OPEN SOURCE DRIVERS THAT WORK WITH MODERN TECHNOLOGICAL STANDARDS AND NOT YOUR OWN PROPRIETARY LITTLE PIECE OF SHIT SOLUTION!!!
ALL OTHER MANUFACTURERS HAVE OPEN SOURCE DRIVERS, AND SOME ARE EVEN MAINLINED IN THE KERNEL!!!
I JUST WANT WAYLAND TO WORK!! FUCK YOU
I’M BUYING AN AMD!!!
https://reddit.com/r/...
https://drewdevault.com/2017/10/...16 -
not really a rant, but but i am intrigued...
got an email that my rockstar account (gta) email was changed.
changed the email and password and noticed that all the details were changed (nickname, date of birth etc) and the guy even posted on support asking to remove steam link (probably could not login). But rockstar requires a screenshot of user logged in to steam (as if that is hard to fabricate...), so he gave up :D
i'm not even mad, i'm wondering what's the guy's story. Probly bought a stolen account for cheap, hoping to play :(
Maybe i should just let him play the game, since i'm not... -
Why its so hard to understand that - not always... - frontend devs will give you a sweet ui with medium back end and back end devs are gonna give you a medium ui with sweet back end?
Why can't we just do what nature made us good for and work in collaboration?
Fuck7 -
You know what is at least equally hard as naming variables?
Finding fitting icons to button actions!
With some icons you rather confuse your users compared to using no icon at all.
Others may fit the button text but not the context in your use case.
And there are so many icon sets out there that you need to search for something and hope that you stumble upon a good one.5 -
I just wrote this piece of code. Without googling. Call me regex king!
But in fact regex is not that hard, you just have to learn the syntax 😄28 -
Yesterday I completed a transactions module that used an external payment processor, similar to PayPal. It was hard, but after few hours of trying out different options I finally managed to get it to work.
I decided to create a simple prototype UI without any styling just to show my progress to the manager and let him know that it's working.
His response? "yeah, that seems to work, but that UI is terrible and not appealing at all. Change that immediately and try to add more thought into your design"
I guess I won't be making prototypes any time soon6 -
Tripped over the LAN cable in my corridor, almost fell. Went to bed only to notice that I left my phone on my desk. Phone is my alarm clock atm, so stood up to get it. Went well until tripping over that damn cable again. Stubbed my toe hard on the bedframe, still cursing now.
I regret deeply not just configuring the Wifi. D:7 -
Internship Update:
I am slowly breaking down.
I have to endure all of that stress.
Both physically and psychically.
I keep cutting myself without wanting it.
I am not attempting suicide lol.
I applied as an IT person.
What I am doing has almost barely to do with IT tho.
I am most of the time busy carrying heavy stuff like refrigerators, placing new washing machines, setting TVs by building them and putting them on the shelves. The shelves are hard to reach. At the same height as my head.
Fuck that shit already. I am not going to miss that place.40 -
Yes, it is dumb that airports, stores, and hospitals run very outdated software, but imagine how hard it would be to upgrade all those machines, especially considering the programs that might not work well with never operating systems and the fact that staff would have to be trained all over again. Not to mention, most of these businesses and services can't afford any downtime and need to make sure that everything is compatible (so, update one PC, you have to update all of them). In theory, I am still a fan of updated systems, but then again, I have a 10 year old XP installation at home, which I've been preparing to reinstall for a year or so (don't really use that PC, but still)7
-
Sad. Got a new job. Apparently, readable code is not a priority. My suggestions were being ignored. Does the benefits of condensing an if-else to a simple one-line return statement really that hard to understand? Does making clean and readable code should be an optional thing to consider? It doesn't help that I'm the youngest, they felt like I don't have enough street cred. I'm starting to hate my job.11
-
Fuck I wish designers learnt colour theory before presenting me with a light colour to go on a white background. Like fuck? It’s not even grey at least.
And the complimentary colours are so shit I think I’ll go throw up after an Indian dinner and colour pick from that mess instead. (I like Indian food ok...)
How hard is it to go, NOPE that’s a shit colour we probably shouldn’t use that????4 -
My Razer laptop died due to a hard drive failure so i filed an RMA. They didn't have the replacement part in stock, so they're replacing the laptop all together. Mine is a 2019 model with a 2060, but the current equivalent model has a RTX 3070, so I'll get that instead. I'm not complaining 😏9
-
I’m sick of these kinds of error messages. “Could not be downloaded at this time.” Ok...but why? Are the stars out of alignment? Did the CEO of the company decide that every other Tuesday at noon, you can’t download this app?
How hard is it to give a reason in the error message??3 -
Hey Google, maybe I'd subscribe to YouTube Premium if you weren't throwing midroll ads into my tutorials every 3:45.
It's stupid, because they're trying so hard to annoy me into subscribing that they've done the opposite and annoyed me into NOT subscribing. I'd have considered it before, but ever since their recent changes it's so frickin' annoying that I refuse to subscribe just on principle because I won't financially support those pieces of trash anymore than absolutely necessary.18 -
OH MY FUCKING GOD!!!!
HOW CAN SOMEONE BE A FREELANCER/WEB DEV AND TYPE SO FUCKING SLOW AND HAVE TROUBLE WITH FUCKING LETTERS ALL THE TIME?!
I'm gonna push this mother fucker so hard that he will learn not to "lie" in an interview never again and become a fucking dev.5 -
So... Been making a script so that my tmux layout on my tty only hard drive displays the weather.
Apparently there is a place called 'Shit' in the world, and there's some 'Patchy rain possible' in 'Shit'.
'Shit' also seems to be 15 °C, and have 3km/h winds. Not sure which direction, but I hope nowhere near my house.5 -
My boss sucks really hard at English... I would not have a problem with it if he didn't insist on naming methods and variables with a non-sense English that he thinks is right...7
-
family: oh cmon, how hard it can be
me: what do you mean
family: youre just sitting in front of that pc all day
me: yeah, thats how we ...
family: youre not working! youre sitting in one place the whole day2 -
"adding that feature is not hard, the devs are just lazy"... or maybe... just maybe development is more complicated than you make it out to be when you vomit your middle management all over it?
-
Recent experience (#2)
- a cousin wanted to reinstall Windows on his laptop
- gave it to a tech shop
- they couldn't, said hard disk faulty
- I took the laptop hoping that it's just a partition table issue
- I tried changing partition table from MBR to GPT, but failed
- removed his hard disk from his laptop and plugged into mine
- tried and failed
- so I thought I would give it a chance with Ubuntu
- tried and ... 👍
- reinstalled his hard disk in his laptop
- works like a charm
- want to see what complaints he comes up with
- he is not a tech guy
- let's see how he manages to use it for his daily tasks20 -
I was not having much respect for out front-end developer, as the UI is not so good., yea. I know it UI depends on the designer.
Now the new design changed and our UI looks awesome.,
and I must say that my respect increased a lot when my pm asked him to fix the layout in UC Browser.
Fucking shit., in UC it is showing two lanes as one lane. I don't know why., he was working hard to fix that.
Massive Respect to him. I really happy by being backend dev.8 -
Dear web developers, whenever there is more than ONE LINE OF TEXT make sure the line-height is 1.4em.10
-
When you work hard for something and you are sure that you gonna get it, but some ass licking guy who doesn't even know how to code gets it. Yes, it happened to me. I was working for an open source organization called PROBOT. I was working my ass off to get into GSoC with that organization. I created PR(pull request) after PR and solved most of their issues. But later on, I came to know they didn't even saw my single PR. Life surely teaches you some hard lessons but it's you who should not give up I would say. I do not regret working my ass off and writing those code and not getting into GSoC but I cherish those moments where I learnt many new things. And as for that organization, I would say they don't even know how to manage. This was my exact reaction when the result came3
-
Have I ever told you guys of the time that I had made my PM feel bad by saying I had to drop 3 classes because he was working me so hard?
Yeah that happened and he felt really bad about it!
GOOD! FUCKING GOOD! I want you to feel bad about it! Don't you dare say that I'm not putting in enough work ever again!1 -
I starting to think, that I may actually be addicted to learning 😅 sound completely stupid, but I'm kinda stressed lately, so I wanted to take a day off, and not do anything.
But my mind kept being like "how does this work, how does that work, how do they fit together". I've never really tried before, to not research something, when I wanted to know how it worked, but Damn it's actually been hard not to...7 -
It's the 21st century. We have this amazing thing called the Internet. It's literally at our finger tips. Any information you want can be found with the tap of a phone screen, and the information will be presented to you in less than a second.
Why is this concept so fucking hard for people to comprehend? Instead of asking me "How do I write a resignation letter?", search the damn internet for resignation letter guides. Like Jesus Christ, it's not that hard of a concept to comprehend. Especially when you've basically grown up with the internet in our lives. -
People with "I am a senior, only I have to be right" mindset are really fustrating to work it.
It is not that hard to accept the truth. No one can be right all the time and no one gonna look down on you for that. You don't have to shove off-topic stuffs down the other people's throat when you realize you might be wrong.4 -
So this happened today.
Trying hard not to judge :/
Later the person also said and I quote:
"It is a markup language or what? We had PHP for that."9 -
App crashed during a live demo. Hard not to feel bad especially since it's friday and i have to go into the weekend with that thought. Am i overreacting?6
-
A Gentoo installation might be fun, but it sure as hell isn't worth it, both in time and effort. Broken audio, broken video, broken stability. A broken kernel that doesn't recognize the hard drive or the network interface. And half a week to compile the fucking thing and it's still not done. This is not the right distribution for me.2
-
Discovered yesterday that my boss does tests with production database... and I'm responsible for the fucking backups and he doesn't even care to let me now when so I can at least schedule one at slave. Come on... it's not that hard to let others know or test on your own machine...1
-
I now know why I'm a developer and not a designer, it's so fucking hard like it's goddamn bootstrap that shit is basically built for me but it still looks like an egg took a shit on a toaster
-
Qin Chen, a 38 year old facebook employee, recently committed suicide and facebook is trying really hard to hide this.
Apparently he was too stressed out at work and was trying hard to steer things his way, he almost succeeded, but then his manager backstabbed him and left him helpless.
Instead of promoting a better work culture and taking steps against such malpractices at workplace, facebook is trying to hide this incident.
Facebook has to realize that them behaving this way not only insults the departed and his family, but also raises a question that is the life of any of their current employees of any value to facebook, or do they just look at them like workforce and not humans?
Let us not be silent. It was Chen yesterday, it could be any one of us tomorrow.28 -
Fact, that I am making websites does NOT mean, that I will make a website for you for free. Why it is so hard for people to understand?2
-
Ok, im officially at the point where I can say this and I don’t say it lightly.. I’m really unhappy..
It’s hard for me to be happy anyway but being unhappy is not the same as not being happy IMO..
I’m so angry, especially at the western governments but also at the western society for making everything down that we’ve built over hundreds of years..
I’m socially pretty conservative I’d say. I have my values and manners which are very important to me. I try to be kind, diplomatically correct, hard working and honest but people sh!t all over that. Almost on a daily basis people tell me to “just lie”, it’ll solve the problem or to blame someone else.
What happened to work for what you want? And to “Be honest and loyal and it will pay off”? It’s more like the opposite nowadays..
Lie to everyone you can, cheat your way through every conflict and try as hard as you can to be a victim and all will work out…?
My boss had an interview ihr a grad student and she caught him googling stuff, trying to hide it. I told her to not even consider him but she thought he “deserves” another chance..
someone who applies and lies “deserves”??? You don’t DESERVE anything, you EARN it.. if you can’t earn it then sorry but this job is probably not for you.. not to mention that this guys CV was full of crap..
I just wanna find a woman, buy a farm an go off grid for a couple of years 😅 oh wait.. that’s legally not possible in pretty much any European country.11 -
FUCKING WINDOWS DECIDES TO UPDATE WHEN I HAVE 6 PROGRAMS OPEN AND NOT EVEN SAVED EVERYTHING.
10+ chrome tabs with research pages that are irrecoverable.
That when I leave for a couple of minutes to take a brake. I'm not even notified beforehand.
I'm fine tho which is nice. Gonna cry and sleep now to work hard again tomorrow.10 -
I hate backendphobia! It feels like so common nowadays. People scare other people with backend being too hard and stuff, and that feeling of scariness is something that infects lot of people. Please stop fearing the backend!
Yes, some backend stuff can be hard, but there's no good reason to fear it. I just hate it when I go to a new team and they all seem to be backendphobics idiots. I've build enough backends to not give in to the fear, pls stop scaring people.11 -
Why the hell do I have to keep showing everyone on my team how to use git. Learn it God dammit!!! Is not that hard. How come you freak out on a simple conflict? Why don't you delete your fucking merged branches?5
-
After noticing 4 operations in a single line, I comment a pr stating the line is not simple to read as there are many operations which can be, especially in the eyes of a junior, hard to read.
I proceed to suggest a better solution.
Colleague: “what??? How is this not readable??? Is it [op1], [op2], [op3] or [op4]? 🤷♂️”
I kindly explain this person that it’s not about the single operations, but the fact they are all on a line. Inside an object assignment.
Colleague: “you should learn stuff! (4 links to websites giving that snippet of code”
Ah yes, the oldie: “but other people are jumping off a cliff, why don’t WE do it???”5 -
Making an MVP is hard as hell. It's not even coding that makes it hard, it's knowing when to stop that's so damn difficult. By the time you're ready with something, your brain says "Hey...wouldnt it be great if you added this!" Then you add it, "whoa add this too!"...several days later:
Brain: "The fuck is this, all you needed was that"
😭😭😭7 -
(semi-rant)
The new MacBook Pro's front is NOT metal. It's made out of some plastic despite looking like brush metal.
I learnt this the hard way when i accidentally ran my keys across it and gave it a nasty scratch.
Every time i see it, i feel an irritable itch that i can't scratch.
Luckily, i have the perfect bandage.24 -
I see this in code:
bool status;
status = true;
It makes me want to hit things. INLINE THAT SHIT! bool status = true; It's not hard. JFC. And of course I don't have the authority to change it.3 -
Fuck, I only need to hire ONE fullstack developer who fucking knows what he's talking about and not trying to weasel their way into this job. I tell them that there are no annoying managers, no KPI, no bullshit, I thought this is kinda valuable, but no
How hard can it be?25 -
I feel like we developers (and people who create things in general) are doomed to not have enough time 😥
I have to be honest, I've got a hard time dealing with that -
Tbh my current job is as close to perfect as I can imagine ever existing. The best and smartest engineers I've ever met (better than Google, better than anywhere), all working on something we think is really really important (autonomous cars), and solving hard problems every day (some of which no one else has ever solved before).
Only downside is an internal sense that when I'm not working I'm delaying a product that will save people's lives.4 -
Last day of internship:
"You will not become a developer, at best you will be a code writter".
That struck hard at the time.5 -
Company Motto: “Business is simple, hire amazing people and let then do their thing”
Company Culture: You can’t do that!! It’s really hard and expensive to hire people with those skills! How would we replace you or save money by continuing to not give you a raise if you did that!?1 -
god i despise these "javascript is bad" articles. everyone seems to be jumping onto that train ever since the WAT talk.
javascript is a *weakly* typed language with implicit type conversions, that's why `{} + []` gives you `0`.
it is not easy to be the most widely used language, and to maintain compatibility across varying platforms.
please think twice before dismissing hard work.
/rant34 -
from time to time i find it hard to organize my personal life. it appears that i forget stuff that does not seem important to me or just not interested in.
apart from my full time job i own a small business and try to maintain a more or less social life (as social as i can get with my dev background).
can you recommend any tools that you use to keep everything in line?12 -
I really despise solving competitive programming problems.
I truly believe it's okay to struggle with them and that people have different abilities. But these kind of problems are an easy way to make you hate yourself and think of yourself less.
I can't solve this problem --> I'm not a good programmer --> I'm not smart enough --> I'm not good enough like my peers who work at FA*G companies, ...
I know these interview problems are a filter and that recruiting is hard and the demand is always high and that they are nothing like the real work but, the reality is, you need to prepare if you want to get into one of the big companies with better perks and maybe better projects.3 -
A friend approached me with an "unpopular opinion" regarding the worldwide famous intro to Machine Learning course by Andre Ng.
His opinion: "shit is boring AF and so is the teacher"
Honestly, I loved it, i think it is a really good intro to the actual intuition(pun/reference intended) to the area. I specially like how it cuts down the herd in terms of the people that stick with it and the people that don't, as in "math is too hard. All i want is to create A.I" <---- bye Felicia.
Even then, i think that the idea that Andrew Ng is boring is not too far from reality. I love math, i am by no means a natural, but with pen and paper in front of me and google I feel like i can figure out and remember anything, i do it out of sheer obsession and a knack for mathematical challenges. That is what kept me sane through the course. Other than that I find it hard to disagree, even if it was not boring for me.
Anyone here thinks the course was fucking boring as well? As in, the ones that have taken it.8 -
Just switched to Kotlin.. For the first like 10 minutes I was like "What is this shit?!" and then I found Java to Kotlin converter and docs. Yay! Looks like it´s not gonna be that hard to do some apps in it.. Hopefully4
-
Learning [framework of your choice] wouldn’t be that hard if the internet were not full of (unnecessarily long) articles, tutorials and answers written with the only purpose of gaining visibility instead of informing the reader.
-
When I point out something you did wrong. I do not care about the things you did right in the past year.
You did something wrong and that needs to be fixed. I do not care about how hard you tried, I just need it to be right. I'm not attacking you as a person I'm complaining about the end result being not good enough.10 -
Work for a large DoD contractor, tons of development projects.
They just sent an email stating that all unmanaged VM’s must be removed!
Hard enough not having admin rights but no vm’s?
ahhahahahahahahhaahhahahahhabahahahahhahahahahahahhahahahahahahanannaannanaaanannananannananannannananan4 -
Hey Spectrum! It'd be pretty wicked if you could email me or shoot me a text the next time you decide to do maintenance that will result in service outages!
It's not that hard to shoot a text that says "Hey Stuxnet! We gonna be doing some maintenance, so ya internet's probably gonna be down for a bit. We'll get that shit up and running asap tho my man."2 -
Jumping back and revisiting some basics of game development that I've ignored for a while and decided to follow a tutorial for building a 2D minecraft clone just to see how easy it is to incorporate some of my engines capabilities...
Every single fucking function he is creating does not have arguments and instead uses hard coded numbers repeated throughout... Fucking send help7 -
Clojure developers: why has our awesome language not taken the world by storm? how do we get new developers interested in Clojure and Lisp! its not as hard as people make it out to be!!
Also Clojure developers: Yeh so we know you are all probably not used to an editor like emacs *crowd looks in confusion*....BUT YOU NEED TO DOWNLOAD EMACS, INSTALL ALL THESE PLUGINS, MAKE SURE THAT THIS SHIT CALLED CIDER WORKS AND LEARN ALL OF THSE CTRL+<Fuck-Mx-You> COMBINATIONS!!
As someone that has been in the community for so long...I can't with the mentality of some of these people, and it scares me because I fear for Clojure disappearing.17 -
A girl I know is a Economics major with a minor in CS. Today she told me and a friend how hard their Java course is. I asked her about the topics that get covered in that course and when I asked her about JavaFX.
"No we will not cover JavaFX, only Java an GUI programmig in it. "
Today I learned that JavaFX is not a part of Java :D2 -
At first my dad was against it, I'm studying electronics engineering and he didn't want me to code because he is a software developer and he know that in my country it's really hard to make a living out of it. But since he realized that there is not much he can do about it he became really supportive and always review my code to help me improve it.2
-
just need to say this: It's GNU/Linux folks. I know, I know, it's not as easy to say when you want to talk about it, but every once in a while give the damn GNU a little credit. Without it we might not have Linux as we know it, so show some love from time to time, it's not that hard to say GNU/Linux.12
-
What the fuck is so hard about vim? Press i for insert mode, esc for visual mode. How is that so hard to remember? There's like 2 commands at most that you need to know18
-
I don't get all the "Can't exit vim" jokes.
IT'S NOT THAT HARD!
Its (esc) : wq to save and exit
And
(esc) : q! to exit without saving.
Just read vimtutor.
Gosh10 -
So I told my partner in not buying a Mac and that in buying a base model pixelbook instead, showed her the pricing and she nearly strangled me...
Why is it so hard to be a Google fan and have to import litteraly everything with an extra 400 AUD tacked on -,-12 -
I fucking give up. Typescript is not meant for complex projects. It's meant for simple projects that are big. There's no way forwards, no matter how much I try to simplify my types I simply can not get the typescript server to stop lagging out the moment I do anything complex. It can't fucking do it, it just can't. And that sucks really, really hard.
I'm so tired of finding the ceiling on everything. I had a bad smell for typescript when it came out... and I never should have expected any more than this.14 -
Why is it so hard for people (especially managers) to learn to work smarter not harder....
FIX THE GODDAMN PROBLEM CORRECTLY... THE FIRST TIME SO WE DON'T HAVE TO KEEP FIXING ITS BLOWUPS ON WEEKENDS....
AND STOP HIRING MONKEYS THAT JUST KNOW TO PRESS BUTTONS RATHER THAN DESIGNING FULLY FUNCTIONAL SOLUTIONS THAT DON'T BLOW UP OR LEAVE A TRAIL OF SHIT BEHIND THAT I NEED TO DECIPHER N CLEANUP....2 -
Not only dev related but remember to constantly backup your important info of your Hard disk constantly... specially if those disk have not only the lastest code you are have been working on but photos of you and high school friends back in the day when the original Iphone was just released that you havent properly printed yet.
I think that is one of the nearest thing I can think of that I regret lately aside from simple being "my life" in itself1 -
Dear developers, I know it's hard but try to understand that devRant is not your product. So let's just stop the feature requests and keep ranting.4
-
Do not use a "debugger".
A debugger is like doing a full-body scan of a sick person. You do not get any specific useful information, and you find a whole lot of information that doesn't help and is just confusing.
Source: Learn Python The Hard Way
Your thought on it?7 -
Why is the internet such a toxic place... You voice your personal opinion and instantly have people who believe they are 'better' than you call you a stupid consumer because they use something that others may not care for.
Fuck me people, why can't we just have opinions and respect each other, it's not that fucking hard!7 -
A few days after the vacation, daddy (me) finally finished copying all the photos from the digital camera to the big external hard drive. Left it lying in the living room, in the corner where all the tech stuff frequently lies. In come my boys, and I'm not sure why, they start plugging power supplies around. Unfortunately the one from the laptop fit into the hole on the external disk, but had a different (higher) voltage. Result: 1 fried hard drive, containing all the baby photos and videos of said boys up that time.
I still believe that it's only the circuit board that is fried, and the data is still all there. I still have the hope to find a used disk, replace the board and all will be back.5 -
We code hard in these cubicles
My style’s nerd-chic, I’m a programmin’ freak
We code hard in these cubicles
Only two hours to your deadline?
Don’t sweat my technique.
Sippin’ morning coffee with that JAVA swirl.
Born to code; my first words were “Hello World”
Since 95, been JAVA codin’ stayin’ proud
Started on floppy disks, now we take it to the cloud.
On my desktop, JAVA’s what’s bobbin’ and weavin’
We got another winning app before I get to OddEven.
Blazin’ code like a forest fire, climbin’ a tree
Setting standards like I Triple E….
Boot it on up, I use the force like Luke,
Got so much love for my homeboy Duke.
GNU Public Licensed, it’s open source,
Stop by my desk when you need a crash course
Written once and my script runs anywhere,
Straight thuggin’, mean muggin’ in my Aeron chair.
All the best lines of code, you know I wrote ‘em
I’ll run you out of town on your dial-up modem.
Cause…
We code hard in these cubicles
Me and my crew code hyphy hardcore
We code hard in these cubicles
It’s been more than 10 years since I’ve seen the 404.
Inheriting a project can make me go beeee-serk
Ain’t got four hours to transfer their Framework.
The cleaners killed the lights, Man, that ain’t nice,
Gonna knock this program out, just like Kimbo Slice
I program all night, just like a champ,
Look alive under this IKEA lamp.
I code HARDER in the midnight hour,
E7 on the vending machine fuels my power.
Ps3 to Smartphones, our code use never ends,
JAVA’s there when I beat you in “Words with Friends”.
My developing skills are so fresh please discuss,
You better step your game up on that C++.
We know better than to use Dot N-E-T,
Even Dan Brown can’t code as hard as me.
You know JAVA’s gettin’ bigger, that’s a promise not a threat,
Let me code it on your brain
We code hard in these cubicles,
it’s the core component…of what we implement.
We code hard in these cubicles,
Straight to your JAVA Runtime Environment.
We code hard in these cubicles,
Keep the syntax light and the algorithm tight.
We code hard in these cubicles,
Gotta use JAVA if it’s gonna run right.
We code hard in these cubicles
JAVA keeps adapting, you know it’s built to last.
We code hard in these cubicles,
Robust and secure, so our swag’s on blast
CODE HARD10 -
I have used Mac since 2011 and I have made statements about how Windows PCs sucks.
I had to buy a Windows-laptop for engineering school and I have experienced problem after problem after problem.
It took about a month to get the right computer (I ordered online and they missed to add an extra hard drive).
I had to return the second one after 10 days because it was not able to boot.
The third one I had to send to HPs repair place in Poland for a week, because the “X”-button” did not work properly.
I have not used the computer for a couple of weeks and now I was going to create an Android Studio-project and found out that the extra hard drive is missing! (Not physically missing, it does not show up)
When I bought the computer I had to portion the disk, but this time it is not showing up in that tool either...17 -
MarSecOps: "Marketing Security Operations, the idea is that security is not just the realm of website developers or the IT department anymore, but rather the marketing department has an equal if not greater interest in, and even responsibility to security."
Source: https://strattic.com/5-predictions-...
WHAT THE FUCKING FUCK? The marketing dimwits responsible for security? Whose IT competence ends at Powerpoint drivel?!
I LOLed so hard that I could have shat a cactus!8 -
I can't believe how hard public transport is designed for cucks in the Netherlands. I've just paid 28,- euro for a retour to next city. Do you have any idea how much you could drive for that? Fuckers. Public transport is really not a solution in NL. Fuck, I'm mad.11
-
"But using XYX is better and it's not hard to set up!"
No, fuck you and your recommendations.
It's too time consuming to set up that blazing-fast minimalistic modular shit, because I know I'll want to configure it to perfection until I bang my head against my tiny keyboard when I have finally realised that all the config I went througu only achieved the same outcome as the 'bloated' software I was originally using.
So, fuck you.
I'd rather get on with my life and get some work done.
It's not like I wasn't aware of XYZ in the first place; I'm not using it because I know what's more important to get my shit done.2 -
I don't know why, but in DevRant's weekly rant, I always find a word that I cannot understand. Even google translate is not that helpful in those cases. for this rant, the word is "Procrastination" :-/
Why some English words have to be so terrifyingly hard? These words always make me stay away from writing for the weekly rants :-/18 -
Why doesn't JSON allow trailing commas? Why? How hard is that to implement? Everyone else has them, why not JSON?33
-
Something I wrote in my "how not to run a company" notebook:
Getting told you've now replaced the CTO as the person people ask for support (literally, he was recieving no questions), but you're not experienced enough to be promoted to senior.
I replied by telling them I was interviewing elsewhere.
Made me laugh. Is it really that hard for management to get that they should invest in talent?5 -
It's hard to teach git to a beginner! There's just so many bits of info that you have to know before it clicks into place. Not to mention git's "reuse" of certain commands with files and refs.7
-
So it's not just through reading your own code later that you can realize how stupid you are. All the great card house of the belief in your own superiority collapsing instantly.
Currently intense time with my son. Can be hard being around one another 24h non-stop... And then realizing that a lot of the stubbornness and quirks of his that drive me crazy: is actually me! (Be it that it's in my character as well or he was reacting to a stupidness of mine)2 -
Been thinking about how to detect sounds for weeks and finally got enough time and motivation to do a Google search... and find an entire example....
All that thinking and worrying for nothing.... now i just gotta figure out how to install PyAudio.... hope it's not hard.... or maybe I already have it installed....8 -
For awhile now, my hopes for humanity just being in a rut, soon to receive some motivational kick in the rear or the helicopter parent trend, skyrocketing over the past ~20yrs giving rise to snowflakes and seemingly imminent social\financial doom, keep going steeper downhill.
The overuse and\or reliance on, both term and tech, AI has been particularly disturbing and painfully ironic...
Seems it's overwhelmed my, typically instant, reslisations of severe head-scratchers that have nothing to do with AI and even, apparently, denote actual honesty and effort employed.
today, within moments, quickly scrolling on eBay i found 2, new to me... which is quite rare, perplexing 'wtf's.
1. a laptop clearly stating, multiple times, reiterated, not copy\paste... that not only was it lacking a hard drive... but "no hard drive cable"...
my mind briefly tried to figure that one out
... even considered searching yheir several other lots to see if they typically included the "hard drive cable" or if they were often denying customers of this clearly standard component.
2- see pic
it was so soon after the 1st find that i briefly considered that i was missing something... aside from faith in humanity, nope.
that said, i do respect their blunt, bold\capslock committee to transparent honesty.7 -
So.. name one fucken case where your database is not a computer backed thing.
Just asking because.. why the fuck? I don't think your database server supports input of fucking math symbols? JUST USE HUMAN LANGUAGE, AS YOU HAVE TO DO ANYWAY!
It's stupid how everything needs to be expressed mathematically ffs. Not that it's hard to understand - it's just more complex than of a very simple wording.5 -
ColdFusion and all ColdFusion devs should be executed. Its a god-awful software from the 90's and if you still use it you're either braindead or ignorant.
Shut up about legacy CF code too! No one cares whether or not your embeddable calendar would be hard to make in JS; fucking figure it out.
I realise that CF may make things easier in the short run, but in the long run you'll have introduced so much technical debt that you'll run crying back to JS anyways; CF is so hard to refactor and even to make flexible that you would spend less total time over an application lifecycle learning JS.11 -
Nothing IN THIS WORLD drives me CRAZIER than you giving me a wireframe or design that is not mobile first! And not even designing to the smallest phone size either! HOW HARD IS IT TO DESIGN MOBILE FRICKIN FIRST3
-
I understand that its very inefficient to call every applicant back or to give valid feed back as to why they were not chosen but I find it hard to believe that I was not chosen for an entry-level programing position when I have knowledge in everything they sought.
😧3 -
Sometimes I wish I could clone myself 3 times and start a company. Not that I think that I'm that smart, I'm fucking clueless most of the time. But because it's so hard to find people who freaking READ THE DOC!2
-
So here I am trying to understand the database schema in order to write a REST interface. Then I find that one of the tables contains an id and a name columns but the name is Integer not a string!
I contacted the developer who gladly explained that it was easier for them to store the ids in the database but the actual names strings were hard coded in the source files so they can handle translations! -
Damn he still hasn't spoken to me, must be over a week now, normally he can't stop talking to me. I must have really pissed him off telling him it is company policy to not give juniors global admin access on all our servers. He's going to have a hard time in life if he keep that attitude up.4
-
HOLY SHIT
FINALLY
AN APP THAT LETS ME USE FIREFOX I STEAD OF SAFARI ON MY FUCKING IPHONE
ITS NOT THAT DAMN HARD APPLE. YOU DID IT FOR THE MAC...
also devrant, plz add browser selection for iOS (yes I already submitted a GH issue)5 -
With school starting in a few days, I'm reminded that half our class failed Grade 11 Computer Science, not because it was hard, but because they wanted to play flash games instead of actually learning2
-
Kinda amazing that dyn does not have DDoS protection...
It is NOT hard to get and for a quite big Company like dyn - it is cheap also3 -
Did anyone else grow up using shitty laptops and cheap hard disks with just not enough space and now that they are adulting and have access to money, have this random, uncontrollable urge to keep buying more SSD's even though they already have more than they'll ever need or is it just me?11
-
It has made life living like hell around muggles who think "it should not be that hard.. can you..."
NO! GO FUCK YOURSELF.
"Can you make me a POS system? A guy told me it should not take you more than a night. I will pay you (enough to buy Age of Empires 2 on Steam sale) as well."
NO GO LEARN TO CODE YOURSELF IN ONE NIGHT AND BUILD YOUR POS(piece of shit) YOURSELF IN THE NEXT NIGHT.3 -
Not really coding, but debugging complex problems. I love it when I have to dive in head-first and dig (very) deep to find answers to super-complex problems. I once went into the internals of a programming language to understand why a library was acting up in a particular scenario. Another time I had to optimize and re-compile from source (after modifying it) so that the application would not leak its memory. (Of course, I contributed it back to the language).
The inner satisfaction that you get after all that hard-work when it finally works, pays off! Bliss!1 -
Dear every app developer or web managers/designers that can read this.
Specificly, the ones who own a android app.
If you have an old android app that is still updated from time to time.
Please, take your time for just one minute.
AND REPLACE YOUR GOD DAMN OLD "Get it on google play" BADGE WITH THE NEW ONE, PLEASE! ITS NOT THAT HARD, WHY ARE YOU GUYS NEVER UPDATE TO NEW LOGOS?!
NOT JUST OLD APPS, EVEN SOME BEW STARTUPS ARE ACTUALLY USING THE OLD BADGE, WHY OH DEAR GOD WHY! WERE YOU LIVING UNDER ECLIPSE ROCK OR SOMETHING?!?1 -
1 year into the project, spending nights fixing issues, but
today the client realises that things aren’t working out and we need to stop the project. 🙃
Does money, hard work and time grow on trees for you? NO CLIENTS ARE NOT GODS. They’re cuckoo.2 -
Good recruiters do not ask who are the other companies or recruiters who contacted you.
Good recruiters understand that potential applicants have greater needs than purely monetary compensation in their offers.
Good recruiters do not threaten you with a hard deadline to decide whether or not you'll accept their offer.
Good recruiters do not ask for referrals if you turn them down.
I've yet to meet a good recruiter.1 -
Who knew that NOT using results given from an API can actually help.
The private devRant APIs give you offsets in text of where links are in comments and in rants.
It’s EXTREMELY inaccurate and I don’t understand why it’s so hard to write it so it’s accurate 100% of the time.
So I said fuck it and NOT use the given offsets and just hard-find using the built-in algorithms inside Swift to create the range for me. Results? It works 100% of the time. No crashes, no out-of-range errors, no nothing.8 -
1. start up my monitors, have one monitor streaming news while the other one is browsing devRant.
2. drink an ungodly amount of caffeine
3. crash so hard that I have an excuse not to code and go back to bed. -
Why is it so hard to remember, that devs need an error message if they should help you. just saying "it does not work" is not helping.
I even wrote you a checklist. so f*ing use it! I'm not there to be called every time just to tell you to do something that's already on this list.
Every. F**ing. Time.2 -
that BS thing you do when your too lazy to code and just copied a code from an existing class and renamed the vars even if it does not work or not being used just to show your boss that your working hard as f*2
-
It's so fucking hard to explain my job to people who don't have slightly idea about it
Person : what you do?
Me : Web development
P : what's that?
M : you know websites on internet for users or clients for products/information bla bla bla
P : like amazon, facebook, xyz ?
M : Yeah you get it
P : so you develop facebook?
M : huhh.... No not that I'm not working for FB that's a different company we create websites according to clients.
(Inner me: why don't you fuck off already)
P : huh... Okay ( no fucks given )1 -
!tech
yesterday i completed around 5 months of working out 5 days/week. this has been incredibly hard as i never worked out for more than 2 days in my 24 years on earth.
but i took a pic of mine in the mirror and my fat belly gave me the most depressing sight to see and question whether it was worth the effort.
i mean, surely i can do 50+ pushups now and have started seeing a few changes in shoulder/ chest area, and a few friends/collegues have appreciated my working out habit , but not getting out the only area that i want to go away, this sucks :/
tbh my plan was to see where this experiment of creating a new hobby goes and i did not do the hard steps (like doing cardio more than body part workouts and taking calorie deficit diet). am also a vegan and didn't consumed any fitness products like creaine nd stuff, so not a very nutrition rich diet.
guess i can't ignore the hard steps anymore . just once in my life if i could get a split chiseled stomach :/ (and maybe some cute girlfriend)6 -
How hard it is percieved by management to do something in code is proportional to whether or not it's a task that sales or the CEO wants, versus what the developers need. Developers want to rewrite something, or fix infrastructure? Too much work can't justify it. Sales wants to clone Google Search? We'll expect it by next month.1
-
So I just found out the hard way, that you can't take screenshots, which is great if you want to enforce privacy, but not so great if you want to treasure some of the most awesome comments you find in this community.
Is there a possibility to add a feature like favorite comments?14 -
It is really hard not to feel arrogant when everyone around you is a shitbag.. but that makes me feel like a shitbag myself so the problem kind of solves itself.2
-
I just said "bye" to all my Whatsapp groups, and finally got rid of that service ! (meaning deleting my account as well, not just uninstalling the app).
It's so hard to make people understand what is happening and what I think about security/privacy... Guess I'll have to wait for people to finally come to Signal or Keybase if they want to reach me more efficiently :)12 -
Have you ever had to get over someone? I don't mean in a relationship. I mean having that person betray you in a way that shows that they are beyond help?
That's what I'm dealing with right now. I'm not crying I've skipped: anger and denial, I've breezed through bargaining, right now in the middle of acceptance and depression.
Now I'm having a hard time admitting I had feelings for her at one point. 🙁
Currently Listening To: f*** You by Cee Lo.3 -
I want to spend about 10 minutes a day in to small code brain teasors.
I know there are apps like SoloLearn. I don't want to learn hard new concepts but rather just maintain the basic ones. I am looking for an app that gives me quizes, not just informational text
What would u recommend?7 -
The amount of willful ignorance about how “master/slave” might be offensive to some people is disheartening. Not surprising, but disheartening.
I thought it was suspect back in the 90s when I was configuring IDE hard drives.
There are loads of terms that express the exact same relational concept, that don’t have their roots in exploitative human relationships.
If you disagree, kindly fuck off. Your shitty attitude is why tech is predominantly white and male.29 -
Imposter syndrome is such a bitch
It feels so good to finally be able to achieve something without constant self doubt (okay I lied, but atleast I am actually programming)
But fuck me it's hard to keep reminding myself that it's okay, it's fine if it's not perfect, just evaluate all the possible solutions and pick the best one, it's fine9 -
I’ve seen so many articles about how over-complicated and hard Angular is and I still have no clue what they’re talking about? It’s not that hard wtf9
-
Do you prefer working remote or in the office?
I like to view these as equal choices. I don't think offices are as bad as some people make them up to be (of course heavily depends on the environment and company!). In opposed to working remote, offices can help you focus more on work and leave work problems "at work".
While, if you're working remote, it's not unlikely for work and personal life to become so intertwined that it's hard to tell them apart anymore. It's hard to not think about work at home if home is where you work.
I believe an ideal is somewhere inbetween - not entirely remote, but not entirely office focused either. Mixing and matching seems like the one approach where you get to have most of the benefits, but with the least negatives. It doesn't seem necessary to always be at the office but it also doesn't seem good for you to always be cooped up at home.7 -
I've always found it funny when sql errors "at or near" a character. I don't know enough about sql to understand why it does that (although I'm sure there a reason!)....but it just sounds like it's not trying hard enough 😂
Maybe someone smarter can explain?1 -
I have this colleague that who is nice, but if you mention anything about (not complete) java, sun, vmware, windows, daus(dumbest possible user), car manufacturer your ears bleed with is rants about it.
For example:
We talked about BMW which published that the energy generated from recuperation of one of their cars is around 60%. Immediatly he rants that it its not possible and the calculated number of an forum user of the newssite who calculated that 90% of the kinetic energy is regenerated has no idea about the problems.
Sometimes its hard to endure the hate, but i can relate with him in some things.2 -
I don't know exactly what year my dad bought the PC with a hard drive of 4GB, but it was not in the year 2000 and following. I'm not sure if it was running win98 or win95. Probably win95. Aaah those were golden times.
I remember having no internet, but still having fun drawing images on ms paint.
Oh and there was a game named sesame street for that os. Sometimes I miss those times.3 -
I have realized that I'm getting nowhere with my boss with my current attitude.
I want to change strategy, but I find it very hard to bite down my tongue and give up on being logical or the attitude of "be competent, do a good job, or gtfo of my way". Like, it's not my place to fix all the issues, neither am I perfect.
I'm not looking for methods of manipulating him, rather I want to change my own perspective and mindset to something that doesn't make me suffer. At least regarding this one person.4 -
With a nice cup of coffee, you start earlier than your colleagues, you do the hard part that everyone is afraid to touch.
But there is always someone who starts late his day and leave usually the first with a stupid smile.
I'm not the manager, so it's not my responsibility to control this person, I admit seeing this affects my motivation but I don't need to have his load on my plate.
I know that this case is quite common but I needed to rant about it.
#do_your_work_bob5 -
If you ever try to learn C++, give C Primer Plus 6th edition book a try. This is one of the best books that are prepared to teach, not tell about C++.
I tried Bjarne's boooks, but damn they are hard to understand, with badly formatted non-monnospace font code examples and terrible technique to teach. -
Have had multiple interview rejections already at 20. Strongly feel I am bad at it.
Maybe it's because these are my first few interviews and/or that I'm still in college and don't realise how interviews work.
Really hard not to grudge the interviewer after a rejection. Cunts all of them.
Share your story/opinion if you feel like.2 -
Your tests won't work right because you failed to meet coding standard, not that hard to understand. Yet, here we are still implementing the same shit that got us in this conversation.
-
I've been reticent to chime in on this weeks group rant, feels too personal...but it is what is is.
Most emotional was losing a dev to cancer, and an analyst to an allergy, and an engineer to an accident...ugh.
Most intense was probably losing servers and hard drives without recovery, not being able to get databases back online because they went down so bad, websites being down, not meeting some quarterly goal, shit not building, email campaigns that go sideways...fuck...anything involving reactionary leadership...unrealistic expectations.
But all that shit, while seemingly important or "stressful", pales in comparison to someone you fought with in the trenches not being there anymore.
restore -if friends -
I shot myself in the foot again!!
These incident usually happen at restless night.
Some night I become too restless so I do what any programmer would do, I program.
The "novel" idea just come up and I code until I become too tired. I usually finish the prototype of the project before I fell asleep.
I usually found out that I have reinvent the wheel the next morning! Great. My "novel" idea is not too "novel" after all.
It is hard to find the novel project these day since it is too hard to beat the decade of collective intelligence of programmer.8 -
I think it will be hard for Facebook to recover from this.
It seems like most people can tell that it is toxic.
Of course, a heroin addict would tell you they know heroin is bad, that doesn’t mean they are gonna stop using.
So FB isn’t going anywhere (they already have their needle in a lot of veins), but I’m not sure that even the addicts will see them the same way again.5 -
Tried really hard to get the external css file working and after an hour found that I had not specified href in the main html file.
fml -
I don't like vector math for gamedev. It's not that it's hard. Vector math isn't hard until operations become O(n log n). It's that it's unintuitive, slow to write, and when I finally come to a solution after arduous number crunching, it always looks obvious, boring and kind of ugly. I don't think I could ever write a piece of vector math that I could be proud of.2
-
Been meaning to rant about this for awhile. Currently in college and in this class we have to write BASH scripts which isn't ever that hard. Except for the fact that everything is checked against a pre-written script. FUCK I just wrote a complex script that does work but because it's not EXACT its coming back failed even tho it prints everything correct and works.
So now instead of fixing the script I'm back on DevRant wasting more time.1 -
This week was so not productive! Learning c# on the job is hard and I had hoped that it would go faster🙃1
-
Why is it so hard to explain to people that
The speed of time = 60 minutes / hour
I mean, I didn't come up with this shit!!! Come on
Also, in other annoyances of today:
VS code updated and ended with a crash, even tho it now says it's actually updated... Should I trust this bitch or not?!?! -
!rant.
I fucked up. Recently I applied for a job in Intel. All questions they throw at me I answered well, but there's one question that f**ked me hard that I can't think of any answer to. (Because ! am not familiar with this)
I was questioned about SLAM ( Simultaneous localization and mapping), I am new to this.
Now I think I failed to get the job. Therefore, I f**ked up12 -
For fuck sake why can't people implement instant payment charges when you order something and not when it gets shipped!
Ordered a board game for about $150 AUD about 3 months ago and my batch was just finished so I just got charged... It's not like a have a fucking trip to Melbourne with some mates this weekend .-.
It can't be that hard guys, charge people when they order and not when it's ready -.-10 -
I really hate doing all the tweaks for tablet and mobile on websites. No matter how hard one tries to design for mobile first and make the transitions as seamless as possible, there are always some “fiddly bits” that won’t behave. And so many devices with all their viewport width variations. Also, there’s the matter of people resizing a desktop browser to any width that might not be covered by the breakpoint ranges that specifically. One could write a hundred breakpoints and still not account for it all on some designs. It’s exhausting.2
-
I'm getting more and more fed up with my fellow colleagues who encounter errors in the execution of their code and come to me like bumbling idiots..." I don't know ow what's wrong ... It's not working"
DID YOU READ THE FUCKING ERROR MESSAGE? I GUARAN-DAMN-TEE IT TELLS YOU EXACTLY WHAT'S WRONG! YOU KNOW WHAT...EVEN IF ITS NOT 100% CLEAR GOOGLE IT. BET YOU FIND THE ANSWER
To add insult to idiocracy...I recently over heard grumblings of being displeased at current level - fuck off you lazy ass child - if you can't read an error and Google for the damned solution in today's era search engines and developer assistance, you don't deserve to call yourself a "Senior Developer"
People like to act like there's some great secret to becoming a competent developer...I'm posit over half is simple reading comprehension2 -
Workers work just hard enough to not be fired and owners pay just enough so that workers won't quit. 😅2
-
im feeling dizzy and sick as fuck both physically and mentally from this fucking college and im not even exaggerating
last time i asked how hard can life get was also the first and last time i asked that
please
no more11 -
Brian Kernighan once said that "debugging is twice as hard as writing the code in the first place. Therefore, if you write the code as cleverly as possible, you are, by definition, not smart enough to debug it."2
-
Have seen someone not getting it to 63.0 two weeks ago here. That was the moment when I decided, that I wanna try this really hard 😂😂
And it worked 👌
It was a little tricky, because I'm driving about 160 kilometers/100 miles every day 😊 had to reset my daily-trip-mileague whilst driving home to achieve that.9 -
Fuck C# for real, like why in the FUCK DO YOU NOT AT LEAST THROW A FUCKING EXCEPTION WHEN I TRY TO CONCENTRATE A STRING WITH NULL, I SPENT 40 MINUTES DEBUGGING THIS SHIT JESUS FUCK
Edit, note: I'm having classes that return null when they don't find something. Why is it so hard for the fucking compiler to at least warn me or some shit!!!!!!!!!!!!10 -
OK, I'm spoiled Linux bra^H^H^Huser, so MD5, SHA1,... checksums for distributions' ISO files are something I take for granted but is really that hard for Microsoft to provide same for Windows 10 ISOs (plain and simple info, not something that require equilibristics and deep diving into MSDN site) ?!2
-
Why am I the only student that others in IT/programming class look up to when it comes down to basic c++ programming??!
It's not *that* hard. Just read the book provided to you by school, goddammit! Just because I can write and use more than one dimension in an array DOES NOT make me any better in prigramming!(or maybe it does, idk)
But, as much as I hate those lads, deep within myself I want to help them get as best of scores in finals as they can. Here's hoping they come around to realise that and pay attention when I try to give them tips...1 -
When you're explaining your app to a non-dev, don't. Use. Technical. Terms. It's not that fucking hard. Don't talk _down_ to them, but use terms they fucking understand.4
-
Not a single year passes that the problem of python2 vs python3, as a dependency, doesn’t bite me in the ass. Node modules frequently fail to build, awscli suddenly can’t find the python it needs because homebrew apparently hard-links to python3 in Cellar... Seriously, W T F?! Fuck you python!!!! You fucking assholes!!! Fuck you and go fucking die!!
-
Remember when I said Windows 10 is kinda beautiful? It's not. Windows 10 is created to break our hard drives so that we'll buy new PCs. Fcking Microsoft.2
-
The final company who was the most interested in hiring me, has finally replied to my email today, being late 7 days.
Cant show the screenshot here because its not in english.
"We want to thank you for participating in this process. This time we have decided to choose another candidate..."
AND GET THIS NOW:
"...the only reason was the number of years of experience."
????
- it's not enough that i have graduated such an extremely hard university
- it's not enough that i have this apparently worthless computer science degree
- it's not enough that i have knowledge
- it's not enough that i have a fuck load of projects done and showcased
- it's not enough that i worked with international clients
- it's not enough that i have the knowledge and skills they're looking for
- it's not enough that i had answered everything correctly on a technical interview
now the new standard is to have minimum 3+ years of working experience on top of all of that.11 -
Using Bloodshed Dev-C++ and not wanting to change that for Visual Studio.
Transistion for VS wasn't simple, as I learned from the beginning od Dev-C++ and amount of 'hacks' that worked in DevC++ and didn't in VS were frustrating me. After a while I understood that DevC++ was a bad first choice IDE and things it did shouldn't have place, but habits die hard I guess.
Still like the lightweigh it had, tho. Wish VS was so simple in use at the beginning. :)1 -
Is there a Map like class in Java that has
getKey(value), getValue(key).
Guess not hard to implement but why reinvent the wheel..15 -
Play designer board games; they are multi-tenant programs, complex algorithms, modularity, meticulously balanced, and all elegantly linked to an artful UI. They are also made out of cardboard.
It is hard to play them and not become a developer that builds increasingly holistically.8 -
I spent the entire day trying to force WordPress to enqueue jQuery and fonts.googleapis.com in the footer. Why is this so hard to do? Why is this still a problem? Does Automattic just not know that PageSpeed Insights flagging render blocking is even a thing?
-
Trying to learn a bizarre custom javascript wrapper that was used to communicate with complex mobile RF devices, the point being was to control them, but damn thing did not work for crap even if you tried hard.
When any of us devs asked the senior "dev" who designed it if there was any documentation on it so we could actually get started on working, he literally told us we sucked ass and that we were pieces of shit that knew nothing of programming.9 -
Working on an assignment in Java. Was making a test, but no matter how hard i tried the test would never run. Went through the code several times changing it entirely.
Realized after four hours that it was the test that was wrong, not the code 🙄1 -
Stupid Windows Update back at it again with the Fall Creator's Update. More like Fail Creator's Update. My poor laptop took it too hard and the built-in mobile hotspot feature is currently bugged and not working, with the ICS service in task manager stuck at 100% you usage. Restore to previous version or not to restore to previous version? That my friends is the question. *picks up Ubuntu 17.10 live disk*2
-
I am unable to see anything useful in current social networks. It all looks like big advertising platforms and I am not interested in looking on ads. This personalization is so shitty that original content is very hard to find. All is so political correct and trendy and what about uniqueness of human individuals. Shitty socialists networks. Hope this website would not be another one.5
-
When the PMO tells you to: "Aye, what's up with that delivery program you started yesterday? Is it done? I already promised some licenses for next Moday (morning ofc)"
You stupid illiterate baboon, be gratious I even picked up this NP hard task, it's like solving the Travelling Salesman problem, not easy!
Fucking PMO -
I am still relatively new to Ruby and would like to write a program using an interactive shell like interface,meanjng that people type the name of the program "taskflow" and the app starts, putting them into interactive mode. Is there a good framework for it or is it hard to write it myself? If not, any ideas or tips on how to accomplish it?3
-
if you're new to git, becareful not to do something like git reset --hard
it works similar to
git checkout --
rm -rf.
and deletes your files that haven't been checked in3 -
I'm looking into GraphQL and so far so good, but I am finding it hard to implement business rules, for example:
1. Receive request with auth token
2. Know who the user is by extractin userId from token
3. fetch data related to that user only.
I was only able to make it allow or deny if there is a token or not lol5 -
Is it weird that I'm doing Electrical and Electronic Engineering but I HATE it and love programming? I know I should find a balance between the two but I just can't seem to. The worst part is that the syllabus hasn't been updated for eons so we are learning about outdated technologies. Ooh, and you can't declare majors until like the final year, I think. I could quit but it would break my parents' hearts, and we are not rich enough to afford a self-sponsored CS course. The worst part is that I'm not even a good programmer, I'm trying so hard to balance the two that I end up not being good at any.5
-
I just learned the hard way not to recklessly daemonize stuff; I ran into a case where my Python script crashes Python itself.
The issue was that one of the query that “requests” package makes for OS was not fork safe, thus causing a segfault. Since Python drops dead as soon as it receives SIGSEGV, all I had was macOS crash log (which is oftentimes hard to decipher). I spent like good one hour before I found “faulthandler” package which enabled me to log the stack trace to stderr and see what the f*<k was going on.
I mean, I’ve seen quite a lot of occurrences of thread safety issues, but now it’s fork safety!?
Maybe I should be sticking to Docker or something unless the situation *really* requires me to daemonize something lol2 -
Who else finds its hard working from home/remotely? since I've been working remotely full time, I feel like I've been working harder and longer hours, I think its because I'm being evaluated solely by outcomes that I feel the need to put in more effort. Not like the days where I could rock up to the office for 8 hours and that was good enough, no matter how much work got done.1
-
Was helping out a friend yesterday with word macros.
Never did that stuff before, but thought, it can't be that hard...
It took me almost 3 hours to figure out, how to fill a fucking textbox based on if a checkbox is selected or not. was also kind of a throwback to MFC Applications (because of how bad the UI was)3 -
Sometimes it’s hard being the only front end web dev at an older desktop/backend centric shop... sometimes I say things that make me look so ignorant but then I’m like “...how do you not know how to write basic CSS?”
-
I am really frustrated and angry when my friends only think that web development is easy you just do everything in bootstrap thats it, but really not all web apps are made in bootstrap, i make mine using css media query and thats hard to set everything manually, im so pissed that they take my job for granted and they cant even right a single decent php function , ignorant retards4
-
I have realised this the hard way. Never ever ever delete something if it’s backed up in cloud and is not taking space in your device, just to free some space.
Obviously some bullshit is better deleted. But never overdo it. You never know when you are going to want the thing you have deleted.
I have 2 regrets. Both related to deleting things without backup. But in my defence, I forgot that they were not backed up. Brain freeze.3 -
Best part of being a dev is knowing only so many people know how to do the things you do. And it's not that hard really, but you know... people.
So there'll still be demand for my work in the foreseeable future. And little competition.2 -
It's a challenge working with people that aren't as competent as yourself. Having another programmer misunderstand some system's design and throw copypasta around; or an artist who wants to chime in on low-level system design. It's hard to communicate not only how things work, but that a person should stick to their designated role and competency - without bruising egos.3
-
I have very mixed feelings about Go's KISS policy. They did manage to keep a lot of stuff easy and they force dev's to not over complicate their code. But there is a line. Generics aren't that hard to grasp. I get focusing on *fearless concurrency*, but how about *fearless list processing* FFS5
-
trying to rotate the character in Unreal Engine based on player input. It rotates around some sort of super weird point, so it looks like it's driving "backwards" while rotating, instead of rotating around the center of the mesh... sigh..
...
...
Solution: pass down the rotation value to the animation blueprint, rotate rootbone.
SUCK IT <.< See? it's not that hard, nor awkward. ffs.2 -
Java Life Rap Video
https://m.youtube.com/watch/...
SPOKEN:
In the cubicles representin’ for my JAVA homies…
In by nine, out when the deadlines are met, check it.
CHORUS:
We code hard in these cubicles
My style’s nerd-chic, I’m a programmin’ freak
We code hard in these cubicles
Only two hours to your deadline? Don’t sweat my technique.
Sippin’ morning coffee with that JAVA swirl.
Born to code; my first words were “Hello World”
Since 95, been JAVA codin’ stayin’ proud
Started on floppy disks, now we take it to the cloud.
On my desktop, JAVA’s what’s bobbin’ and weavin’
We got another winning app before I get to OddEven.
Blazin’ code like a forest fire, climbin’ a tree
Setting standards like I Triple E….
Boot it on up, I use the force like Luke,
Got so much love for my homeboy Duke.
GNU Public Licensed, it’s open source,
Stop by my desk when you need a crash course
Written once and my script runs anywhere,
Straight thuggin’, mean muggin’ in my Aeron chair.
All the best lines of code, you know I wrote ‘em
I’ll run you out of town on your dial-up modem.
CHORUS:
‘Cause…
We code hard in these cubicles
Me and my crew code hyphy hardcore
We code hard in these cubicles
It’s been more than 10 years since I’ve seen the 404.
Inheriting a project can make me go beeee-serk
Ain’t got four hours to transfer their Framework.
The cleaners killed the lights, Man, that ain’t nice,
Gonna knock this program out, just like Kimbo Slice
I program all night, just like a champ,
Look alive under this IKEA lamp.
I code HARDER in the midnight hour,
E7 on the vending machine fuels my power.
Ps3 to Smartphones, our code use never ends,
JAVA’s there when I beat you in “Words with Friends”.
My developing skills are so fresh please discuss,
You better step your game up on that C++.
We know better than to use Dot N-E-T,
Even Dan Brown can’t code as hard as me.
You know JAVA’s gettin’ bigger, that’s a promise not a threat,
Let me code it on your brain
WHISPERED:
so you’ll never forget.
CHORUS:
We code hard in these cubicles,
it’s the core component…of what we implement.
We code hard in these cubicles,
Straight to your JAVA Runtime Environment.
We code hard in these cubicles,
Keep the syntax light and the algorithm tight.
We code hard in these cubicles,
Gotta use JAVA if it’s gonna run right.
We code hard in these cubicles
JAVA keeps adapting, you know it’s built to last.
We code hard in these cubicles,
Robust and secure, so our swag’s on blast
CODE HARD1 -
Remember that your Product Manager, Project Manager, etc are not your friend. They are coworkers first and friend second if you classify them as that. Learned that the hard way the other day.1
-
I think my senior does not really care to what I say. I told him that we need to study the core of spring framework before the mvc part so we can easily understand the source code of our client. And now that we're given a task to create and update new functionality on that given source code, him and our intern having a hard time finishing their task because they don't even know what @Autowired is.
Anyway good luck sir :) -
Biggest hurdle right? That would be finding it hard to wrap my head around functional programming...it's just not getting in.. I need help pls.2
-
Frontend developer mainly, getting all excited by C#, net core, apis, http, databases. A new world of trinkets and hard-edged engineering. Makes me eyes glitter.
But my day job needs me to become as proficient as possible on the frontend of the stack. As we warm up to a huge application rewrite, with me as the sole frontender, it becomes clearer and clearer that, if I am not only to survive, but leave a codebase behind me that is clean, thoughtful, well modularised and built with maintenance and performance in mind, that I must let go. I have to focus.
I feel a little sad today. Somehow, right now, the frontend world does not feel as exciting. Javascript feels loose, unpredictable...my work open as well to everyone with every flavour of opinion. Because it is observable.
But I am mortal. Time is precious, and limited. I feel I need a dose of curiosity discipline and that, if I can do so, I can devote myself not to my coming and going whims of interest, but the real hard work of learning craftsmanship once that feeling of glitter has faded.
My brothers and sisters, steady my hand. -
anyone else ever focused so hard/long that they peeled an orange(mandarin) to eat, then forgot to eat it so long that it was crispy?
i mean like literally the thin skin remaining was actually crispy... this is me taking a break to remember last times i ate/etc... and hopefully not have more crispy oranges... though tbh wasnt bad8 -
(Italy)
In 1 word: SUCKS
In 2 words: SUCKS HARD
Basically you work in companies that are either not tech oriented and use you as an extra (eg: fix printer, sort boss fantastic vacation pictures in his overpowered Mac) or if the company main business is tech, they are FANGS-wannabe that pretend to compete with world biggest companies with a severely understaffed crew that they pay as clerks5 -
Background: I am working on task x. On successful completion of task x, task y may be given to me. Task x is haaaaaard. My group is not the only player and any fuck up will break my group and at least two others. Now here is my story:
Me: Yeah I am doing this hard thing and that hard thing and getting ready for these hard meetings.
FormerCoWorker fcw (): wow that sounds hard.
CurrentCoWorker ccw (): yeah he's working on task x and task you.
Me me (): what? No I'm not. I am working on task x. Don't go randomly assigning me tasks like that.
ccw: well if you finish task x you will be an expert in section z of code. So it is only natural you take on task you.
me: yeah but task x sucks and task y is why several engineers have quit the company. You never know. You could be assigned task y and quit. Why do I have to take on task y and quit?
NGL, I will do it of they promote me. I may be a whore, but I am gonna get paid. -
*me to myself* okay this time I'm not solving that problem with recursion. The assignment is hard enough already.
*A ton of sweat, blood and hours later* Whoops. -
Me : .. but sir without sass/js compiled, how can we address the issue?
Boss : that is not an issue, issue is with on approach we have taken?
You sick fuck, you take other developers un-finished work, expect me to finish it (which it did) and when the other developer is not smart enough to copy paste the solution, you give an "update" to me, I mean how the fuck, what ever..
I really really put efforts to make this shit happen, I know very little about your commerce cloud shit, but when you question my logic on basis of someone who will pay you to finish her work, it is very unethical and hard to swallow it down.
Maybe this is my first real job, that is why this is so hard, but I gotta do what I gotta do -
Holy shit! Why is it so hard to find a JSON viewer for android that doesn't absolutely suck ass?
I want a viewer that:
-reads json from the clipboard
-queries json for strings in context
-allows copying of values, not the key and the value put together
Major bonus points:
-JSONPath querying
-Free/pay version without ads7 -
I dont know if i should learn typescript, i really like how it shows any error if you have done some mistake in the code in realtime. But it seems kinda hard and its not used that much at my office work. Should i start learning now or should i focus on strengthening my react skills for now? I work on react and javascript on daily basis.11
-
Has anyone else found that not all USB C inputs are the same? You can't just buy an cable and expect it to plug into any socket.
1. I replaced the cable for a power pack, but the new one didn't fit my OP6 socket well, no clicking and have to push it in very hard to get it to charge, and still eat to fall out
2. The pixel 2 cable fits it nicely and all cables are ready to plugin and work
3. I tried charging my new Pixel 4a with ur though but very hard to plug in. Had to install the charger and cable that came with.
4. Amazon Fire takes all of them nicely and send all the others can use the cable that came with it too8 -
Clients asking for features in a prorecord schedule and budget... "Facebook have it. It is not that hard"
-
Young aspiring dev asking for career advice here. I have to choose between two job offers:
1. The first for a larger company that mainly works with a top-tier company's solutions.
2. The other for a smaller company where I have more freedom to choose a stack.
I'm not really straight out from university. I'm wondering about what would be the most developing for me personally and professionally. Does the size of the company matter? I work hard and like to be rewarded for hard work, where is that more likely to happen? Should I choose from what stacks I prefer? Salary?
Do you fellow devs have any other input or advice? Perhaps guidance on other questions I should ask myself?2 -
Just got my Maker Fair NYC tickets. Me, My Brother, My Nephew and my Daughter. Gonna be a blast. Just a little disappointed that Raspberry Pi will not be having a booth this year.
We won’t be hard to spot, we will be the group of nerdy looking people... lol ... if that narrows it down for you.2 -
...by saying "so what?!"
Either my fears that I'm not good enough to be where I am are founded, in which case I need to be thankful for this opportunity to be "above my station" so to speak, and work hard to make sure I *do* deserve to be there.
...or they're unfounded, in which case I need to work hard to do the best job I can.
In either case, it doesn't change the outcome, so worrying about it is futile. Heck, even go one step further - shoot for the jobs you *think* are above your station, and then see what comes of it. -
Have you ever use Ubuntu (or any Linux that use Pango to render text) for a significant amount of time that you notice that text in Mac OS is just not that crisp? To the point that it looks blurry, even more so in non-retina display.
I want to justify buying new Macbook for that sweet M1 silicon, but I don't think I can live with the blurry text. I rarely use built-in display on a laptop, but it is hard to find external monitor with Retina resolution (200+ dpi) with decent size, or ultrawide for that matter.3 -
Not to dislike 9 to 5 developers who have no passion for their craft and leech my hard work and knowledge while getting mad at me for not taking my time to sit with them and explain every small aspect of their tools to them that they should already know after having used them for 15+ years.
-
I've seen a lot og images om devRant lately that are shitty pictures taken with the mobile camera - the last I saw was a picture of Stack Overflow. Come on my fellow devs, screenshotting is not that hard and time consuming. We are supposed to not be computer-illiterates :D
Merry Christmas by the way!2 -
I really love how quick it is to get data from SQL with Djangos ORM. But heaven forbid I want to do a WHERE EXISTS clause. Comparing against two tables should not be that hard....1
-
Trying very hard not to slam down my shitty monitors in protest.
Was just informed by my manager that all coursework has to be directly related to my present role. Since I am not a developer than my classes will no longer be covered.
Same company that spent 15 grand just for the food at last year's company xmas party.
Even though I have already used my skills to revamp the company intranet, created macros that halved my workload and now able to understand the developer docs for 3rd party software we implement.2 -
I don't get why my boss wants to outsource the easiest part of our next project to India. Not hating on Indian developers, but the 13 hour time difference that makes coordination unnecessarily hard.
-
You should not mock @tosensei too hard. He's a good dude, he just have antiproctocoletism (from greek (ἀντι, πρωκo and κολεῖτης)
(It's a congenital disease that makes your anus looks like a vagina).4 -
My dream job, apart from everything that's been mentioned already, is working every other month or so: one month working (not too hard of course), one month off. I'd spend that either travelling or hobbying.
-
Hello everyone. I was just wondering whether or not I should learn angular (first one) or just dive into angular2. Angular 4 is on the way and I have a feeling that I will have a hard time to adapt. I am a bit confused about what to do.8
-
You know what is awesome. React with Redux. It is such a clean and scalable pattern for building UI. Conceptually not that easy but on once you have it. So much better than any other pattern I have seen.
But what fucks me off is working with other librarys with it not hard just fucking annoying.2 -
How hard is it for people to understand that rounding individual decimal numbers and adding them is not equal to adding them all and then rounding off.
FFS1 -
Greatest minds of humankind processed all that eternal questions and hard problems of ourselves and the outside world. They all formed the outcomes and conclusions into comprehensive messages.
Are they hidden somewhere? Is this some hidden knowledge that is extremely exclusive? Where is that library and how hard it is to get there? Maybe it is impossible for me?
No.
It’s right there, hidden in plain sight and often overlooked.
It’s called art. That packages are artworks. I just realized that all that time people much smarter than me spent their lives thinking about all that stuff and I can get all their answers right now, for free.
Art is not a steal.
Art is a robbery.17 -
when you work in a small team and there's no transparency.
TL asked for help and I gave the solution that worked for my env, and then TL just went silent for days.
is it so hard to feedback whether is it working or not? -
Why the *fuck* does everyone think every single paragraph should be centered? Yeah, sure, components, icons, things that are presentation, sure most of the time you want that centered. But not *every* time. And, especially, never when the content is body copy text. That shit is hard to read, dammit! And yet I swear every single non-technical person and marketer I've known wants everything to be centered.
WHYYYYYYYYYYYYY -
A weird thing happened when I tried to install linux mint on my PC.
Although I installed it on a hard drive (I have another hard drive for windows), my bios tells me that Linux would be on the same hard drive as Windows?? I can assure that it's not the case, as I plugged out the linux drive and grub couldn't boot Linux anymore, just windows. Plug back in, linux bootable. Ok fine?
When I installed linux I panicked for a moment, as I thought I had it correctly installed separately, instead it would have become a dual boot, according to the bios?6 -
i just learnt how much clearcase sucks the hard way. i always used git for personal projects and am used to finding a simple solution to any problem at most one stackoverflow away, i just messed up my local repo, and experienced people could not manage to undo it. i mean come on, this is a f**king versioning software, how hard can it be to delete everything local and re-pull from remote without messing up configuration files? either clearcase has some serious design shortcomings for my understanding of a versioning software, or it is so overly complicated that nobody actually knows how to revert this mistake.2
-
Robert Martin says in clean code, or maybe clean architecture, that one should separate the tests into what is hard and easy. GUI tests are hard and therefore brittle and so we should test against view models.
However on clean agile he says a story is not done until it passes automated acceptance tests which in my experience are always brittle and grow so large and brittle that things grind to a halt.
What am I missing? Are stable acceptance tests possible on the GUI? Should we test only an API?5 -
Colleague: Can you help me with something when you're not busy?
Me: TypeError: cannot concatenate 'not' and 'busy' as <status>!
I guess it doesn't help that I do my work in a non-dev environment...
On the plus side, it's very hard to be bored as a developer :)
*sigh* -
Finding a dev for our dutch team is hard. Our demands are not that big. Can be a junior or senior php guy. Bit of front end required. Any tips? How would you like to be contacted?18
-
I don't know if anyone here, who tried to answer the question for real, did not answer "my current boss" or "myself", but I am fairly certain, I still have to meet my best boss.
Had two so far and both had their flaws that are hard to deal with. -
Which is a good platform for dedicated servers, privacy-wise, and if possible (but it's not my primary goal) not too heavy on my wallet? I'm finding it hard to find something reliable that won't hand out my ass data to the first cop it sees. Which are the best companies? Also, since it would be my first time, how I recognise a bad service?1
-
I've just started to take one of those DIY Learn Chinese in "X" days.
Not sure I think I am a little confused which is hard make these different sound in Chinese or trying make sense of some of that Erlang syntax... -
It is snowing hard here in the mid-West of the States, just wish that we had 4-day work week system since 2 days is not enough in this weather. Wonder how European devs (esp in Germany) enjoy their extra 8hrs?9
-
I'm not working as a developer for money, sometimes it's hard to find the motivation to code on a recent project. The result are 10 projects that are all not finished -.-4
-
Started my first experience with Udemy yesterday. The video seems to be buffering occasionally and switching to low quality frequently which makes it hard to read what's on the screen. I'm not happy about that the least bit. Is that normal for Udemy?
Also, I bought a course for €10 that was supposedly discounted from something like €200. I assume this is a marketing trick? Do all courses always have those kinds of "discounts"?8 -
<rant>
Linux: Manjaro XFCE
I disabled WiFi in the manage networks widget because reasons.
BIG Mistake!
Fuck! Can't enable it anymore.
😱😵😭😭😭😭😭😭😭😭😭
</Rant>
<Info>
More info in case you want to help me:
Widget sais: "Wifi Disabled" in grey letters and not clickable.
Googled around, debug info:
$ip list
wlp3s0 ... State DOWN
$ip link enable wlp3s0
Error: locked by RF-Kill
$rfkill list
....
1: phy0
Soft lock yes
Hard lock no
$ rfkill unblock 1
$ rfkill list
1: phy0
Soft lock no
Hard lock no
WiFi still disabled.
$ip link enable wlp3s0
$ip link
...
wlp3s0 ... Down
WiFi still disabled.
$ cat ..../NetworkManager/NetworkManager.status
....
Wireless ... Disabled.
Restarts case rfkill soft lock again.
The laptop is a 2015 Razer Blade 14 and does not have hardware switches or shortcuts that I know of, that dis or enable wifi, or Bluetooth.
</Info>10 -
"Easy is not to be underestimated. Easy taps the pool of talent and ideas out there that were turned off by hard." - Chris Anderson1
-
I know that you need to stop to not burn out but I have a lot of work until July 1th and I have been working like crazy since September. What can I do to not get mad before our hard deadline? 😖6
-
I'm wondering how you guys can use a laptop with keyboard that lacks something as crucial as numpad. Was it hard to get used to not having it? I'd love to replace my old Samsung Ativ Book 2 (that monstrous i3...) for a Dell XPS or something similar but seeing that it hasn't a numpad makes me wanna cry.
I'd love to hear from you, how is your experience without numpad and how long did it take to get used to.1 -
God damn...if you want to be a developer learn using git and fucking STOP messing up the repo every time you push something.
Understand the importance of branches and use 'em so the problems you're causing are isolated and stop commiting / pushing on master....ITS NOT THAT HARD TO READ THE FUCKING CONTRIBUTION GUIDELINES!!!3 -
So I have a xaml object that is designed for pagination on web pages, and the current page must be at least 1.
But the web service used for the data that go with that object starts its pagination at least at 0.
So everytime I must assure that the xaml object has 1 and the web service has 0 for the first page.
That's not hard, but that's the kind of thing that's annoying, why doing it that way -
Trying to learn AdonisJS. Looks like a really cool framework, but having a really hard time how all of it really comes together. I get the model-view-controller philosophy that Adonis abides by, but not really how it's implemented.
:(1 -
"Easy is not to be underestimated. Easy taps the pool of talent and ideas out there that were turned off by hard." - Chris Anderson
-
For learning there are a lot of sites are available. But I was not comfortable with hackerrank or geeksforgeeks etc. Finally I found a website edabit.com that was totally free. It is amazing site and it helps me a lot for understanding JS method like map, filter etc. Now I have started solving hard problems too :)1
-
Not really a rant and only slightly related to development (getting paid, that is). The GBP is crashing, hard crashing.
https://www.dailyfx.com/gbp-usd -
Today it took me *five* commits and nearly 2 hours to tidy up a module before doing a tiny 5-minute change.
I could have just done my change but that thing was so messy, I first had to straighten things up.
It's not that I didn't expect that, the module was mainly done by my dearest co-worker who's code usually causes me anaphylactic shocks.
But I'm always amazed how hard it can be to follow a style guide, and ours is really small anyway.2 -
Just started on an IT company as my first job and I trully like it, But I believe that this is not what I am looking for in my career. The company is too big and I have the feeilng that growing is going to be hard in here.
I am thinking about applying for a systems and software engineering company, I know it won't be easy to get hired but I need to try.
Any advice on it?1 -
Lately I am facing this issue. I spend a lot of time and did hard work on some specific thing! but it doesn’t seem to work as it should be, so because of this I am disappointed. I don’t know I should be feeling like this or not, but I am questing myself that I am a good developer or not!
It’s not like that I don’t know stuff, I start working on laravel , few months ago. It’s been 4 months, and I already develop a backend of the whole app, but it was not that complex. Recently , I am assigned to this new project, which is very complex, and It was already made by some other developer, so I am new to this and I don’t know how it actually works. But I was assigned to add new functionality to it, and It was kinda complex, like maths and calculation and depending upon the data coming and updating calculations changed. So, I almost work hard and over time for this, and I think I did a good job, but turns out it didn’t. So, I worked again on this, but again turns out it didn’t work out as it suppose to be.
So , After all of my hard work, the code was not right, and that led me to question myself and I am feeling bad. Is this normal? Is it okay to feel at something?3 -
I'm a student and I love cms systems. So now I want to create my own website on top of one. I know html CSS JS and PHP. Can someone recommend a cms that is not so hard to learn? I know I will need time. But I appreciate fast solutions. They boost my motivation to move on :)9
-
I format the memory card of my PS2 with Free MC Boot. 👨🏻💻*Hackerman*
Mhe is not that hard just need to play from my HDD I'm kinda bored.
Have any game to recommend?!5 -
The professor that made us use ada. This course was in 2018. Not useful to real world and also hard af. Was a great professor good at teaching and a great guy - just the course was hard as fuck and if you were struggling it was hard to find resources.
-
Not a rant, but has anyone here had any experience developing a StyleGuide?
I'm looking at building one that could document JavaScript and AngularJS as well as CSS etc.
Having a hard time finding a generator/tool that would work.
If not I'll look into building one myself... 😬4 -
I love it when someone says they wish they could find people to stay when in reality they just want the opposite but to not seem somehow
Strange.
Which they are
More strange is the fact that they keep doing this dumb shit without enr in the ssme.way
And no they can't copy my fucking hard drives and the like here2 -
I am in my final year of CSE degree, and it's that time of the year when I have to prepare for placements. I need motivation. I need to work hard. I need to push hard. I am not sure if I can practice hundreds of coding problem. I do not find every other question interesting. Please motivate me to work hard.1
-
It's does not take a huge amount of knowledge and skill to get a program working.Kids in high school do it all the time. young men and women in college start billion-dollar business based on scrabbling together a few lines of PHP or Ruby. Hoards of junior programmers in cube farms around the world slog through massive requirements documents held in huge issue tracking systems to get their systems to "work" by the sheer force of will. The code they produce may not be pretty; but it works. It works because getting something to work-once-just is not that hard.