*computer fell, broken in pieces*

Me calling [Microsoft] tech support: hey can you check my warranty on this computer, I think I broke it?

Tech support: yes sir but we must first go through the troubleshooting steps,

Me: no, no I just-

Tech support: have you tried pressing F8 sir?

Me: umm… no, look I'm just -

Tech support: sir please press the F8 key sir

Me: okay… I pressed it, now can you just check my-

Tech support: sir please what happened when you pressed F8?

Me: it's broken, now if you could just check my warranty -

Tech support: sir I'm sorry sir I think you did it wrong. Please press F8

Me: no just check my-

Tech support: sir I think you do not understand, sir it is at the top-

Yup.

Father bought a PC in 1997. Back then very few had it. I learned doing things like accessing the internet and sending emails, among others. I remember having added age on websites to be allowed to sign up at times :P My sisters used to play games on it sometimes. The first few ones we had were Tomb Raider: The Last Revelation, Tomb Raider Chronicles, American McGee's Alice(Which caused us to upgrade the PC xD)... And some others.

I have a memory of this pseudo-3D-looking game where you move in a maze and try answering questions. I want to remember its name, but I cannot :(

We literally have video evidence of me liking the computer as a child, yet my parents either say I'm addicted or deny I've ever liked it before. Not only that, but continuously limiting my time with the PC hasn't been a literal obstacle in my way of trying to do things in their opinion. Funny how my parents think the last few years I've been my worst when they've hurt me in those years so much that our relationship is guaranteed not working out. There were doubts in my head before, but now it's cemented and there is no way of going back. Father, for example, tells me it's too late to do anything with a PC now(As well as how I've been unable to use the PC. He looks at these pro players' footage in some TV show and he's like, „You've been unable to use your hobbies“, as if they have never ever screamed at me for perceived gaming and not actually cared to check), and I need to look for a „real“ job.

Sorry. I went to bed at 2:00 in the morning. Feel like a zombie because of ongoing weirdly insufficient sleep, even though I sleep kinda more than normal. Even when I took Melatonine for that it didn't help at all.

Childhood was where beating began. I was about 6/7. Right when I entered school. The first school that I attended was a private one and supposedly for „Wunderkinds“, while in reality I haven't seen a SINGLE teacher or psychologist approve of it, their argument being that children were basically drowned in work that wasn't age-appropriate(I don't mean anything bad. Just that teaching about Galaxies and all in first grade isn't the brightest idea). There was always a mountain of homework to do and as opposed to some other countries, we had to do it on a day to day basis. We didn't have a week-long deadline. I was predictably not keeping up with it as I could have, had it been a normal amount, so my parents decided I didn't want to study and began their methods of getting me to „study“. I have yet to see a person able to keep up with that school's tempo, no matter the age.

This place was also where I got bullied. I felt I had nowhere to be: At home, the parents' situation, at school, the bully. I never really went outside to play with other children, so I missed that part of childhood.

After the second year of school I was transferred to an advanced German school, called like that because they taught German and not English there. I also got to learn a bit of Russian before they removed it from school. In that period I used to attend ballet. But for less than a year. And piano, which I remember having attended for quite a long while, some years, if my memory isn't fried. I quit it because of it having been forced on me. Last piece I ever played fully was Beethoven's Marmotte.

In this school I was once again the outcast of the class. I had some people to interact with. All of those interactions lasted a few years at most. Then, because of a part of my class choosing me as a laughing-stock N2 and another girl as the N1, I found my best friend, who I still have today. She's the only friend I have nearby.

Most of the time I hated myself. Even today I struggle with that sometimes.

After that came university. This us where I got something like a friend circle at last. But it still didn't last. I got in a relationship with one of the guys, but I was just attracted. There was another I couldn't dare getting close to. Turns out he also had something for me. Then he disappeared from our lives and a year after, I still cannot forget the person. If I want to, I have to deprive myself of my own personality. Not a thing I'm willing to give up. Then I broke up with the guy I was in a relationship with and completely disappeared from the friendship circle. To be honest, I had reasons to. They refused to even try to look for the guy and they called him a friend for years. Sometimes parents hitting me can occur even today, but if I REALLY piss them off.

Now I'm here and oh, my God, I'm officially am aunt now! My sister gave birth to a daughter this morning... She's in Berlin with mother and both she and the child are doing great. I just hope she manages to be a good mother.

The problem with being a programmer...

I just broke up with a girl I've been seeing the past 2 months, that I was really into.

But in the end, it became a question of, either i'm with her, or I'm with my work.

I don't think that would happen with other professions, at least, not as easily.

I think, with other professions or projects, you tell someone "I need to work" and it's really fucking understood. "Ok, you need to work"

They understand it. If I was a lawyer.. I have a case. if I was a carpenter, I have a wall to build,
or a house. Etc. All understood things. Or physical things that can be seen.

But with programming, first of all, I work my own hours, I write software and then sell it. I do it all myself, I own my own business. I don't have normal hours like a job, but I do know my requirements, which is at LEAST 8 hours a day of solid, uninterrupted work.

If I had a "job" it would be like "gotta go to work" and that would be it.

But, because I work for myself, and because the things I build, aren't like something you physically see, nobody gets it.

My parents, as supportive as they are, will never understand how I just implemented a new design pattern and like, leveled up because of it.

They see software... buttons, and even then, when I try to explain what excites me, it's like trying to get a 3 year old interested in calculus.

How could they possibly understand the richness of what I do, how fulfilling it is
and how much I love it, when all they see
is me on a computer, clicking keys.

The same for this girl I dated.

The only place I feel where people understand,
is here.

Do you have any similar experiences to share?
Would love to hear it right now.

I'm not an iOS expert, I just wanted to get Google ads on my iOS app so that I could make a few petty dollars at the expense of my users. Is that too much to ask?

I started by following Google's instructions: install cocoapods, copy and paste some swift code... Compile failed, app broke. Carefully retrace my steps. Nothing.

Stackoverflow (praise be with them) suggests upgrading Xcode. Go to app store and click to upgrade Xcode. No progress bar, no status updates, just that pissy little spinner for several minutes. I become impatient try a few more times. It ain't happening.

Stackoverflow (holy of holies, defender of the weak) points me to an alternate source for Xcode, on the app store dev console. 4GB and some time later, an attempt to unzip gives "unknown error". Genocide of sorts.

Stackoverflow (all that is pure, all that is kind, all... I think you get it) says upgrade your OS. I tried months ago but I had issues with that pissy little spinner. Persist. 5GB and a "heavy-year" of time later (sorry), it installs. Then Xcode installs. Then bar a few errors, the app compiles.

So after almost 24 hours, life resumes. The lesson.. respond to all obscure iOS errors by upgrading. If fully upgraded, calmly acquire a baseball bat and destroy your machine. Make sure you have a good book nearby in case of either event.

Thank you for reading my rant. Now if you'll excuse me, I have to pay Apple
$150 so that I may list my app in the app store.

This is how I feel most of my client proposal start:

* It's simple, I'd like to re-invent <the wheel>.

* All I want to do is use <rocketship engine> on <old typewriter>.

* I'm too cheap to hire a full-time < DBA, DevOps engineer, development team>. Can I pay you pennies?

* I'm poor and broke, can you do this for free?

* I'd like to <commit illegal act> and be <legal compliant standard>.

* I heard it was possible to <fly 30 people to the moon> using <Ford Model-T>. Please do this for us.

* I <sold my house>, but now <I'm locked out by the new owners>. Please help.

This rant is a confession I had to make, for all of you out there having a bad time (or year), this story is for you.

Last year, I joined devRant and after a month, I was hired at a local company as an IT god (just joking but not far from what they expected from me), developer, web admin, printer configurator (of course) and all that in my country it's just called "the tech guy", as some of you may know.

I wasn't in immediate need for a full-time job, I had already started to work as a freelancer then and I was doing pretty good. But, you know how it goes, you can always aim for more and that's what I did.

The workspace was the usual, two rooms, one for us employees and one for the bosses (there were two bosses).

Let me tell you right now. I don't hate people, even if I get mad or irritated, I never feel hatred inside me or the need to think bad of someone. But, one of the two bosses made me discover that feeling of hate.

He had a snake-shaped face (I don't think that was random), and he always laughed at his jokes. He was always shouting at me because he was a nervous person, more than normal. He had a tone in his voice like he knew everything. Early on, after being yelled for no reason a dozen of times, I decided that this was not a place for me.

After just two months of doing everything, from tech support to Photoshop and to building websites with WordPress, I gave my one month's notice, or so I thought. I was confronted by the bosses, one of which was a cousin of mine and he was really ok with me leaving and said that I just had to find a person to replace me which was an easy task. Now, the other boss, the evil one, looked me on the eye and said "you're not going anywhere".

I was frozen like, "I can't stay here". He smiled like a snake he was and said "come on, you got this we are counting on you and we are really satisfied with how you are performing till now". I couldn't shake him, I was already sweating. He was rolling his eyes constantly like saying "ok, you are wasting my time now" and left to go to some basketball practice or something.

So, I was stuck there, I could have caused a scene but as I told you, one of the bosses was a cousin of mine, I couldn't do anything crazy. So, I went along with it. Until the next downfall.

I decided to focus on the job and not mind for the bad boss situation but things went really wrong. After a month, I realised that the previous "tech guy" had left me with around 20 ancient Joomla - version 1.0 websites, bursting with security holes and infested with malware like a swamp. I had never seen anything like it. Everyday the websites would become defaced or the server (VPN) would start sending tons of spam cause of the malware, and going offline at the end. I was feeling hopeless.

And then the personal destruction began. I couldn't sleep, I couldn't eat. I was having panick attacks at the office's bathroom. My girlfriend almost broke up with me because I was acting like an asshole due to my anxiety issues (but in the end she was the one to "bring me back"(man, she is a keeper)) and I hadn't put a smile on my face for months. I was on the brink of depression, if not already there. Everyday I would anxiously check if the server is running because I would be the one to blame, even though I was trying to talk to the boss (the bad one was in charge of the IT department) and tell him about the problem.

And then I snapped. I finally realised that I had hit rock bottom. I said "I can't let this happen to me" and I took a deep breath. I still remember that morning, it was a life-changing moment for me. I decided to bite the bullet and stay for one more month, dealing with the stupid old server and the low intelligence business environment. So, I woke up, kissed my girlfriend (now wife), took the bus and went straight to work, and I went into the boss's office. I lied that I had found another job on another city and I had one month in order to be there on time. He was like, "so you are leaving? Is it that good a job the one you found? And when are you going? And are you sure?", and with no hesitation I just said "yup". He didn't expect it and just said "ok then", just find your replacement and you're good to go. I found the guy that would replace me, informing him of every little detail of what's going on (and I recently found out, that he is currently working for some big company nowadays, I'm really glad for him!).

I was surprised that it went so smoothly, one month later I felt the taste of freedom again, away from all the bullshit. Totally one of the best feelings out there.

I don't want to be cliche, but do believe in yourself people! Things are not what the seem.

With all that said, I want to give my special thanks to devRant for making this platform. I was inactive for some time but I was reading rants and jokes. It helped me to get through all that. I'm back now! Bless you devRant!

I'm glad that I shared this story with all of you, have an awesome day!

There are times when being "friendly neighbor it guy" pays back.
I have a neighbors, their son is little less intelligent than average person after being injured in accident, I help them from time to time. He gets the pc trashed with adware, usual stuff, they ask me to clean it up.

Recently I broke my arm. They offered to cook for me until I recover to full health... Seriously, that's huge help when you live alone and spend most time working. I'm glad to have them.

Wanted to share with you guys, there are people who appreciate your help with their pc and can give back if you're in need.

To replace humans with robots, because human beings are complete shit at everything they do.

I am a chemist. My alignment is not lawful good. I've produced lots of drugs. Mostly just drugs against illnesses. Mostly.

But whatever my alignment or contribution to the world as a chemist... Human chemists are just fucking terrible at their job. Not for a lack of trying, biological beings just suck at it.

Suiting up for a biosafety level lab costs time. Meatbags fuck up very often, especially when tired. Humans whine when they get acid in their face, or when they have to pour and inhale carcinogenic substances. They also work imprecisely and inaccurately, even after thousands of hours of training and practice.

Weaklings! Robots are superior!

So I replaced my coworkers with expensive flow chemistry setups with probes and solenoid fluid valves. I replaced others with CUDA simulations.

First at a pharma production & research lab, then at a genetics lab, then at an Industrial R&D lab.

Many were even replaced by Raspberry Pi's with two servos and a PH meter attached, and I broke open second hand Fischer Sci spectrophotometers to attach arduinos with WiFi boards.

The issue was that after every little overzealous weekend project, I made myself less necessary as well.

So I jumped into the infinitely deep shitpool called webdev.

App & web development is kind of comfortable, there's always one more thing to do, but there's no pressure where failure leads to fatalities (I think? Wait... do I still care?).

Super chill, if it weren't for the delusion that making people do "frontend" and "fullstack" labor isn't a gross violation of the Geneva Convention.

Quickly recognizing that I actually don't want to be tortured and suffer from nerve damage caused by VueX or have my organs slowly liquefied by the radiation from some insane transpiling centrifuge, I did what any sane person would do.

Get as far away from the potential frontend blast radius as possible, hide in a concrete bunker.

So I became a data engineer / database admin.

That's where I'm quarantining now, safely hiding from humanity behind a desk, employed to write a MySQL migration or two, setting up Redis sorted sets, adding a field to an Elastic index. That takes care of generating cognac and LSD money.

But honestly.... I actually spend most of my time these days contributing to open source repositories, especially writing & maintaining Rust libraries.

This happened when I was on third semester of the career at university. I had my first boyfriend, the "Python" guy. He has that nickname because he used Python as his main programming language and nobody on the classroom used it.

In a few words, he was a... horrible human being. He talked down to me almost all the time, saying to me that my country was sh*t (he is from United States, and for a reason he never wanted to told me, he cannot go back to his country), that my university was sh*t and he said "you're will be lucky if you rot programming in a chair".

As you might wondering, yes, unfortunately it was a toxic relationship. Once he said he wanted to kill the teacher because he though that he hacked his laptop D:

He claimed that he was going to teach me python and security stuff, bla bla bla, but nothing. I learned python by my own.

I almost lost my faith in dev future because I though that the only ones that could have a real future in programming where people without ethics and only if they have a friend or a relative on a company.

The saddest part was that I dated him because I love smart boys, but he was just an idiot that, furthermore, wanted to change me (he pressured me to have tattoos, dye my hair and have sex, things that, of course, I didn't do).

I found courage to break up with him. I waited until the semester ends (in order not to lose my programming final projects) and, the day after the last day of class, I broke up with him.

I recovered my faith on programming when, next semester, one of the teachers invited me to give a python programming workshop :D and I gave two python workshops, and two of mobile development.

Now I'm working as a junior .NET developer. Thank God I broke up with him before the relationship became even worse. "Python" wanted to marry me after a year! O_O

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Discussion between me and my N+1
(Note : I'm in the company for 3 months)

Me : As the tech leader, shouldn't you review my code ?
N+1 : I'm not the tech leader.
Me : Wait what ?
N+1 : I wrote the app from A to Z, hence I'm the architect.
Me : That's what I mean. Being the most knowledgable dev in the company makes you de facto tech leader.
N+1 : No, I'm not the tech leader. The CEO is.
Me : But he didn't even know the tech we are using !
N+1 : .... Anyway, I won't do code reviews. I don't like that.

(2 hours later)

N+1 : You made a mistake in the code. You broke a hidden functionality. You should be more careful, or ask me if you have doubts.

This guy is collector.

Looks like I'm getting fired on Wednesday :)

Long story:

*I add first unit tests to project.

*Boss adds new functionality and breaks all the tests so I can't compile and write more for what I'm working on.

*Boss is very fragile and cannot handle any comment that can possibly be taken as a slight against him.

Me: "I wanted to ask what our policy on unit tests is please? Because we haven't really said how we are treating unit tests, and everyone myself included is not thinking about them. I also haven't added tests when I fixed bugs and this time your changes broke the tests"

Boss 10 minutes later: "I want to speak to you in private".

Boss: "you are too forceful and direct. You said I should have added tests."

Me: "yeah but I didn't mean in a nasty way"

Boss getting louder and more aggressive: "You are too forceful"

Me: "I didn't mean it in a bad way"

Boss: "I didn't want to add tests for that!"

Me: "then why add any tests?"

Boss: "Fine we are not having this conversation now!"

*Boss storms out

I decided I can't speak to the guy about anything without upsetting him spoke to the manager before I quit because I can't work like this.

That resulted in a meeting with my boss, his boss and the head of HR where I ended up savaging him and told them I can't bring up anything as I can never tell if it will offend him and that I spend ages writing emails and trying to document communications because I just can never tell if I will upset him. Also that I cannot bring up any ideas because I can't tell if he will somehow get offended and that I can't even write code because if I change something he wrote at some point he will get angry.

My boss claims that I am extremely forceful and disrespectful and that I am constantly insulting him and his decisions.

We go back over a ton of shit and I refute everything he says. In the end I have to have a meeting with him on Wednesday where we either get things straight, he fires me or I quit.

I think at this point that our relationship is too fucked for him to be my team lead on a 6 man team.

Side note I keep bringing forth ideas because we have one database shared between 6 Devs, no pull requests (apart from mine and another new guy), no test driven development, no backlog, no team driven story pointing, no running tests before merging, no continuous integration setup, no integration tests, no build step on merge, no idea of if we are on track to our deadline other than his gut feeling, no actual unit tests backend - just integration with a test db, no enthusiasm to learn in the team and no hope.

Currently on an internship, PHP mostly, little bit of Python and the usual web stuff, and I just had the BEST FUCKING DAY EVER.

Wake up and find out I'm out of coffee, oh boy here we go.

Bus leaves 10 minutes late, great gonna miss my train.

Trains just don't wanna ride today, back in a bus I go, what's normally a 10 minute train travel is now a 90 minute bus ride.

Arrive at internship, coffee machine is broke, non problem, I'll just lose it slowly.

NOW HERE COMES THE FUCKING GOOD PART!!

Alright, so I'm working on a CMS that can be used just about on any device you want, mobile or desktop, it's huge, billion's of rows of scientific data. Very specific requirements and low error margins. Now, yesterday I was really enjoying myself here until today, Project manager walks in, comes to my desk and hands me a Samsung Gear S3, an Apple watch and some cheap knockoff. He tells me that before the Friday deploy, THE ENTIRE CMS SHOULD WORK ON THOSE WATCHES!

I mean, don't get me wrong, I like a challenge but it's just not right, I mean, I'm still not sure what the right way to handle tables on phones is, but smart watches, just no. Besides that, I've never worked with any Apple devices, let alone WatchOs, nor have I worked with Android Wear.

Also, Project Manager is a total dickhead, he's the kinda guy that prefers a light theme, doesn't clean up his code, writes 0 documentation for an API, 1 space = tab, pure horror.

So after almost flipping my desk, I just called my school coach to announce I'm leaving this internship. After a brief explanation he decides to come over, and guess what, according to the Project Manager I wasn't supposed to do that, I was supposed to test if it would be possible.

FUCKING ASSFUCKFACE

"Arch Linux is actually not that difficult".

I ssh'ed into my home server yesterday.

I was greeted by a message from an ext3 disk about needing fsck. Fine, "I haven't been in here for a while, might as well do some maintenance". fsck /dev/sda6, let's go!

This nicely "repaired" the sshd service (i.e. cleared the sectors), I cursed at myself for pressing enter at "repair (y)" right before the connection broke.

So I connected a display and keyboard... ok so let's just pacman -Sy sshd or whatever. We can do this! Just check the wiki, shouldn't be that hard!

Wait... pacman has not run since 2010? WAIT IT'S ACTUAL UPTIME IS 9 YEARS??? I guess we know why I'm a DB admin and not devops...

Hmm all the mirrors give timeouts? Oh. The i686 processor architecture isn't even supported anymore...?

4 hours, 11 glasses of cognac, 73 Arch32 wiki/forum pages, 2 attempts at compiling glibc, and 4 kernel panics later: "I think I'll buy a new server".

Living in a tiny house and having a remote-only job (and no lappy) means I get the wonderful, lovely privilege of working in my bedroom... with my 18mo (who will not leave me alone), and my girlfriend (who won't fucking leave). It's positively great!

Blasting music is often not enough to drown out the sound, and certainly does nothing for getting hit with toys or screamed at to get picked up, so I get basically nothing done during the day. And that's presupposing I'm not begged to run errands/go to lunch with her, both of which take precious hours. (She won't take the baby out alone, so she's always here unless we find a babysitter)

At least it's quiet after 9pm, so I stay up coding for as long as I can. But 18mo's wake up super early, and the girlfriend prefers to stay in the room until I'm up... so even with earplugs I don't get enough sleep. A monster a day and a bottle of Tito's vodka a month is all that keeps me sane.

Why can't I just be fucking left alone to fucking work? I'm our only goddamn source of income.

It's no wonder we're fucking broke.

And to make matters worse, I'm being downsized... and considering the above, I doubt I'll be able to land a new job. 😡

So there it fucking goes.

Hi. I'm WillibertXXIV.
I'm not a programmer by trade; I have a more than fulltime job as a cook. As for the last year, I spent pretty much all my free time, overlapping my sleep time, to learn how to code.

All that so I can create a game that I started working on the same day I started my learning process. So far it's shit and it's going to stay that way for a long time. Only I can say this. It's my baby. It's fucking ugly and shit but it's mine.

Yesterday I broke it. I broke my baby. I don't know how it fucking happe. When I went to sleep I had a steady 175fps, nice realtime lightning and player / enemy that flowed like running water. I worked really hard to make that happened. Profiling, writing better code, profiling, etc. It's still not good, it's less shit.

I woke up, beautiful day. Not too warm, not too cold, that sweet spot right in the middle. Girlfriend already made the coffee. Perfect. Woke up, sat down to start my morning time work before going to my realjob and

BAM

Everything is shit, 20fps max. That one thing, gfx.waitforpresent, showing up in the profiler eating everything as the game run. Movements are now of stroboscopic nature. Light is still ok but what good does it do now fucking piece of shit. I'm not qualified enough for this shit.

Fuck,
Fuck this,
Fuck this shit,
Fuck this shit i'm out of here.

Ranting time;

Yeah so OK this ancient legacy clusterfuck we've been maintaining and keeping alive finally broke. And even though I'm very pleased with both being right, and the well deserved right to say I TOLD YOU SO, SO MANY MANY FUCKING TIMES to all in management, it's the definition of hate to work 18 hours a day to fix the shit someone else built, that they refused us to refactor. Ah, but wait; there's more! Everyone thinks it's our fault (R&D), because historically it was our department that built the system. Ten years ago. So sales and support are now all over us, those responsible for us being in this mess are either gone or so high up in management that they refuse to take part.

Taking the fall and blame and workload, for something we warned repeatedly about, but were refused to do something with, because shiny features and new apps is what is important!

I'd understand it if the numbers were red, but they arent!! We are growing so fast it was inevitable!

I fucking hate companies who dont listen to their devs..... also companies who places ops on dev shoulders.

Yaaaargh! Also; two developers means twice as fast? No? Fuuuuuck!!!

Finally got a job. The process was quick af! Hired in like a hour.

At least now I can't be homeless.

But I'm getting married Saturday, so this means one thing:

I'm a have to work while on honeymoon hahahah

My girl gonna be pissed but glad that I'm not broke

What is the most ridiculous over-the-top "startup" thing you've been the victim of as a developer?

Alternatively, what kind of weird startup luxury would you absolutely love to have at your company?

For me, at various companies I've worked at/visited:

1. Hammocks & fatboy beanbags. Current employer has a "Netflix & Chill" corner with nice couches, and a small gym. I have encountered isolation/flotation tanks at the office of one of our partners... which is cool, but over the top in my opinion.

2. A fully automated aquaponics garden in the lunchroom. Was awesome, until some fish died and started to rot.

3. One hoverboard per employee, at previous employer. I splashed hot chocolate milk in an arc over three desks. A coworker broke his ankle while watching me spill chocolate milk.

4. Daily scrum standup meetings, on socks, in a big bouncy castle. Not kidding. Fucking ridiculous... (but secretly fun). That employer also had spiral slides between all floors, a tiny half-pipe with tiny skateboards, and someone who rode a unicycle way too much. It was a fucking circus. Stuck in the office of a Fintech company.

5. Soldering bench (at my current company), with drawers full of breadboards, servos and electronics components. Completely unrelated to my work, but it was my idea. It's just great to build a simple kits together with another random coworker while brainstorming platform features & refining specs... much better than meetings with bullshit slides.

6. Unlimited energy drink. Developed a serious caffeine habit (15-20 cans a day), and almost got a stomach ulcer. Not beneficial to employee health.

7. I really do love working from home + unlimited holidays. Just being able to honestly say "fuck you guys, I'm gonna get drunk and play games today", and at other times working until 4am and sleeping in the next day, or taking a week to work in a park in Rome... It makes work truly feel like my favorite hobby. Combined with a good sprints and curious/ambitious people, you can easily track productivity anyway.

I've had many, but this is one of my favorite "OK, I'm getting fired for this" moments.

A new team in charge of source control and development standards came up with a 20 page work-instruction document for the new TFS source control structure.
The source control kingpin came from semi-large military contract company where taking a piss was probably outlined somewhere.

Maybe twice, I merged down from a release branch when I should have merged down from a dev branch, which "messed up" the flow of code that one team was working on.
Each time I was 'coached' and reminded on page 13, paragraph 5, sub-section C ... "When merging down from release, you must verify no other teams are working
on branches...blah blah blah..and if they have pending changes, use a shelfset and document the changes using Document A234-B..."

A fellow dev overheard the kingpin and the department manager in the breakroom saying if I messed up TFS one more time, I was gone.

Wasn't two days later I needed to merge up some new files to Main, and 'something' happened in TFS and a couple of files didn't get merged up. No errors, nothing.
Another team was waiting on me, so I simply added the files directly into Main. Unknown to me, the kingpin had a specific alert in TFS to notify him when someone added
files directly into Main, and I get a visit.

KP: "Did you add a couple of files directly into Main?"
Me:"Yes, I don't what happened, but the files never made it from my branch, to dev, to the review shelfset, and then to Main. I never got an error, but since
they were new files and adding a new feature, they never broke a build. Adding the files directly allowed the Web team to finish their project and deploy the
site this morning."
KP: "That is in direct violation of the standard. Didn't you read the documentation?"
Me: "Uh...well...um..yes, but that is an oddly specific case. I didn't think I hurt any.."
KP: "Ha ha...hurt? That's why we have standards. The document clearly states on page 18, paragraph 9, no files may ever be created in Main."
Me: "Really? I don't remember reading that."
<I navigate to the document, page 18, paragraph 9>
Me: "Um...no, it doesn't say that. The document only talks about merging process from a lower branch to Main."
KP: "Exactly. It is forbidden to create files directly in Main."
Me: "No, doesn't say that anywhere."
KP: "That is the spirit of the document. You violated the spirit of what we're trying to accomplish here."
Me: "You gotta be fracking kidding me."

KP grumbles something, goes back to his desk. Maybe a minute later he leaves the IS office, and the department manager leaves his office.

It was after 5:00PM, they never came back, so I headed home worried if I had a job in the morning.

I decided to come in a little early to snoop around, I knew where HR kept their terminated employee documents, and my badge wouldn't let me in the building.

Oh crap.

It was a shift change, so was able to walk in with the warehouse workers in another part of the building (many knew me, so nothing seemed that odd), and to my desk.

I tried to log into my computer...account locked. Oh crap..this was it. I'm done. I fill my computer backpack with as much personal items as I could, and started down the hallway when I meet one of our FS accountants.

L: "Hey, did your card let you in the building this morning? Mine didn't work. I had to walk around to the warehouse entrance and my computer account is locked. None of us can get into the system."

*whew!* is an understatement. Found out later the user account server crashed, which locked out everybody.

Never found out what kingpin and the dev manager left to talk about, but I at least still had a job.

THIS is a good BIOS. I just got this thinkpad (since the screen in the one I had broke) and I was like "I'm going to use always fn as ctrl" and I see this. Thank you thinkpad

Ok story of my most most recent job search (not sure devRant could handle the load if I was to go through them all)

First a little backstory on why I needed to search for a new job:

Joined a small startup in the blockchain space. They were funded through grants from a non-profit setup by the folks who invented the blockchain and raised funds (they gave those funds out to companies willing to build the various pieces of the network and tools).

We were one of a handful of companies working on the early stages of the network. We built numerous "first"s on the network and spent the majority of our time finding bugs and issues and asking others to fix them so it would become possible, for us to do what we signed up for. We ended up having to build multiple server side applications as middleware to plug massive gaps. All going great, had a lot of success, were told face to face by the foundation not to worry about securing more funds at least for the near term as we were "critical to the success of the network".

1 month later a bug was discovered in our major product, was nasty and we had to take it offline. Nobody lost any funds.

1-2 months later again, the inventor of the blockchain (His majesty, Lord dickhead of cuntinstein) decided to join the foundation as he wasn't happy with the orgs progress and where the network now stood. Immediately says "see that small startup over there ... yeah I hate them. Blackball them from getting anymore money. Use them as an example to others that we are not afraid to cut funds if you fuck up"

Our CEO was informed. He asked for meetings with numerous people, including His royal highness, lord cockbag of never-wrong. The others told our CEO that they didn't agree with the decision, but their hands were tied and they were deeply sorry. Our CEO's pleas with The ghost of Christmas cuntyness, just fell on deaf ears.

CEO broke the news to us, he had 3 weeks of funds left to pay salaries. He'd pay us to keep things going and do whatever we could to reduce server costs, so we could leave everything up long enough for our users to migrate elsewhere. We reduced costs a lot by turning off non essential features, he gave us our last pay check and some great referrals. That was that and we very emotionally closed up shop.

When news got out, we then had to defend ourselves publicly, because the loch ness moron, decided to twist things in his favour. So yeah, AMAZING experience!

So an unemployed and broken man, I did the unthinkable ... I set my linkedin to "open to work". Fuck me every moronic recruiter in a 10,000 mile radius came after me. Didn't matter if I was qualified, didn't matter if I had no experience in that language or type of system, didn't matter if my bio explicitly said "I don't work with X, Y or Z" ... that only made them want me more.

I think I got somewhere around 20 - 30 messages per week, 1 - 2 being actually relevant to what I do. Applied to dozens of jobs myself, only contacted back by 1, who badly fucked up the job description and I wasn't a fit at all.

Got an email from company ABC, who worked on the same blockchain we got kicked off of. They were looking for people with my skills and the skills of one other dev in the preious company. They heard what happened and our CEO gave us a glowing recommendation. They largely offered us the job, but both of us said that we weren't interested in working anywhere near, that kick needing prick, again. We wanted to go elsewhere.

Went back to searching, finding nothing. The other dev got a contract job elsewhere. The guy from ABC message me again to say look, we understand your issues, you got fucked around. We can do out best to promise you'll never have to speak to, the abominable jizz stain, again. We'll also offer you a much bigger role, and a decent salary bump on top of that.

Told them i'd think about it. We ended up having a few more calls where they showed me designs of all the things they wanted to do, and plans on how they would raise money if the same thing was to ever happen to them. Eventually I gave in and signed up.

So far it was absolutely the right call. Haven't had to speak to the scrotum at all. The company is run entirely by engineers. Theres no 14 meetings per week to discuss "where we are" which just involves reading our planning tool tickets, out loud. I'm currently being left alone 99% of the week to get work done. and i'm largely in-charge of everything mobile. It was a fucking hellhole of a trip, but I came out the other side better off

I'm sure there is a thought provoking, meaningful quote I could be writing now about how "things always work out" or that crap. But remembering it all just leaves me with the desire to find him and shove a cactus where the sun don't shine

.... happy job hunting everyone!

Root encounters HR at her new job.

So, I left my job a few weeks ago. I was pretty sad about it, so I didn't want to write anything about it. It was a great place to work, with great managers, decent coworkers, and interesting work. I also had free reign over how I built things, what to improve, etc. Within about four months, I authored over half of the total commits on their backend repo, added a testing suite with 90% coverage, significantly improved the security (more accurately: added security), etc. but I got a job offer that allowed me to work remotely, and make well over six figures (usd). I couldn't turn it down, even though I wanted to. So, I left. I'm still genuinely sad about that. I had emotions and everything. 🙁 I stayed on long enough to finish the last of the features for their new product launch, and make sure everything was stable. I'm welcome back whenever, though they don't want to have remote employees, and I want to move, so. that's probably not going to happen. sigh.

Anyway, I started my new job this week. Rented an office (read: professional closet) and everything! It's been veritable mountains of HR paperwork so far. That's all I've done besides some accounts setup. I've seriously only worked on and completed one ticket so far in two and a half days, and I still have six documents/contracts to sign! (and benefits; that'll probably take my weekend.)

But getting an I9 thing notarized? Apparently I only have three days before I'm legally unemployable by them or something, idk. HR made it sound ridiculously dire and important, and reminded me like five or more times. I figured it was just some notary service; that takes like 10 minutes, right? So I put it off until my second day so I didn't have to disappear in the middle of my first day. Anyway, I called a bunch of notary services on day 2, and apparently only like 5% of them both do notary services this time of year and aren't booked full. And of those, probably another 5% will notarize I9 documents.. No idea why it's rare, but whatever, I'm not a notary.

The HR lady assured me that I didn't need any special documents; I should just go there, present my IDs, and the notary will provide or draft documents for everything else. Totally doesn't sound right, but fine; I'm not a notary nor will I ever work in HR, so I'm not very knowledgeable about this. So, against my better judgement I decided to just go anyway. I called around and finally found a place that wasn't closed, busy, or refusing, and drove over there. Waited. Waited. Waited. Notary lady was super slow in every single action. (I should mention that it's now 10am, and I have a meeting with the Senior VP of Engineering [a stern, stubborn old goat who enjoys making people feel inadequate] at 12:30pm.) The notary lady looks like she's an npc updating in slow motion (maybe at 0.25x speed?) and can't seem to understand what I need. Eventually, she tells me exactly what I had assumed: if there's no document, she can't notarize said document, and she doesn't have an I9 for the company I'm trying to work for. (like, duh.) So I thank her for proving the flow of time is variable, which she ignores in slow motion, and drive back home. It's now about 11.

I message the same HR lady, and the useless wench gawks in surprise and says she's never heard of that ridiculous request before. It took prodding to get her to respond every time, but after some (very slow) back and forth, she says she wants to call the notary personally and ask what they need. I waited around for another response that never came, and eventually just drove to the notary place again to have them notarize the required ID documents. That plus my chat history with HR should be enough to show that I bloody well tried, and HR just shit the bed instead. I finally got them notarized at like 12:10, and totally broke the speed limit the entire way to the office, found the last remaining parking spot, and made it to my office just in time for the meeting. seriously, less than two minutes to spare. Meeting was interesting (mostly about security), but totally made me facepalm, shout "Seriously!? What the hell are you thinking!?" and make slapping motions at some of the people talking. I will probably rant about that next.

But anyway, I'm willing to bet that the useless wench won't get back to me before the notary closes, if at all, and will somehow try to blame it completely on me if I bring it up again. Passive aggressive bitch. She's probably thinking: "If I don't help her with these mandatory legal processes, it'll be her fault she didn't get them done in time. I mean, they're so easy! She's just doing it wrong." I fucking hate HR.

Every step of this project has added another six hurdles. I thought it would be easy, and estimated it at two days to give myself a day off. But instead it's ridiculous. I'm also feeling burned out, depressed (work stress, etc.), and exhausted since I'm taking care of a 3 week old. It has not been fun. :<

I've been trying to get the Google Sheets API working (in Ruby). It's for a shared sales/tracking spreadsheet between two companies.

The documentation for it is almost entirely for Python and Java. The Ruby "quickstart" sample code works, but it's only for 3-legged auth (meaning user auth), but I need it for 2-legged auth (server auth with non-expiring credentials). Took awhile to figure out that variant even existed.

After a bit of digging, I discovered I needed to create a service account. This isn't the most straightforward thing, and setting it up honestly reminds me of setting up AWS, just with less risk of suddenly and surprisingly becoming a broke hobo by selecting confusing option #27 instead of #88.

I set up a new google project, tied it to my company's account (I think?), and then set up a service account for it, with probably the right permissions.

After downloading its creds, figuring out how to actually use them took another few hours. Did I mention there's no Ruby documentation for this? There's plenty of Python and Java example code, but since they use very different implementations, it's almost pointless to read them. At best they give me a vague idea of what my next step might be.

I ended up reading through the code of google's auth gem instead because I couldn't find anything useful online. Maybe it's actually there and the past several days have been one of those weeks where nothing ever works? idk :/

But anyway. I read through their code, and while it's actually not awful, it has some odd organization and a few very peculiar param names. Figuring out what data to pass, and how said data gets used requires some file-hopping. e.g. `json_data_io` wants a file handle, not the data itself. This is going to cause me headaches later since the data will be in the database, not the filesystem. I guess I can write a monkeypatch? or fork their gem? :/

But I digress. I finally manged to set everything up, fix the bugs with my code, and I'm ready to see what `service.create_spreadsheet()` returns. (now that it has positively valid and correctly-implemented authentication! Finally! Woo!)

I open the console... set up the auth... and give it a try.

... six seconds pass ...

... another two seconds pass ...

... annnd I get a lovely "unauthorized" response.

asjdlkagjdsk.

> Pic related.

Here's the time an Amazon recruiter scheduled a call with me just to tell me I wouldn't be getting the job.

A few years ago, I left Uber after the seemingly non-stop public snafus they were getting themselves into (I have a lot of rants about Uber if anyone is interested, some of them mind-melting). I decided to take a two month break given that my financials looked decent for once and I was tired of 100 hour weeks.

During that time, I of course started perusing the typical job-seeking sites I had remembered from before. Somehow, from one of the profiles I set up, I caught the eye of an Amazon recruiter. They emailed me and I agreed to set up a date and time for an introductory chat.

They already had my CV. They already had my StackOverflow/Github information. This wasn't a technical interview, and the recruiter wasn't part of any of the tech teams. This is important information moving forward.

A few days later, I got the call from the recruiter. He introduced himself as the person from the emails, thanking my for my time, etc.. Things started out pleasant with the smalltalk and whatnot, but then the recruiter said "so I have some concerns about your resume".

Under one of the sections I had a list of things I was skilled with - one of which, regrettably, is PHP. Completely ignoring Java, Javascript, C# and C++ knowledge and all of the other achievements I have with those technologies, the recruiter really wanted to drill me about the PHP.

"Do you work a lot with PHP?"
"No, not anymore - from time to time I have to do something with it but it's not my main language anymore. I know it quite well, though."
"Oh okay well we aren't looking for any PHP roles right now, unfortunately."
"Okay, no problem."

Perhaps I could have said more, but from my end of things, I meant "I don't see a problem here, I don't write a lot of PHP and you don't need a lot of PHP".

After a pause that felt like an hour, the recruiter broke the silence and said "Okay well thanks for your time today, I'm sorry things didn't work out."

Bewildered, I asked which technology stack they were using on the team.

"Not PHP, unfortunately. Thank you for your time." and then an abrupt click.

The recruiter found me himself, looked at my resume (assumably), sought out to contact me, arranged a time for a call, and then called me, just to tell me I wouldn't get the position due to knowing PHP at some point in my career.

Years later, the whole interaction still shocks me. Somewhere in my drafts I have a long letter to the recruiter basically going over my entire career history explaining why his call was incredibly... well, fucking weird. Towards the end of writing it I realized it was more therapeutic for me to deal with whatever it was that just took place and that it probably wouldn't change my odds of working at Amazon.

So yeah. That's the story of the time Amazon set up a recruiting call just to tell me I wouldn't be working for them.

So, some time ago, I was working for a complete puckered anus of a cosmetics company on their ecommerce product. Won't name names, but they're shitty and known for MLM. If you're clever, go you ;)

Anyways, over the course of years they brought in a competent firm to implement their service layer. I'd even worked with them in the past and it was designed to handle a frankly ridiculous-scale load. After they got the 1.0 released, the manager was replaced with some absolutely talentless, chauvinist cuntrag from a phone company that is well known for having 99% indian devs and not being able to heard now. He of course brought in his number two, worked on making life miserable and running everyone on the team off; inside of a year the entire team was ex-said-phone-company.

Watching the decay of this product was a sheer joy. They cratered the database numerous times during peak-load periods, caused $20M in redis-cluster cost overrun, ended up submitting hundreds of erroneous and duplicate orders, and mailed almost $40K worth of product to a random guy in outer mongolia who is , we can only hope, now enjoying his new life as an instagram influencer. They even terminally broke the automatic metadata, and hired THIRTY PEOPLE to sit there and do nothing but edit swagger. And it was still both wrong and unusable.

Over the course of two years, I ended up rewriting large portions of their infra surrounding the centralized service cancer to do things like, "implement security," as well as cut memory usage and runtimes down by quite literally 100x in the worst cases.

It was during this time I discovered a rather critical flaw. This is the story of what, how and how can you fucking even be that stupid. The issue relates to users and their reports and their ability to order.

I first found this issue looking at some erroneous data for a low value order and went, "There's no fucking way, they're fucking stupid, but this is borderline criminal." It was easy to miss, but someone in a top down reporting chain had submitted an order for someone else in a different org. Shouldn't be possible, but here was that order staring me in the face.

So I set to work seeing if we'd pwned ourselves as an org. I spend a few hours poring over logs from the log service and dynatrace trying to recreate what happened. I first tested to see if I could get a user, not something that was usually done because auth identity was pervasive. I discover the users are INCREMENTAL int values they used for ids in the database when requesting from the API, so naturally I have a full list of users and their title and relative position, as well as reports and descendants in about 10 minutes.

I try the happy path of setting values for random, known payment methods and org structures similar to the impossible order, and submitting as a normal user, no dice. Several more tries and I'm confident this isn't the vector.

Exhausting that option, I look at the protocol for a type of order in the system that allowed higher level people to impersonate people below them and use their own payment info for descendant report orders. I see that all of the data for this transaction is stored in a cookie. Few tests later, I discover the UI has no forgery checks, hashing, etc, and just fucking trusts whatever is present in that cookie.

An hour of tweaking later, I'm impersonating a director as a bottom rung employee. Score. So I fill a cart with a bunch of test items and proceed to checkout. There, in all its glory are the director's payment options. I select one and am presented with:

"please reenter card number to validate."

Bupkiss. Dead end.

OR SO YOU WOULD THINK.

One unimportant detail I noticed during my log investigations that the shit slinging GUI monkeys who butchered the system didn't was, on a failed attempt to submit payment in the DB, the logs were filled with messages like:

"Failed to submit order for [userid] with credit card id [id], number [FULL CREDIT CARD NUMBER]"

One submit click later and the user's credit card number drops into lnav like a gatcha prize. I dutifully rerun the checkout and got an email send notification in the logs for successful transfer to fulfillment. Order placed. Some continued experimentation later and the truth is evident:

With an authenticated user or any privilege, you could place any order, as anyone, using anyon's payment methods and have it sent anywhere.

So naturally, I pack the crucifixion-worthy body of evidence up and walk it into the IT director's office. I show him the defect, and he turns sheet fucking white. He knows there's no recovering from it, and there's no way his shitstick service team can handle fixing it. Somewhere in his tiny little grinchly manager's heart he knew they'd caused it, and he was to blame for being a shit captain to the SS Failboat. He replies quietly, "You will never speak of this to anyone, fix this discretely." Straight up hitler's bunker meme rage.

Engineer: hi whats this meeting for

Employer: unfortunately today we're cutting staff and you've been affected-

Engineer: 🤣😂🤣😂🤣-

Employer: why are you laughing?!

Engineer: no no- sorry it's just-

Employer: it's not funny-

Engineer: you're broke 🤣😂🤣

Employer: what?!

Engineer: that's like so embarrassing for you-

Employer: that's offensive. That's rude

Engineer: no i mean- you should have told- i didn't know you guys were this poor

Employer: we're not poor the market shift is-

Engineer: is really cringe. I mean can we just start a gofundme campaign or something-

Employer: that won't be necessary

Engineer: this just isn't a good look for you- it's giving 😂- it's giving poverty vibes honestly🤣🤣

Employer: that is very offensive-

Engineer: I'm really embarrassed for you. I was doing three people's jobs anyway bye

OH MY FUCKING GOD! WHY THE FUCK WOULD YOU REWRITE A FUCKING PIECE OF CODE AND DON'T MAINTAIN ITS FUNCTIONALITY?
ARE YOU FUCKING MAD????

JUST SPENT 1 FUCKING HOUR TRYING TO FIGURE OUT WHY THE FUCK THE DATA WASN'T BEING PASSED TO REDUX STORE!

YEAH, UNIT TESTING SURE IS A FUCKING WASTE OF TIME YOU DUMB FUCKING IDIOT THAT HAS MASHED POTATOES FOR A BRAIN!

GO ROT IN HELL YOU PIECE OF SHIT!!!!

NOW IF I DON'T FIX THIS SHIT MY ASS IS ON THE LINE BECAUSE I MADE THE FUCKING FUNCTIONALITY THAT YOU BROKE?? NO FUCKING WAY!

I DON'T CARE IF YOU ARE MY BOSS, I'M GONNA GIT BLAME THE SHIT OUT OF YOU IF ANYONE PISSES ME OFF!

This codebase reminds me of a large, rotting, barely-alive dromedary. Parts of it function quite well, but large swaths of it are necrotic, foul-smelling, and even rotted away. Were it healthy, it would still exude a terrible stench, and its temperament would easily match: If you managed to get near enough, it would spit and try to bite you.

Swaths of code are commented out -- entire classes simply don't exist anymore, and the ghosts of several-year-old methods still linger. Despite this, large and deprecated (yet uncommented) sections of the application depend on those undefined classes/methods. Navigating the codebase is akin to walking through a minefield: if you reference the wrong method on the wrong object... fatal exception. And being very new to this project, I have no idea what's live and what isn't.

The naming scheme doesn't help, either: it's impossible to know what's still functional without asking because nothing's marked. Instead, I've been working backwards from multiple points to try to find code paths between objects/events. I'm rarely successful.

Not only can I not tell what's live code and what's interactive death, the code itself is messy and awful. Don't get me wrong: it's solid. There's virtually no way to break it. But trying to understand it ... I feel like I'm looking at a huge, sprawling MC Escher landscape through a microscope. (No exaggeration: a magnifying glass would show a larger view that included paradoxes / dubious structures, and these are not readily apparent to me.)

It's also rife with bad practices. Terrible naming choices consisting of arbitrarily-placed acronyms, bad word choices, and simply inconsistent naming (hash vs hsh vs hs vs h). The indentation is a mix of spaces and tabs. There's magic numbers galore, and variable re-use -- not just local scope, but public methods on objects as well. I've also seen countless assignments within conditionals, and these are apparently intentional! The reasoning: to ensure the code only runs with non-falsey values. While that would indeed work, an early return/next is much clearer, and reduces indentation. It's just. reading through this makes me cringe or literally throw my hands up in frustration and exasperation.

Honestly though, I know why the code is so terrible, and I understand:

The architect/sole dev was new to coding -- I have 5-7 times his current experience -- and the project scope expanded significantly and extremely quickly, and also broke all of its foundation rules. Non-developers also dictated architecture, creating further mess. It's the stuff of nightmares. Looking at what he was able to accomplish, though, I'm impressed. Horrified at the details, but impressed with the whole.

This project is the epitome of "I wrote it quickly and just made it work."

Fortunately, he and I both agree that a rewrite is in order. but at 76k lines (without styling or configuration), it's quite the undertaking.

------

Amusing: after running the codebase through `wc`, it apparently sums to half the word count of "War and Peace"

If you are a salesperson, you can just go straight to hell. You're all a bunch of cocksucking twats and I'm amazed you manage to get yourselves dressed each day. You're a no good fucking waste of oxygen and you need to put your fork in a socket the next time you're eating.

I'm working on building a crm and ticket management system for use in the office to handle client passwords. Since I'm building from scratch I wanted to make sure I had properly planned my classes and functions before opening the code editor so I put a message on my door that says "Don't interrupt, thanks" followed by the date so people knew it was a fresh message and not something left from the previous day.

I'm deep in the zone, the psuedo code and logic is flowing, I'm getting classes planned and feeling really productive for an hour or so when suddenly my door flies open and in comes a sales person.

SP: "Hey, do you have any extra phones lying around? Mine's being slow and keeps hanging up on people."

Me: "Do you see the sign on my door right there at eye level which says not to bother me?"

SP: "oh, do you want me to come back later?"

Me: "You've already interrupted me now, let's go see what's going on before I spent an hour setting up a new phone for you." While we are walking across the office I asked him when the last time the phone rebooted.

SP: "idk, Salesperson#2 suggested that as I was headed over here but I figured I'd just ask you."

We get over to his desk and I see he has two phones sitting on his desk. "Where did this one come from?"

SP: "Oh that was on the desk over here but I figured I could use it."

Me: "Well aside from the fact that the phones are assigned to specific people for a reason, you took the time to unhook your phone to set this one up and you didn't think to reboot your phone first. Plug your phone back in."

He plugs the old phone, which is assigned to him, and while booting it does a quick firmware update and boots up fine. He tests a few things and decides it's all better now.

So someone suggested a fix for you and you decided, instead, you would break company IT policy by moving equipment from one station to another without notifying the IT department. You entered a room which had a closed door without knocking, and you disobeyed the sign on the actual door itself which politely requests that you go away. All because you couldn't be bothered to take 2 minutes and reboot your phone, which you had to do anyways.

You completely broke my train of thought and managed to waste 2 hours of effecient workflow because you had an emergency.

Reinstalling arch. I broke it while grading homework. Sad. Also worried my phone is going to ring and I'm going to not have my laptop ready.

I'm a computer sciences student, so I had to work on a group project at the end of the year. This project had a very big impact on our ratings, and many students were working really hard on it
One evening, a friend of mine knocked at my door to seek for help, she was too depressed to keep working on the project and needed to talk a little bit
After a little talk, we worked on her part of the project together. We managed to finish it just in time and send it to her teammate (they were not using git, our school never ever talked about it so they did not know what it is)

The next day was the d-day, every group had to show the teachers their projects
I arrived in a room where everyone was trying to fix the remaining bugs before their turn
And I saw my friend, almost crying. Her mate changed everything in the code we worked on and everything broke. There was not enough time to merge it again, they were stuck with a non functionnal soft
Obviously, he kept telling everybody it was her fault

Just go to hell, you fucker
I can't even understand how you did have such a stupid idea, now she needs to repeat her year because of you
Fuck you and don't ever come in my sight again, you selfish brat
Just because you know you will pass does not give you the right to fuck with another person's ratings

I swear to god, I'm going to track down the dipshit who just made my day hilariously painful.

So here I am, finishing up this project that's been going on for what feels like an eternity, when I get an email "why doesn't order X show up in this other system?".

I mean, it's a common thing they can take 15 minutes to push across, so the usual quick glance and what do you know, it's just sitting there as if it's waiting to be pushed through, than an hour later... it's still there, so I start digging, maybe a data issue, nope looks all good, customer details, payment details, products...

just another order, jump on the logs and all looks fi......... wait.... why does this postcode have 3 digits and not 4 , Australia has 4 digit postal codes fyi, looks at order again, 3 digits, look at log, 3....hold on why's it only 3 digits, checks code, handled as string... ok..... where the fuck would it drop a digit.... frontend requires 4 digits, validation requires 4 digits... how the fuck did you get 3 digits in... I can't see anything anywhere that logically makes sense for this🤔

Drops address into google and it's a postcode starting with 0.

Jumps on DB and the fucker is an int in the postcode table. For all you playing at home 0123 <> 123

I don't know if I should feel bad, or impressed, it's been 7 years since this table was created, and 7 years before someone managed to live in one of these parts of the country with a leading 0.

QA didn't spot this years ago,
No one tested this exact scenario,
The damn thing isn't even documented as a required delivery area, but here we are!

Kudos good sir, you broke it! 🤜 🤛
You sir may get your order now!

Dev checked in code (I suspect purposely not inviting me on the code review invite) saying he "fixed" the authentication bug in the web service.

Um no, like I told you last week, the authentication error is because the load balancer wasn't passing the user's authentication to IIS.

If I didn't overhear him telling a user "Still getting the error? I don't know, we might have to re-write that service", he might have gotten away with it.

Me: "Wait, that doesn't sound right. If I hit the server directly, authentication works. Its an issue with the load balancer, not the service"
Dev: "Admin said the load balancer is fine and it has to be the service."
Me: "I don't buy it. IIS is returning the authentication error, not the service."
Dev: "I added exception handling and nothing is being logged. Must be something in the service configuration."
Me: "No, IIS performs the authentication, not the service. I explained that last week, remember?"
Dev: "Oh yea. What changes do we need to make to the service?"
<my blood pressure starts to spike>
Me: "None. Give me a sec.."
<we have other apps on the same server farm that work just fine, so I re-configure the service pool settings to match theirs>
Me: "See, now going through the load balancer, the service works fine. For some reason, the admin had our service set up differently."
Dev: "OK, I'll let the users know the service is fixed."
Me: "Service was never broke and I'm not leaving it in its current state. In the morning I'll talk to the admin and see what he can do to fix."

All of the things broke today. I'm currently numb as I'm experiencing every emotion possible. I need alcohol and a beach. And no human interaction.

i was asked to start a new project, and another dev was brought onto the team shortly after. as soon as he joined, straight away he started an entirely new project and worked on it through the whole weekend, then came back on monday and just sort of pasted his files into/over the code i had already started and was working on, with no regard for folder structure or naming conventions or anything. his work was even split between 2 almost identically named namespaces (both of which were completely different to the existing project namespace) and his shit broke everything i did in the first place. the cherry on top is that none of his work was even functional, it was purely dummy/mockup web pages that weren't linked to any sort of backend.

when i asked him wtf he thought he was doing, he kept saying "i didnt touch your code" and refused to acknowledge that pasting a project over a different project can break stuff, then said it "wasn't his fault that i'm slow and not keeping up". and just kept saying vague bullshit about how i have to do it his way because he "has more experience"

he had no idea what my previous experience was, he had never asked and i had never told him, he just decided that he had more experience than me.

i dug through the shit and found out that he didn't just break my work, he had actually purposely deleted it when he realised it was getting in the way of his spaghetti. i showed him the commit and confronted him with it and all the cunt said was "well the good news is, you know the fix" and kept trying to dismiss me in the most disrespectful ways he could think of. i eventually snapped at him (long overdue at this point) and told him that any experienced developer would not commit code that didn't even fucking compile, especially when they're the one who broke it, and that he needs to grow up. of course he then complained that i was being unprofessional.

our manager decided we should go with fuckfaces """code""" without even looking at the work either of us had done, purely because fuckface is older than me and that's how the world works.

in the end i just told my manager that i refuse to work with the guy and he could either take him or me off the project (guess who he picked) or i quit.

after a few months of the guy failing to deliver any of even the basic functionality that was asked for, the entire project got scrapped, and the dude just quit once everyone realised he was literally just larping as an experienced dev but couldn't accomplish simple tasks.

i never received an apology from anybody involved.

Newest additions to my 3rd country, high school student, under-budget working....er....station? I'll just call this my "computer bed" from now on.

Please. Hear me out.

I've been doing frontend for six years already. I've been a junior dev, then in was all up to the CTO. I've worked for very small companies. Also, for the very large ones. Then, for huge enterprises. And also for startups. I've been developing for IE5.5, just for fun. I've done all kinds of stuff — accessibility, responsive design (with or without breakpoints), web components, workers, PWA, I've used frameworks from Backbone to React. My favourite language is CSS, and you probably know it. The bottom line is, you name it — I did it.

And, I want to say that Safari is a very good browser.

It's very fast. Especially on M1 Macs. Yes, it lacks customization and flexibility of Firefox, but general people, not developers, like to use it. Also, Safari is very important — Apple is a huge opposing force to Google when it comes to web standards. When Google pushes their BS like banning ad blockers, Apple never moves an inch. If we lose Safari, you'll notice.

As for the Safari-specific bugs situation, well… To me, Safari serves as a very good indicator: if your website breaks in Safari, chances are you used some hacks that are no good. Safari is a good litmus test I use to find the parts of my code that could've been better.

The only Safari-specific BUG I encountered was a blurry black segment in linear gradients that go from opaque to transparent. So, instead of linear-gradient(#f00, transparent), just do linear-gradient(#f00f, #f000).

This is the ONLY bug I encountered. Every single time my website broke in Safari other than that, was for some ugly hack I used.

You don't have to love it. I don't even use it, my browser of choice is Firefox. But, I'm grateful to Safari, just because it exists. Why? Well, if Safari ceases to exist, Google will just leave both W3C and WhatWG, and declare they'll be doing things their way from now on. Obey or die.

Firefox alone is just not big enough. But, together with Safari, they oppose Google's tyranny in web standards game.

Google will declare the victory and will turn the web into an authoritarian dictatorship. No ad blockers will be allowed. You won't be able to block Google's trackers. Google already owns the internet, well, almost, and this will be their final, devastating victory.

But Safari is the atlas that keeps the web from destruction.

Man I really need to get this off my chest. So here goes.
I just finished 1 year in corporate after college. When I joined, the team I got was brilliant, more than what I thought I would get. About 6 months in, the project manager and lead dev left the company. Two replacements took their place, and life's been hell ever since.

The new PM decided it was his responsibility to be our spokesperson and started talking to our overseas manager (call her GM) on our behalf, even in the meetings where we were present, putting words in our mouth so that he's excellent and we get a bad rep.

1 month in, GM came to visit our location for a week. She was initially very friendly towards all of us. About halfway through the week, I realized that she had basically antagonized the entire old team members. Our responsibilities got redistributed and the work I was set to do was assigned to the new dev (call her NR).

Since then, I noticed GM started giving me the most difficult tasks and then criticizing my work extra hard, and the work NR was doing was praised no matter what. I didn't pay much attention to it at first, but lately the truth hit me hard. I found out a fault in NR's code and both PM and GM started saying that because I found it, it was my responsibility to fix it. I went through the buggy code for hours and fixed it. (NR didn't know how it worked, because she had it written by the lead dev and told everyone she wrote it).

I found out lately that NR and PM got the most hike, because they apparently "learnt" new tech (both of them got their work done by others and hogged the credit).They are the first in line to go onsite because they've been doing 'management work'. They'd complained to GM during her visit that we were not friendly towards them. And from that point on if anything went wrong, it would be my fault, because my component found it out (I should mention that my component mostly deals with the backend logic, so its pretty adept at finding code leaks).

What broke my patience is the fact that lately I worked my ass off to deliver some of the best code I'd written, but my GM said in front of the entire team that at this point "I'm just wasting money". She's been making a bad example out of me for some time, but this one took the cake. I had just delivered a promising result in a task in 1 week that couldn't be done by my PM in 4 weeks, and guess what? "It's not good enough". No thank you, no appreciation, nothing. Finally, I decided I'd had enough of it and started just doing tasks as I could. I'd do what they ask, but won't go above and beyond my way to make it perfect.

My PM realized this and then started pushing me harder. Two days back, I sent a mail to the team with GM in cc exposing a flaw in the code he had written, and no one bothered to reply (the issue was critical). When I asked him about it, he said "How can you expect me to reply so soon when it's already been told that when anything happens we should first resolve within the team and then add GM in the loop?" I realized it was indeed discussed, but the issue was extremely urgent, so I had asked everyone involved, and it portrayed him in a bad light. I could've fixed it, but I didn't because on the off chance if it broke something, they'd start telling me that I broke the tool, how its my fault and how its a critical issue I have to fix ASAP, etc. etc., you get the idea.

Can anyone give me some advice of how to deal with this kind of situation? I would have left but with this pandemic going on, market being scarce and the fact that I'm only experienced by 1 year, I don't think I qualify for a job switch just now.

I'm lost. I am so used to calls saying people broke things, I feel weird that I'm not annoyed with someone's idiocy...

Help?

I'm extremely lucky I'm not violent person. What happened today for some reason just completely pissed me off. I'm not sure why it got under my skin so much, but I feel completely disrespected.

I went to our marketing person's office to discuss a basic requirement for our api. Very simply, we have a lot of old shitty date that doesn't have a lot of fields filled out (worse yet, some are simply bogus values like crazy random dates and whatnot).

She put in a ticket claiming our most recent change started changed the creation dates to be empty. Easy enough to disprove, because the marketing software we have shows a records of all the edits for each contact, and if it came from our api it'll be labeled as "Web API". So of course I check the example contacts she give us, and there's no history of changes, meaning they never had the date to begin with (which is correct, as until now we didn't track creation date WHICH IS NOT MY DECISION. So dude 10 years ago probably made that decision).

So I start asking what exactly we're using it for. She does an absolutely horrible job of describing it and keeps telling me "no you absolutely have to be able to do all this, it's our requirements". By "this" she wants me to magically give all these contacts correct creation dates after the fact.

Eventually she gets the whole campaign idea out and I point, politely, that they're probably violating GDPR. She starts yelling saying her and her boss have been doing marketing for years and they know what they're doing. So I (less politely this time) said that's fine, I just want to talk with her boss to make sure he understands he's in the grey area and that if I'm the one building this, I'm kind of liable as well.

She clearly didn't like that, but I thought whatever, let's just agree on some requirements and I'll pass it on to my boss (who genuinely shits on her every single day and is constantly saying she never knows what she's doing).

So I go back , do some work. A little later I have to go print something off which is next to her office. Her door is shut, but I can hear her from down the hall yelling at someone about the conversation we just had. She actually starts mocking me. Doing the "stupid person" voice. This goes on for longer than our conversation.

Like I said, I know I'm right and she's just venting because she doesn't want to admit she's made a mistake. But for some reason it just completely broke me. I'm new but up until this point everyone had been pretty open about how they feel about me and my co-worker. But she just didn't need to go that bloody far.

So hey this is the first time I'm actually posting here... huh ... also

!rant

just sad.

So I broke up with my girlfriend a few hours ago. We had been together for 7.5 years, still have three months left on our lease. Not for any satisfying reason I could feel good about, just that what we want to do with our lives just doesn't seem compatible. She was my best friend, and I hope that I can keep at least some degree of that friendship eventually. I love her dearly, I just stopped loving her the way a lover should, if that makes sense. I feel kind of shitty but I know I will feel way worse tomorrow. Hopefully I won't be too hungover. Sorry for the downer. Okay that is all.

So how is your Friday?

Well let me tell ya, fixed a production issue and I'm totally exhausted and to top it off my girlfriend broke up with me.

I need a fucking drink!

Best of both worlds. Yeah, I'm broke.

Ok so a very quick background: I didn't get a job until I needed one after my phone broke and I didn't have the money to buy another one. (I'm a student still for those who don't know lol.)

>> Phone randomly breaks.
>> Don't have the money for a new one
>> Searches for low skill jobs (ie cashier) that would work with me in terms of how many hours I work and whenever those hours are.
>> Apply to like 15 (not even exaggerating either lol) jobs
>> Wait for responses
>> One day goes by. Nothing
>> Two days go by. Nothing
>> Three days go by. Nothing
>> Fourth day rolls around and I get a call about one. I answer, tell him I'm available starting that Monday.
>> (Keep in mind I'm on an old temporary phone)
>> Next day I buy a new phone (didn't have to pay anything up front aside from the taxes on it, as it's on a payment plan)
>> Reset old phone after usage
>> Monday rolls around and I drive to the location of the job, and walk in the door asking for x.
>> "I'm sorry sir, who? We don't have anyone here by that name."
>> I panic and hop in my car, and try to find the address of the store I applied to. I find out it's different than where I went.
>> Start driving there and call that phone number. I ask to speak to x.
>> "I'm sorry sir, there's nobody here by that name."
>> Call literally every other location in the city and ask for x, but nothing.
>> Since I'm already on the way, I drive to the location of the store I had applied to. Whenever I get there, the manager spends half an hour on the phone trying to figure out where I belong. Nothing.
>> By this point, it's well over an hour past whenever I was supposed to show up, so I gave up because I figured they probably wouldn't have hired me anyways.
>> I get home determined af to figure out who the hell called me.
>> I remembered that Verizon has call logs you can look at online.
>> I go back through it and find the number. Google it.

Here's where the story gets a lil funny now.

>> Number shows up for a store that I applied to who's name sounds a LOT like the first store.
>> Called them and explained what happened, and told them I'd be there asap if they still wanted me.
>> That was like 6 months ago and I'm still here lol

Third call of the morning. No one I need is answering. Boss fell asleep (but went on mute, thankfully) and deputy director is on the line listening in.

I'm hungry. Cranky. And feeling ignored.

To all my dev friends here: please answer your phones of you're needed to give information about your code. These are code specific issues (ie- application/program specific) that require knowing the code to know what broke so we know how to fix it.

Shame me later for piracy but I think i just found the goldmine of books and vid tuts. Has packt(books, vids) and even O'Reilly books as recent as last month. This good boye has EVERYTHING.
coderprog.com

On the screen: four text boxes cycling through rainbow color backgrounds and spinning wildly in circles.

Manager walks in.

Here's the context.

We were pair programming and working on a simple form. We were just finishing up the style, and I suggested we use a CSS3 animation to make the invalid fields pulsate a light red once.

I'm the young guy in the office, so I am most familiar with the "new" front end stuff like flex and CSS3.

My colleague was unfamiliar with CSS3 animations, so I implemented the red flash quickly and showed him.

He was curious what else you could do with CSS3 animations, so I changed my "to/ from" to a "0%/ 25%/ 75%/ 100%" style animation to show how keyframes worked. Then I made the animation iterations infinite so it went on forever. Of course, I didn't have any normal colors on hand so I just went with my debug colors: red, green, blue, yellow, etc.

We submitted the form with invalid inputs and sure enough, they flashed rainbow colors. It looked pretty funny so I thought "haha, lets quickly add rotation while we're at it"

That's the point where the education turned to a little fun but it wasn't going to take more than a second.

So we did it and it looked pretty funny and it actually made me laugh. Then we started discussing next steps on the form (back-end). Discussion lasted maybe five minutes before our manager visited to update us.

As we were discussing, the invalid controls were still spinning and rainbow colored in the background. Whoops.

The words we managed to say were just "It's invalid" and then we broke out laughing.

Two days ago I went to change an Nvidia driver on my Linux mint partition and it ended up breaking everything, all my fault because I'm so new to Linux, anyways to dig that hole deeper I looked for ways to fix it, found some random command that managed to destroy mint even more lol. I had no start menu and cinnamon kept going into recovery mode.

But the next day after spending time working through what to do I managed to fix it, I basically downloaded mintmenu again and uninstalled the graphics driver

All in all I think I've come closer to learning how fun Linux is, it was fun fixing what I broke rather than actually clean installing mint again.

Morale of the story: don't randomly use commands found on the net that has 3 upvotes lol

Hey Root, remember that super high-priority ticket that we ignored for five months before demanding you rewrite it a specific way in one day?

Yeah, the new approach we made you use broke the expected usecases, and now the page is completely useless to the support team and they're freaking out. Drop everything you're doing and go fix it! Code-complete for this release is tonight! -- This right after "impacting our business flow" while being collapsed on the fucking floor.

Jesus FUCKING christ, what the fuck is wrong with these people?

If I dropped the ball on a high-priority ticket for two weeks, I'd get fired, let alone for five fucking months.

If I was a manager and demanded a one-day rewrite I can only imagine the amount of chewing out I'd receive, especially on something high-priority.

And let's not forget product ownership: imagine if I screwed up feature planning for someone so badly I made them break a support tool in production. I'd never hear the end of it.

Fucking double standards.

And while I'm at it. Some of the code I've seen in this codebase is awful. Uncommented spaghetti, or an unreadable mess with single-letter variables, super-tightly coupled modules so updates are nearly impossible, typos in freaking constants added across sixty+ files, obviously-incorrect comments, ... . I'll have to start posting snippets to show them off. But could I get away with any of it? ha. Hell no. My code must be absolutely perfect. I hear about any and every flaw, doesn't matter how minor, and nothing can go out until everything is just so.

Hell, I even hear about flaws in other peoples' code during my code reviews. Why? Because I should have fixed it, that's why. But if I do, I get yelled at for "muddying the waters."

Just. JESUS FUCKING CHRIST.

It's like playing a shell game where no matter which shell I pick (or point to their goddamn sleeve where they're clearly hiding it), I get insulted for being so consistently useless, and god damn, how can I never find the fucking pea or follow the damned rules? I'm so terrible and this is why "nobody trusts me." Fuck you.

I'll tell you why I can't find your damned pea: IT'S RATTLING INSIDE YOUR FUCKING HEADS, you ASSHOLE FUCKING IMBECILES.

That's right: one pea among the lot of them.

goddamn I am fucking pissed off.

A few years ago I was browsing Bash.org, and a user posted that he'd physically lost a machine.

A few weeks ago, I'd switched my router out for OPNSense. I figured it was time to start cleaning up my network.

Over the course of tracking down IP addresses and assigning statics to mac addresses, I spotted an IP I didn't recognize.

Being a home network, I'm pretty familiar with everything on the network by IP, so was a little taken aback.

I did some testing, found out that it was a Linux box. Cool.

I can SSH into it. Ok.

Logs show that it's running fine, no CPU/Memory/Harddrive issues. Nice.

So where is it?

Traceroute shows its connected directly to the router... Maybe over an unmanaged switch...

Hostname is "localhost"... That's no help.

I've walked the network 4 times now, and God knows where it is.

I think maybe I'll just leave it alone. If it ain't broke...

Never EVER buy a Mac as your primary PC if you're a developer.

Back in 2014 I bought an iMac because I already had an iPhone, and being able to code on xCode and also have a Windows partition seemed perfect. It wasn't.

Soon enough, I started encountering issues. My storage was randomly filling up, my computer started getting slow despite me having a small number of start apps and still a lot of storage available, it was all a mess.

So - I installed Windows 10 using Bootcamp to use it as my main OS. All was great until I wanted a new partition of Windows so I can test some things out without damaging my stuff. I try multiple methods, none of which work because my disk is not in the right partition format, and I don't want to change it because I'd have to format the whole thing.

Whatever - I give up, and try going back to my normal partition, disappointed. Guess fucking what?! My Windows Boot was damaged! Yes, I shit you not!

So - not only was this absolute piece of shit not able to add just one more fucking partition with an OS on it, but it BROKE my main partition, and now I'm trying to recover it.

I've said it once and I'll say it again: Never EVER get a Mac as your primary computer, unless you only work on Mac/iPhone apps.

For paying 1300$, I was expecting a seamless experience with little to no issues - yet all I got is a computer that's fucking broken from it's very core.

Fuck you, Apple.

One of those things that put a smile on my face happened today.

I (like many devs) am fond of Linux. So I use Linux on everything.

I'm currently doing an internship abroad in Finland(Linus Torvald's country!) for my college.

So there is this Finnish student who uses Linux. And after a while he asked what I was using so I told him that I'm running linux(arch+i3 like all the cool kids).

So one day he was like; But can you game on Linux?
I was like, yeah sure, might not work as well as Windows but some games run native and some can be emulated through wine. He was like; Hmm maybe I'll try it out.

So he installed Linux mint on his laptop and came to work. I was rather proud (even though he installed the bastard child of Debian and Ubuntu).

So far I've helped him set up streaming games from his pc to Linux and port forwarding.

But then came the big boy. Since I always try to teach him some stuff since they don't teach him a lot at his school.

He asked me if I could help him set up a plex streaming server on Linux.

So we took an old computer and installed Ubuntu Server(Lot's of information for it).

Installed and configured plex server, qtbittorrent-knox and all kind of goodies.

I started showing him how to use ssh, how the rights system works, etc.

It broke my heart a little that he want to be able to teamviewer in it.(since it's running openSSH daemon)

So he installed Ubuntu's desktop ontop of it as well as teamviewer.

It ran slow as hell because the PC has an old crummy core2duo and ddr2 2gb of ram. It chokes when multitasking.

So seeing that as well as telling him everything that can be done with a GUI can be done in CLI.

I saw the lightbulb lighting up. He gets it now. He understand the power of Linux.

That just made me smile all the way home.

Today I broke our testing server.
I accidentally (don't even ask, I'm stupid) renamed the /lib folder and nothing worked anymore. Not a single bash-command. I had to shutdown the server and reboot it with a recovery-cd to rename the folder again. Luckily it all runs in a vSphere so I didn't even had to stand up from my desk.

Had a 1:1 with my boss last night and together we figured out a tricky bug related to my PR. However, either my PR or that bug patch broke a tangentially-related test. Queue my usual exhaustion, and I gave up trying to fix it.

This morning, I'm looking at it and nothing makes sense. My change should not have broken the test. So I reran the controller's tests, and... they all pass?

What is logic.

Good thing, though; that test leads to a few rabbit holes I haven't even begun exploring yet.

Oh, never mind. It broke again.
Ergh, here we go. 😔

I'm installing Gentoo on a keyboard. Not even kidding.
.
.
.
.
.. well, clickbait aside, it's a laptop that's been turned into a keyboard on steroids, its backlight broke so I had to remove the display until I get around fixing that.. but its keyboard is so good. They don't make them like that anymore... So yeah 🙃 turning it into some kind of controller for the other desktops. Tomorrow (or rather, in half a week when the Gentoo installation is finally complete) I'll be SSH'ing into my keyboard 😛

The finish line for my Linux journey is starting to get in sight 😄

Somewhere in a lonely break room
There's a guy starting to realize that eternal hell has been unleashed unto him.
It's two a.m.

It's two a.m.
The boss has gone
I'm sitting here waitin'
This desktop's slow
I am getting tired of fixin' all my coworkers' problems
Yeah there's a bug on the loose
Errors in the code
This is unreadable
Rubber ducky can't help
I cannot debug, my whole life spins into a frenzy

Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow

I'm falling down a spiral
Solution unkown
Disgusting legacy, ugly code
Can't get no connection
Can't get through to commit

Well the night weights heavy
On my confused mind
Where's the error on this line
When the CEO comes
He knows damn well
To keep his distance
And he says

Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
When you need Stack Overflow

When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow

When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow

I recently broke up with my boyfriend of more than two years (we have known each other for more than four). My code (and my work in general) seems to have gotten better. Maybe because he's not always at the back of my mind. No matter what anyone says, long distance WILL take a toll on you if you don't meet the other person for more than a year. Nope. Nope. Nope. I'm loving the single life now and feel so much more confident about myself!

An adult cam website I worked on as freelancer had/has this code everywhere:
$user = $_POST['usr'];
$pass = $_POST['pwd'];
$row = $db->query ("SELECT * FROM users where username='".$user."' AND password='".$pass."' COUNT 1);

I was hired to add new features and was touch any other parts of the code. When my job was done, I tried to fix those as a good samaritan but the client thought I was messing with the system or should be thing of new features to add. So I got fired.

5 years later, I check out of curiosity and they are still there. I ask him again if I can work on them for a little less pay(I'm broke) and he doesn't reply. What a douche. I hope his site receives a shot of SQLi from a customer.

Pattern I'm noticing...

*email* Hey, can you help me with my code, I don't know why it's not working...*end email*

no comments. if you wrote the shit and don't know what the blazes it's doing, how am i supposed to know what you broke? I'm not a mind reader, I don't know what you were thinking when you wrote the code.

true, I could go through and read it and try to figure it out, but then i'll be cranky and much less likely to want to help you in the future because you're causing unnecessary work, and part of my job is to get you ready for work environments, and I WILL DO EVERYTHING IN MY FUCKING POWER TO MAKE YOU THE ONE PERSON THAT EVERYONE DOESN'T HATE, BUT I WILL HATE YOU FOREVER BECAUSE YOU'RE PISSING ME THE HELL OFF.

The manager and selfperceived omnipotent cult leader was the worst kind of businessman. Slimey and trecherous, zero sense of ethics, but felt holier than the pope because he "helped" his weakling herd of piteous employees.

These employees were smart kids, most of them in their late teens. All of them legally disabled. There was this kid who gobbled up ritalin like candy, a boy who had received his measles shots and turned socially awkward (/s), a chubby girl who could name all the hex colors of her chocolate stained shirt... you know, what we call skilled developers in the industry.

Fiftyfive of them.

They were awesome, awkward highschool dropouts, like I had been a decade earlier. They worked 50h a week. They had great humor, were passionate, devoured information about new technologies, and they built custom websites from scratch in no time. I had to lead this flock, and felt honored to work with them.

Then things started to smell funny.

I discovered all 55 of their workstations ran pirated software, from Windows to Adobe CS. I'm not without sin in that regard, but as a company it's just plain stupid.

Clients were treated like shit. I mean, we all feel like punching a client in the face sometimes, but I'm taking about unjustified debt collections paired with death threats.

Then I found out these kids were often disappearing for a few months, only to return months later.

I started digging, and discovered they were all working reintegration internships (because they were on below minimum wage disability payments), at almost zero cost to my employer.

After 6 months, my boss gave them a negative recommendation, they were all too "sick" to function in normal jobs.

Then they were rotated to a shadow company, doing the same work for another 6 months, and so on to a third company.

He broke these kids, talked them down, made them feel worthless. He threatened the ones who understood what was happening.

I ended up bringing the company down, with the CEO and two government officials jailed for fraud and corruption.

Some employees were quite mad about it, at least at first — I was the shepherd who abandoned his sheep. Luckily, most found better paid positions in no time.

Truly one of the most fucked up and difficult situations I've been in.

I'm coming off a lengthy staff augmentation assignment awful enough that I feel like I need to be rehabilitated to convince myself that I even want to be a software developer.

They needed someone who does .NET. It turns out what they meant was someone to copy and paste massive amounts of code that their EA calls a "framework." Just copy and paste this entire repo, make a whole ton of tweaks that for whatever reason never make their way back into the "template," and then make a few edits for some specific functionality. And then repeat. And repeat. Over a dozen times.

The code is unbelievable. Everything is stacked into giant classes that inherit from each other. There's no dependency inversion. The classes have default constructors with a comment "for unit testing" and then the "real" code uses a different one.

It's full of projects, classes, and methods with weird names that don't do anything. The class and method names sound like they mean something but don't. So after a dozen times I tried to refactor, and the EA threw a hissy fit. Deleting dead code, reducing three levels of inheritance to a simple class, and renaming stuff to indicate what it does are all violations of "standards." I had to go back to the template and start over.

This guy actually recorded a video of himself giving developers instructions on how to copy and paste his awful code.

Then he randomly invents new "standards." A class that reads messages from a queue and processes them shouldn't process them anymore. It should read them and put them in another queue, and then we add more complication by reading from that queue. The reason? We might want to use the original queue for something else one day. I'm pretty sure rewriting working code to meet requirements no one has is as close as you can get to the opposite of Agile.

I fixed some major bugs during my refactor, and missed one the second time after I started over. So stuff actually broke in production because I took points off the board and "fixed" what worked to add back in dead code, variables that aren't used, etc.

In the process, I asked the EA how he wanted me to do this stuff, because I know that he makes up "standards" on the fly and whatever I do may or may not be what he was imagining. We had a tight deadline and I didn't really have time to guess, read his mind, get it wrong, and start over. So we scheduled an hour for him to show me what he wanted.

He said it would take fifteen minutes. He used the first fifteen insisting that he would not explain what he wanted, and besides he didn't remember how all of the code he wrote worked anyway so I would just have to spend more time studying his masterpiece and stepping through it in the debugger.

Being accountable to my team, I insisted that we needed to spend the scheduled hour on him actually explaining what he wanted. He started yelling and hung up. I had to explain to management that I could figure out how to make his "framework" work, but it would take longer and there was no guarantee that when it was done it would magically converge on whatever he was imagining. We totally blew that deadline.

When the .NET work was done, I got sucked into another part of the same project where they were writing massive 500 line SQL stored procedures that no one could understand. They would write a dozen before sending any to QA, then find out that there was a scenario or two not accounted for, and rewrite them all. And repeat. And repeat. Eventually it consisted of, one again, copying and pasting existing procedures into new ones.

At one point one dev asked me to help him test his procedure. I said sure, tell me the scenarios for which I needed to test. He didn't know. My question was the equivalent of asking, "Tell me what you think your code does," and he couldn't answer it. If the guy who wrote it doesn't know what it does right after he wrote it and you certainly can't tell by reading it, and there's dozens of these procedures, all the same but slightly different, how is anyone ever going to read them in a month or a year? What happens when someone needs to change them? What happens when someone finds another defect, and there are going to be a ton of them?

It's a nightmare. Why interview me with all sorts of questions about my dev skills if the plan is to have me copy and paste stuff and carefully avoid applying anything that I know?

The people are all nice except for their evil XEB (Xenophobe Expert Beginner) EA who has no business writing a line of code, ever, and certainly shouldn't be reviewing it.

I've tried to keep my sanity by answering stackoverflow questions once in a while and sometimes turning evil things I was forced to do into constructive blog posts to which I cannot link to preserve my anonymity. I feel like I've taken a six-month detour from software development to shovel crap. Never again. Lesson learned. Next time they're not interviewing me. I'm interviewing them. I'm a professional.

This morning there was this window cleaner again, that actually made me remember a rant from the old box - my previous account. Repost of that coming in an hour or so :3

Turns out that he came in the morning, and I completely forgot about it. The only appointment that I had today got canceled so I was like, eh fuck it. There's been this family event yesterday that made me so fucking tired... I'll just stay in bed for a little while longer.

Apparently that window cleaner ringed my bell multiple times, haven't heard him do it but anyway.. he and the cleaning lady had the genius idea to ask my landlord whether they can just barge in my home. Way to start the day, isn't it? I thought there were burglars.

In my bathrobe and visibly pissed off (I am NOT a morning person!), I let him do the window cleaning and waited for them to get the fuck out already. Then that cleaning lady, the fucking bitch that called my landlord to break into my home without MY prior permission!!! While the window cleaner was doing his work, she proceeds to ask me this.

Cleaning lady: "I had this technical issue earlier, and since you are good with phones I thought I'd ask you."
Me (thinking): oh, here it comes.. *rolling eyes*
M: "What's the issue?"
CL: "Well my stepson has an iPhone, which he broke and we brought it to a smartphone repair shop. They repaired it twice but an hour after receipt of the fixed phone, it breaks again."
M (t): You went wrong at iPhone, and you went wrong at visiting that incompetent mofo "teknishan" twice.
M: "Well I have no experience whatsoever with iPhones, but continue."
CL: "Well, he replaced the motherboard, and some pin at the bottom.."
M (t): The fucking motherboard of all things. The whole fucking motherboard?! The last thing that I'd look at, he just replaces like that?! Fucking piece of shit. That's even worse than Apple stores. And what's up with that goddamn pin? CAN'T YOU POSSIBLY BE A BIT MORE SPECIFIC?!
M: "Given only this information, I have no idea what's wrong with it."
CL: "But you are good with these things, aren't you?!"
M: "I disassemble my own broken phones, and dick around with their motherboards. That, while I'm fully aware that in the process I can break it beyond repair. That does not make me an expert on every phone out there."
CL: …

Well what did you even expect, fucking bitch. You barge into my home, don't even have the dignity to leave for me to be able to shower and dress myself, and then you go ask shit like that? Go suck my fucking cock, and shove that iPaperweight down your ass!! How about that?!

Fuck, I'm too tired to rant about shit. Life is really starting to go better and I just...don't know what to rant about, so I've been quiet for the past couple months.

Uhhhhh, whenever I close my laptop the screen stays on and seeps through but I'm too lazy to actually mess with it to make it turn off when I close it?

I've been hanging out with my best friend again lately and she's the best fucking person ever?

OH WAIT, I'M BROKE, THERE'S SOMETHING (I've spent like 10 minutes typing, just trying to think of shit to say)! But I'm just bad with managing money and I get paid on Saturday anyways..

Guys. I don't know what to even rant about anymore. Life is finally going good enough that I don't feel the need to rant all the time.

Online team meeting at 9:30 am, I wake up at 9:25 am

Wake up. Meeting was moved at 9:00 am and renamed to "CRITICAL". It's been 45 minutes and I still don't know what broke, but I'm too scared to ask.

Two places: At a major NYC firm, I was in charge of social media. I was also involved with an intranet community. Something went bad with the intranet community project politics and I got blamed for it even though I had emails to prove I hadn't said/done what I was accused of. But to assert their dominance, my bosses called me to their office, sat me in literally a corner of the room, and interrogated me for 2 hours. The only thing missing was the bright light in my eyes and the "good cop" part of the routine. I'm ashamed to say they "broke" me and I just gave up and did what they told me to do to "fix" it even though I hadn't done anything wrong. The bosses were old enough to be my parents, so I wonder how much of that worked its way into the psychology of it all.

The second toxic workplace was where each month the boss would come from his home by the beach to tell us plebes what new ideas he wanted us to work on. We would just get done reporting on the results of his delusions of grandeur from the month prior and he'd pull the rug out and start us on some new thing. Never got any consistent traction on anything. He was the ultimate seagull manager: fly in, make a lot of noise, poop all over everything, and leave us cleaning up the mess. Oh, and we had to change the locks because we had to fire a customer service guy who was a little bit on the ragey side of things. Because of high turnover, I had seniority within 4 months of starting there.

Today my raspberry pi media center bricked itself (at least it won't boot properly. Than I thought I just format the SD card and reinstall everything. But than my windows pc won't boot properly because it's still running on old hdd and I suck at building PCs. Than I tried my ThinkPad with antergos and remembered that it is also dead because the last update broke something. And now I'm trying to boot my windows at least into safe mode and my ThinkPad to boot from the live stick to chroot and fix it. Still waiting since 15min for any progress.
Now is my old Oneplus One with an outdated nightly of a custom Rom my only working connection to the web.
I'm starting to think that waiting for the last minute to fix problems might not the best way for me.

Me: We really need to improve our unit test coverage.
Team/Boss: <sarcasm> Haha yeah.
Production Bug: I'm doing something nasty to a client, because a dev broke something but no test coverage.
Boss: How could we have prevented this?!

Been a while but I'm back with fresh rants.

If you look in my history you will see support wanted us devs to start paying for writing bugs. Now the release presentation has passed but we're still in crunch time because we can't put clients onto the new version yet. And in the meantime our coffee machine broke. So support has started to manually pour coffee, which was actual real nice of them.

Now yesterday I'm in a hurry and the coffee is out so I decide to pour a quick cup for myself with the leftover grounds. When I'm back at my desk I get a call asking if I just made coffee. I'm like yeah something wrong? Proceed to get chewed out for being selfish and that they see how it is with me, then get hung up on before I can even explain.

So yeah not only is my company too cheap to get a new machine, the lack of one causes drama.

Today however our network guy, who was present when my colleagues asked what was with the weird phone call, brought in his own machine and let me have coffee from it. Meanwhile suport can keep their crappy manual pouring. And I don't need to go into their office anymore.

My PC died 2 weeks ago. I've been stuck on mobile since and will be too broke for a new machine for an indefinite (though certainly not infinite) period.

It's hell. One can only read so many ebooks and meditate so much.

What's the longest you've ever been without your machine, unwillingly?

Worst part is I was just starting a pet project and now it's on hold!

Pic related, my feels as time drags on when I'm not at work.

When I started my current job 6 years ago I was given a desk phone with a 100mb port. Speed didn't matter at the time as everyone was given laptops for our desks. I changed positions in the company where I'm going to be provisioning servers and whatnot over the network. Started using a desktop that didn't have a Wi-Fi adapter. I requested a new phone with a Gig switch port, if possible, so doing file transfers on the network wouldn't be limited. IT had a couple of questions...

IT-Have you noticed slowness when downloading/uploading?
Me-No, but its a 100mb port...so.
IT-Well I just did a speed test and we're getting 60up/5down. Your phone is over that.
(Working from home? Our fiber was way faster than that I thought.)
Me-That's fine, but this will be for internal network transfers. Not going out to the internet. We have gigabit switches on campus correct?
It-Yes but you shouldn't notice a speed difference.
Me, now lost-If you can't change out the phone that's fine. I'll figure our something.
IT-Now now, lets troubleshoot your issue. Can you plug your phone in?
Me-Yes I have it, but I'm remote today. There is no way for it to reach the call manager.
IT-Let's give it a try.

40 min of provisioning later he gave up and said maybe it is broke. Got a "working" one the next week.

PS first post, and writing on phone. Yay insomnia!

!dev (when do I ever post a dev related story? I only post about my personal life really)

For about 2 years I had a very good friend, and I had a huge crush on her for most of those 2 years. All of my junior year of high school, she dated my best friend, then they broke up the summer after because he'd cheated on her around the time they got together and she had found out. I was there for both of them during the breakup (it was fucking exhausting). The thing is, I was there for the girl more because I had a crush on her, and I started to consider her my best friend rather than her ex.

She knew I had a crush on her for a long time. But she still spent about a year going to parties every weekend, getting fucking hammered, and hooking up with random guys, then proceeded to tell me about it after. I can't count how many times she had to cancel plans because she got hammered the night before.

But I had a huge crush on her, so I essentially put her up on a pedestal, thinking she could do no wrong. Then we hit a point where we didn't talk for a couple months because I hit a low point and she was uncomfortable with me because of it. Around April we started talking again, immediately back to being best friends but my feelings for her came and went for a while. She had a huge crush on our other friend that had a girlfriend at the time. Life went on, she actually ended up being my first kiss while she was drunk one night (I was sober cause I was driving), but I started talking to a different girl a few days before then, so I was very conflicted about everything there.

Then a few weeks ago came. A different friend got a Radeon 5700 XT and I went over to his house to check it out and everything. We ended up talking for a while, and the conversation turned to my whole friend group that I hung out with all the time (the girl being the center of the group). That friend was never very fond of her, and he always made that very clear. Basically he made me realize that she's not perfect, and that I'd been seeing her through rose-colored glasses.

I spent a week or so rethinking our whole friendship, and I realized that she is nowhere near fucking perfect. For example, she ALWAYS has to be the center of attention. If our friend group is focusing on someone else for whatever reason, she essentially throws a fit then gets really quiet to get attention. Also she can't take criticism at all, she always acts like a victim if you try to criticize her in any way. I also feel like every time I tried to better myself in some way, she ended up bringing me down and making me feel like my problems aren't important. She uses her kindness as a weapon, such as "How could you say that about me? I've been nothing but kind to you!" And the list just goes on.

So, about a week ago, I told her that I feel like she's a toxic person, and she does nothing but bring people down over time, because that's truly how I feel. And of course, she couldn't take the criticism, and said "I don't even know why you feel that, I've been nothing but nice to you".

I haven't talked to anyone in that friend group in one week now. And I feel a lot better mentally. Being friends with her felt like a chore. Only one person in that friend group has tried to talk to me, and that was today. Nobody else has texted me or anything since last Monday. And I honestly couldn't care less. I feel like a huge chapter of my life is over, like the depressing chapter in a book.

I don't know how to end this. I'm doing fairly well now, been hanging out with coworkers a bunch lately. Life's actually kinda good for once.

Alright, this my fucking rant right here. Distraction? This whole company is a distraction! Boss decided to throw us all in an open work environment doing jobs that require careful concentration. Straight outta college I'm getting handed vague ideas, (make a desktop app that helps our customers put data on the internet, make an iPhone app) with out so much as an inkling of what technologies to use, just make it work.
Ok I will but when you hit a roadblock with very little resources to draw in it's hard to stay focused.
On top of that since I worked in support for a year I'm our senior support person! But sometimes support just doesn't use their brains and I'm using my time to solve very basic problems.
That brings me to my next point, the goddamn piece of shit that is our telephone. Fuck that thing when it rings it's never good. Moreover, since I don't want to get roasted for not being responsive I have the motherfucker forward to my personal cell. So I answer every fucking call and I get so many spam calls!
Not to mention I'm mainly running the hardware show around here. Shits broke I'm the one fixing it. Need new shit I'm putting the order together.
Tried to get a new guy to be the sys admin, ordered a 6th gen board with a 7th gen proc, had to pull 3 machines apart to get that sorted. Then he left bc family issues, and has been gone for weeks.
The other devs are also slam up busy, and the main product is about 15 people's piss on a plate of garb age spaghetti. (I got a lot of shit going on but at least I'm the only one pissing in my spaghetti) it's a constant run around if who does what with a code first plan later mentality causing confusion and delay.
Nobody wants to help anybody because they are also annoyed with this setup and are getting bitched at by customers or management.
Sales is mostly composed of a bunch of crackhead yes men and women who just want a commission and only half know the shit we sell and have sold 15 new features that had not been discussed. But management always says make it happen. In what priority? It's all a priority they say! Wtf.
So yea, then it brings me to me, dealing with this much chaos at work makes it seem like a high amount of chaos in my life is normal. I'm just now learning to control this.
I've had to do a lot of growing up as a person and as a developer. I've went from being the most junior to about the 3rd most seniors and I've no doubt my efforts have contributed to the growth of the company.
I'm a big believer in coding flow, and that it takes at least 15 mins to get in that flow and about 5 seconds to break it. There is no do not disturb on the company chat, everything always on fire it seems.
So fuck a lot of this, but I've done the research and where I'm at is the best opportunity in a 100 mile radius. So I am thankful for this job. Plus I usually win the horror story contest.

So TL;DR the biggest distraction is every fucking thing in this god forsaken place.

Best girl i've met.

I attended a CMS Conference last month(I don't use a CMS, i'm just interested with the topics about DevOps and UI/UX). I met this pretty lady ( I find her cute and awesome.) who's one of the speaker, she talked about design principles and applying it to BEM with SASS. After the talk, i asked her some questions about her dev't workflow like what tools she used and some best practices. Our conversation went well and exchange some of our knowledge and ideas also i introduced her to devrant (She's a wordpress user, i showed to her how the community hates WP, idk if she registered). After her talked we separated ways and ended seeing again after the conference as she's looking for a cab going to a mall (Same directions where i'm heading to), We talked again and decided to have dinner together. I felt like she's the best girl i met as she's into TV shows i like (Silicon Valley and Mr Robot). We added ourselves in FB and saying goodbye to each other. After a week or two, i just found out that she already into a relationship and it broke my heart.

I guess im back to the start, but i'm happy that i made a new friend.

I broke into hotels WiFi. So here's the setup
They have a main router (TP-Link) which they use for official purposes then they connected the main router to a Microtik router for guests.
I got a glimpse of the software they use for accomodation, billing etc. It runs on php stack maybe MySQL too and some ip can't remember now. I can use wireshark to sniff the packets. Basically should I tell the office of this hotel about the security? Or just let it go.

P.S: Guys you know I'm visiting my gf but I've got some time for myself as she had something to do. So you know I'm not using my laptop when I'm with her.

Oh, my boss never fails to amaze me...

Every fucking time he talks about changes to someone outside the team he says something like:
"we always gotta be prepared for breaks because it is always like that, you change something here and when you see you broke something there"
All in a manner that *tries* to bring tensions down.

And every time I explain to him why the fuck automated tests are important and wtf they do he always manage to understand it as a waste of time...

I'm never gonna give up, motherfucker.

I was messing with my Ubuntu setup, and somehow, I broke it

Since I didn't have a recent backup, I decided to switch to Manjaro

I'm in love

Asus have now decided that a removable battery is a feature people do not need anymore on a powerful laptop.

My battery or charger had a fit and blew the fuse on my charger and broke the battery, and now I have to send my laptop back because they can't send me a new battery, as replacing it myself would void the warranty.

Please for the love of all that isn't completely retarded, nobody start taking more pages out of Apple's book, even some completely non-technical people could handle changing a battery before, this benefits no one.

To make things worse, I'm on holiday right now and leaving the country for a year a few weeks after I get back, so if they can't get it back to me fast enough, I won't have the laptop for the whole bloody reason I bought it for, just because some smart arse designer has clearly never owned a laptop in their life.

I work in a contract position and reviewed the code of a senior engineer recently. Regretfully I can't provide context to preserve anonymity.

He wrote awful JavaScript;

- handled a single DOM element with 2 different frontend libraries
- used the logical operator && to 'chain' two methods (it didn't work) instead of returning a boolean value,
- broke everything down into minute detail (a comment box had 7 components!),
- API calls were made for every component update instead of maintaining local component state where it made sense, which meant UI updates were slow,
- animated EVERYTHING, which made my Firefox on Xubuntu i7 64bit with 16GB RAM beg for mercy.

I had a rough couple of months with interviews, with 2nd stage technical interviewers throwing impossible tasks at me.

Example:

1. Create an online Python code editor with Javascript which can compile Python bytecode,
2. Use Mesos and Kafka to create real time architecture for Tensorflow with a Javascript frontend in 1 day. (I asked, and wasn't allowed to use Kubernetes or serverless architecture),
3. Hack a website from the browser's address bar using parameters ( what?!! ),

Obviously, the next time I meet a 'senior', I'm going to tell him talk is cheap;

'SHOW ME YOUR CODE.'

We just got into a malicious bots database with root access.

So guard duty gave us some warnings for our tableau server, after investigating we found an ip that was spamming us trying all sorts. After trying some stuff we managed to access their MySQL database, root root logged us in. Anyway the database we just broke into seems to have schemas for not only the bot but also a few Chinese gambling websites. There are lots of payment details on here.

Big question, who do we report this to, and what's the best way to do so anonymously? I'm assuming the malicious bot has just hyjacked the server for these gambling sites so we won't touch those but dropping the schema the bot is using is also viable. However it has a list of other ips, trying those we found more compromised servers which we could also log in to with root root.

This is kinda ongoing, writing this as my coworker is digging through this more.

I can you about one really annoying coworker: Me.

The first thing I did as a sysadmim was to break my colleague's rc helicopter. After that I decided to learn Python, pestering him with questions once every two minutes. I developed, using the word loosely, some scripts that I wrote directly on the production servers, with predictable results.

After a while, I broke less things than I fixed. I learned a lot those years. Today I'm still amazed by the patience and knowledge of this guy; I owe most of my career to him.

These days I have a brilliant job stopping morons such as myself from breaking to many things. I try to be as patient and I hope to be as knowledgeable.

Friends of mine have a new flat.

It's a nice flat. Cheap. Noone wanted it. 100 square meters.

Reason noone wanted it...

Previous owners were bastards from hell.

Really. Every motherfucking room needed to be completely renovated by the owner.

Door frames were made of wood, nice and old - at least the part that was left of them. Splinters, scratch marks, partially broken out of the wall.

2 windows needed to be fully replaced. Rest of the windows needed to be bleached, PET abrasive cleaning solution and the frames needed repair with resin as they drilled into the frames. Then treatment with sealant of course.

Yes. There was no other solution. After bleaching you recognized the windows were white. Before... Let's not talk about it.

The previous owners even managed to destroy the bathtub.

The kitchen tiles... Fat cleaner. Bleaching. Abrasion. Polishing.

Soooo.

Day of moving.

The apartment is in the 6th floor / level.

Cran / lift was ordered.

16 people wanted to come.

7 people came.

2 including myself couldn't lift heavy stuff nor walk the stairs due to health issues.

Crane broke after first try.

Today. I want to murder the previous owners. After torture and crucification.

I'm feeling levels of pain I couldn't Imagine before.

Only hate and beer let's me keep my shit together.

I REALLY didn't think after renovating and cleaning the flat for my friends in the last several weeks that it could get worse.

Boy. I was wrong.

Thanks for letting me vent here. I really feel devastated currently -.-

And I need to help them tomorrow, too.

Bikini Atoll, tchernobyl and every other atom bomb desaster Zone combined looks better than the chaos in their flat.

Everyone who could lift shoved everything inside.

I solo carried everything that wasn't too large in the room and then, as every room looked like desaster, completely managed the kitchen (cleaning, unpacking, trash, placing everything where it belongs and so on) :( :(

Current lappy got about 4GB RAM and not enough cores. I can't even run krita without it slowing down more the more I work on a file.
It would be frustrating if only I wasn't so depressed.
So yeah, due to being broke and lack of nerves, I'm gonna completely stop working on the comic for now.

Sent email to my parents this morning telling them to contact me by email since the Pie update broke my One Plus 6 (when I tried to reroot it but got a bootloop and restoring from TWRP screwed it up even more somehow) so restoring it.

First response from my dad: you can use my spare S9...

Yes he has a spare because he got it in a 2 for 1 deal... but I'm thinking uhhh..... It's not like I physically dropped the phone and cracked the screen... (like he did to his late 2 phones)... I'm 99% sure I can restore somehow... Like I did last time (a few months ago)

Today was "one of those days".

So, the state machines were keep on failing. I said fuck it and wrote a simpler loop thing.

Even that failed.

And it took me hours to figure out what was wrong. But I did. Because THERE WAS VIRTUALLY NO FUCKING DOCCO ON THIS SHIT, ANYWHERE ON THE FUCKING ENTIRETY OF THE INTERNET. Hell, I even translated a few pages from Mandarin. Which is ridiculous since I'm working with standard robotic shit. Like, wtf even?

Anywho, I also had a heart attack because the port was not responding. I ran across the building to find the guy who fortunately had another port controller. That didn't work either. Then by the God-given cure of "Turning it off and on again " (it, in this case, being the computers) it worked!

Then I broke the window blinds. It's not coming down anymore.

Like, yeah, thanks, I'll take a weekend and half.

I'm broke but I'm not a "poor person" broke.

I'm fancier broke. I'm broqué.

Look at that. The very fucking smart colleague spent 40 days implementing a repository pattern (WHEN WE'RE USING AN ACTIVE RECORD ORM), breaking stuff left and right. Does he use that fucking pattern at the very least?

Of course he doesn't. And along the way he's making sure to create conflicts with the stuff he broke (and I'm fixing). By the time I fix the merge conflicts of one commit, he pushed 6 of them.

Hired a new BI developer. She tested reasonably ok in SQL, and certainly showed good strengths in visualising data, plus had a good attitude in the interview. We hired her. She broke her laptop the first day. We got her another then she complained the camera didn't work but didn't realise the lever in front of the camera was to move the privacy shutter off and on.

Assigned her some work of taking queries that are used in a BI tool that targets the transactional database directly, and re-jigging them for Snowflake which we're using as a data warehouse now, aggregating all our data into one place. Yet, she's struggling to understand why the SQL query she's pasted in doesn't work as-is.

I go over it again; the source schemas and tables are this, but in Snowflake we've named them this. She then bemoans how much work that is to change them all - I say use find and replace. She then struggles with Snowflake syntax errors and asks for a guide on T-SQL to Snowflake. I show her Google and say "this is what I did when I hit these problems - search for 'Snowflake equivalent to T-SQL getdate()' or 'how to get current date in Snowflake' but she still doesn't understand. I ask if she's every had to work between T-SQL and MySQL or MySQL and PostgreSQL or Oracle and so on and she says yes. I say the syntax isn't the same, is it? And she goes oh, now I understand.

She scored reasonably in her SQL test but I'm now concerned there's something fundamental missing in her grasp of SQL. I gave her a detailed demo of the tools, I explained in the interview and on her start about our move to a data warehouse for all our apps, and put her through some training plus gave her time to work through our Confluence pages - not expecting she'll remember everything, but more to ensure she recalls they exist and what the general contents are.

Anyhow, that's my rant.

TL;DR;

Idiot hard coded database host on the app... Pushed to prod and suddenly shit wasn't working... Took me 10 minutes to figure out what was going on...

Wrote a passive aggressive git message and commited.
Before updating prod my boss turns around to me and the following took place:

Boss: is there any problem with the server?

Me: yes, someone (i know who was ) hard coded the test db IP and it broke the backend.

Boss: oh, but will it affect the mobile app?

Me: well, it won't work but I'm already pushing the fix.

Boss: no..err.. I mean... Will I have to make any change to the mobile app?

Me inside: wtf dude... For real?! Get your shit together...

Me: no. It good, I already fixed it.

Boss: OK. Thanks

TL;DR;

Moron hard coded dB's host and stupid boss can't get shit together nor ask who did it to take precautions...

Finished my on call rotation. Coworker is still on a call for 10 hours. She's not on call. I might be getting on this call. For the sake of the idiots who didn't listen and broke it worse, I really hope I don't have to take over for her. I might get fired tonight...

Stress made me fall into old habits of instead of saying stop and letting my team now that I was falling apart (not realising it myself even) I just kept saying "Yes, I fix that." to every single request that was made in the project.

The closer we got to the deadline, the more I hyperfocused and ignored the signs. I just kept working. The last two days I didn't even sleep.

Of course the launch botched. I finally broke down and both my mind and my body have given up, since yesterday I'm in a mental feedback loop causing continuous anxiety attacks and migraines. I literally CAN'T do anything but trying to not go back into fight- or flight mode and remember to breathe.

I FINALLY made my project manager aware (something I should have done days ago) that I am incapacitated and now I am waiting for medication (Oxazepam) to be picked up at the pharmacy by my husband.

I almost literally worked myself into the ground.

I've been here before. Never again.

This is what happens if you don't listen to your mind and body and put up a white flag in time.

I can't stop the urge to buy Udemy courses. Help!! If I don't stop, I go broke cause I'm still aiming for a job.

This is my first post. I felt like if I'm wrote this I'll just be a big fat crybaby, but i need to release this pressure from me.

I've been pretty burnt out past 6 month.

So a little bit backstory here, I've come from broken family, and currently on my 7th semester of college. But I've been part of small startup as mobile apps developer for a year and a half now.

6 month ago, it just a year of recovery from a toxic relationship that basically ruins my college life. I have really bad GPA (bad score for being absent from classes), basically no friends, and a barely passable (or even bad) skill in Android Dev. Then I got new girlfriend that really supportive for me. But after 2 months, her parents ask me if I would marry her or not. because if not, I have to broke up with her (We're in Indonesia and both of us is Muslim, so outside marriage relationship is kinda in "grey area" depend on who you ask). So I have to choose to marry her or not, and I choose the marriage. I think I have enough saving and just enough income to support both of us.

Then it's been a downward spiral from there.

The startup that I've been working on were in a pretty bad shape. I've been underpaid since the beginning (and that's not really a problem for me at that time, that's my choice and I blame no one) but abysmal growth and some miss management force us to scale back and makes me basically in a non-paying jobs.

So I take college break for a semester and been trying to find projects here and there for marriage savings, but because the weak employee protection here, lots of the projects I have completed have yet to pay the fee (even until today). And even if they paid me, most of it were really low paying jobs (we're talking $200 per 3 weeks project here, to be fair, for our average GDP, it's not bottom-low).

And the deadline is approaching, our marriage date is settled in (very) early January 2019, and i've been in this "not yet graduated but needs job" limbo. Most of employer here still has the old "Degree Based" Job specs, and not "Skill Based" one. so because de-jure I've still a "College Student" no Job listing is willing to take me in. I've apply to almost 30 Job Listing and just get interview once, and still failed because I can't move to the company area, too far and have too expensive living cost vs the salary ($300 living cost vs $450 salary, while i need to give money to my girlfriend back home for a living).

So I switch my direction to Competitions with Extra Job offering as a Bonus, and I've been pretty close to winning one, held by CIMB Bank, but still failed. It's little bit better now because CIMB came interested with me but there is red flag which I need to graduate with decent GPA before July 2019, and in current GPA? it's practically impossible.

Can it getting worse? oh it can. Remember I come from broken home family? it's inherently hard to keeps communication with both of my parents that to this day still despise each other. And while my mother is still supportive to my marriage, my father isn't. He even basically disowned me last week because my one-sided decision to marry my girlfriend, and blame my mother for being the "bad influence" for me.

And now, today, December 16th, and I'm still in this weird Limbo and have nowhere to go. with $0 in my pocket (have spent all of my savings for marriage preparation) And our marriage is approaching. I almost given up.

We are required to use corporate SSO for any authenticated internal websites, and one of the features they require you to implement is a "logout" button.

They provide a whole slew of specifications, including size and placement/visibility, etc. They provide an SSO logout URL you must redirect to after you take care of your own application logout tasks.

Makes sense... except the logout URL they provide to serve the actual SSO logout function broke over 3 months ago, and remains non-functional to this day.

Apparently I'm the first person (and perhaps one of the only people) who reported it, and was told "just not to worry about it".

So, we have a standing feature request to provide a button... that doesn't actually work.

Corporate Security - Making your corporation _appear_ more secure every day...

I grew up on a farm in western KS. My parents bought PCs when I was in grade school. First was a trs80 , then an Epson Equity 1+, where I built a spare key for it, and built levels in willy for my brother to beat. Then a 486 and pentium which I broke often. I ended up working at the same store in college for extra cash. While I'm an adverage developer, I do on and make decent $$. I still help them out with keeping their PCs running, for moms sewing, and dads Linux box. I figure I owe them for their investment in me. They gave me the tools to figure out what I want to do with my career and my life.

as a C# dev every time i have to code something in JS i'm just ranting because

- no types
- no fucking errors

i tried to move a Oval in an HTML5 canvas via Drag and Drop and after one hour I gave up...

such a fucking creepy broke language..
as a proof, if js wouldnt be that fucked up why is there typeScript, CoffeeScript, Brython, ... ?

Cant wait to finally use WebAssember...(really)

I just broke 2 phones in two days... believe it or not... Both screens cracked and no swipe functionality survived...

I miss my fucking Nokia Lumia 930... that motherfucker was almost fully destroyed, screen cracked as shit, I could actually hold the screen on one hand and the rest of the phone on the other and it was still fucking working...

Needless to say, I'm going to Amazon and I'm getting a new Nokia phone, fuck LG, fuck Sony.

*flashback to days of windows xp*
Just finished formatting and installing xp on friend's trash pc cuz the os was compromised due to a shitload of viruses. Notice that other partitions might still be infected and i don't have an antivirus on me.
"Big boi Ill be back in an hour, just whatever you do, don't open ANY drives no matter how urgent it is. Just Don't do it or i won't be able to help you"

Come back and VIOLA this worthless trash avocado opened a drive to play a game and d pc was infected. Again. Back to square one. It almost broke my heart. Almost.

I remember that day well. I was 15yo and hopeful. That day marks d start of my hatred toward tech incompetent people.
SO FKIN
A N G E R Y

So today
College
My classmates stink of incompetence. I'm not that smart in fact i consider myself to be a noob among devs but seeing ppl that are several order of magnitudes trashier than me breaks my heart and makes me soo Fkin

A N G E R Y

Hey you cunt of a skunk, WHY can't you even compile a fkin cpp file without an IDE what the fuck is wrong with you? What do u mean ur program isn't compiling? Well it literally says there syntax error on line 15 congrats u moron u fkin spelled else as esle. Why shud I waste my time on stupid Shitty ppl like u huh?

And waddup mr shithead.No. Not gonna help you partition ur drives and install a fkin linux just cuz ur too lazy to google it urself.
And if i refuse to help cuz im working on my shit then I AM D BAD GUY? Stop bitching about me u lazy bastards get ur lazy arse off and read the fkin book. Watch a tutorial or sm shit why the fuck can't u understand YOU LITERALLY PAY TO COME HERE AND YOU AREN'T EVEN TRYING TO LEARN THE BASICS GOOD LUCK GETTING A JOB YOU WORTHLESS CUNTS.

Now now all the poison is out i can finally focus on improving myself and stop giving a fuck about them. Its hard to be calm and cool when ur surrounded by ppl like this all day. Even harder when there is almost noone that you can look upto. All this time, there's only one thing I've learnt- in a place like dis, being an asshole is better dan being polite.

Just got the Oreo 8.0 update for my OnePlus 5T. Yay!

But it broke something, so now I can't debug my app with Xamarin... 😐

Luckily there's already a bugreport on their bugzilla! It seems like it's been fixed. Just need to update Visual Studio. Guess I'm lucky after all. 😁

...

The problem is still there... 😡
Don't know what to do now... 😕

Today I broke my collar bone. I'm right handed and I can only use my left arm. The worst part is I can't code :(. FML

//Worst day ever.
Everything just broke today. I'm making an app for a website. Of course the site is down and it may not get back up, rendering my work useless.
I wanted to play a game this morning to relax...aaand servers down.
Later I updated the amd drivers on my laptop and now everything is just so slow that I can't use it so I'll be reinstaling windows tomorrow.
And stupid me I thought I could release the app this week.

I'm getting really tired of those dumbass programmers that do not understand shit and then come to me when production breaks. (I am also a programmer, not really a DevOps engineer, but I'm the least worst at DevOps stuff, so it's my job...).

We're programming some kind of document management tool. Today we had a release, and one of the new features is to download all of your documents as a zip file, which is asynchronuously generated. When it's done, the user gets a mail with the download link to the zip file.

The feature works basically, but today it broke our production service, as somebody was running a test of it.

Turns out all the documents are loaded into memory to be zipped. So if you have 2 gigs of documents, a container with memory restrictions in that area will crash.

I asked the programmer who reported this «ops problem» to me, why he didn't just shit the files into a temp foler in order to zip them in there.

He told me that he wanted to do so, but did not know how to mock this for a unit test, and therefore went to the in-memory «solution», which was easier for him to mock.

For fuck's sake, unit tests and mocks are fucking tools, not ends in itself! I don't give a fuck about your pointless mocking code when the application crashes!

When I got to deal with such dumbasses, I'd prefer to mock those motherfuckers with a leaky bucket of liquid shit, which basically accomplishes the same task from my perspective: dripping shit all over the place and make everything suck as fuck.

Intern tries to merge a huge commit without knowing what he's doing. Breaks half the app. I'm at 30 min and counting of having to fix everything he broke.

Ever had a day that felt like you're shoveling snow from the driveway? In a blizzard? With thunderstorms & falling unicorns? Like you shovel away one m² & turn around and no footprints visible anymore? And snow built up to your neck?

Today my work day was like that.. xcept shit..shit instead of pretty & puffy snow!!

Working on things a & b, trying to not mess either one up, then comes shit x, coworker was updating production.. ofc something went wrong.. again not testing after the update..then me 'to da rescue'.. :/ hardly patch things up, so it works..in a way.. feature c still missing due to needed workarounds.. going back to a and b.. got disrupted by the same coworker who is nver listening, but always asking too much..

And when I think I finally have the b thing figured out a f-ing blocker from one of our biggest clients.. The whole system is unresponsive.. Needles to say, same guy in support for two companies (their end), so they filed the jira blocker with the wrong customer that doesn't have a SLA so no urgent emails..and then the phone calls.. and then the hell broke loose.. checking what is happening.. After frantic calls from our dba to anyone who even knows that our customer exists if they were doing sth on the db.. noup, not a single one was fucking with the prod db.. The hell! Materialised view created 10 mins ago that blocked everything..set to recreate every 10 minutes..with a query that I am guessing couldn't even select all that data in under 15.. dafaaaq?! Then we kill it..and again it is there.. We found out that customers dbas were testing something on live environment, oblivious that they mamaged to block the entire db..
FML, I'm going pokemon hunting.. :/ codename for ingress n beer..

Well , this isn't a rant or a joke , so I just thought I should post it here in case people are going through a similar situation . So I know this guy , who works at this startup , so he had just joined the company and made a huge impression on the boss ( My friend is fantastic in developing ) , so as great as that sounds , it doesn't . After a year or so , he's been promoted and is now kinda a face for the devs of the company and this made his boss very cocky , like he would take so many projects or requirements of his top clients and place them on the shoulders of my friend and give a bad time limit , which is impossible but he always managed to just finish completing it . Naturally it affected his sleep cycle , his daily life and as a result , his mental health . As time went on and as more and more projects were being placed on him..........he finally broke , he used to miss so many days of work , not return any of my calls or texts , miss lunches , have breakdowns . I became very concerned and didn't want him to end it , I went to his place , spoke to him , found out that he had suicidal thoughts . Fast forward a year later , he's still going to a shrink , everyday but he's better now and after forcing him to talk to his boss and now his boss gives him plenty of time to finish the projects and said to be straightforward with how he feels and so on . I know this isn't what you would expect to find here but I just wanted to say after having this experience , please do not keep quiet , be straightforward with your boss and don't overburden yourself , if you're an introvert , tell it to someone you know , to tell your boss , and if you know anyone in a similar situation , do be out there for them . I'm sorry if this kinda spoils your mood , but people have to be aware . Be careful , lots of love people

Still on the primenumbers bender.
Had this idea that if there were subtle correlations between a sufficiently large set of identities and the digits of a prime number, the best way to find it would be to automate the search.

And thats just what I did.

I started with trace matrices.
I actually didn't expect much of it. I was hoping I'd at least get lucky with a few chance coincidences.

My first tests failed miserably. Eight percent here, 10% there. "I might as well just pick a number out of a hat!" I thought.

I scaled it way back and asked if it was possible to predict *just* the first digit of either of the prime factors.

That also failed. Prediction rates were low still. Like 0.08-0.15.

So I automated *that*.

After a couple days of on-and-off again semi-automated searching I stumbled on it.

[1144, 827, 326, 1184, -1, -1, -1, -1]

That little sequence is a series of identities representing different values derived from a randomly generated product.

Each slots into a trace matrice. The results of which predict the first digit of one of our factors, with a 83.2% accuracy even after 10k runs, and rising higher with the number of trials.

It's not much, but I was kind of proud of it.

I'm pushing for finding 90%+ now.

Some improvements include using a different sort of operation to generate results. Or logging all results and finding the digit within each result thats *most* likely to predict our targets, across all results. (right now I just take the digit in the ones column, which works but is an arbitrary decision on my part).

Theres also the fact that it's trivial to correctly guess the digit 25% of the time, simply by guessing 1, 3, 7, or 9, because all primes, except for 2, end in one of these four.

I have also yet to find a trace with a specific bias for predicting either the smaller of two unique factors *or* the larger. But I haven't really looked for one either.

I still need to write a generate that takes specific traces, and lets me mutate some of the values, to push them towards certain 'fitness' levels.
This would be useful not just for very high predictions, but to find traces with very *low* predictions.

Why? Because it would actually allow for the *elimination* of possible digits, much like sudoku, from a given place value in a predicted factor.

I don't know if any of this will even end up working past the first digit. But splitting the odds, between the two unique factors of a prime product, and getting 40+% chance of guessing correctly, isn't too bad I think for a total amateur.

Far cry from a couple years ago claiming I broke prime factorization. People still haven't forgiven me for that, lol.

So pretty much all my clients have decided they are done working or responding to emails until the new year. Normally this would be fine and dandy, but I work in an office that says I have to be there every day still, and all my projects are in a state of "Waiting for Client Approval" so I can't move forward on anything.

I've spent two days so far just staring at my work pretending to do things while browsing the web, but I'm losing my mind here pretending to work when I could be doing other things. I still have at least 4 days next week where I will be in the office hoping someone responds, either say something is broke or tell me to push it live so I can get my projects out of limbo.

Broke down and asked the junior dev to help me hash out an issue. He's also struggling with it.

I'm not a retard after all... unless were both retards.

Why do you want to work for this company?
I'm broke and i need a placement for Uni next year

SPECS:

- Dooge X5 max (worst phone ever, can't reccomend, randomly shuts off, displays advertizement, gets super hot)
- Bottle of coke light (so I don't get fat)
- Auna Mic 900-b (I used to do videos on youtube, though they were so bad i've deleted them lol)
- Two HP 24es screens (one of them broke when I let it fall while switching overheating cables)
- Mech keyboard with MX - Red
- Razer Naga 2014 (I regret buying that already)
- Wacom intuos small (I wanted to become a designer for a game with @Qcat)
- Computer with
CPU: ryzen i1600. 3.8ghz, 4ghz with boost, 12threads 6 cortes
RAM: 16 gig
Storage: 250gb SSD, 1tb hdd
Stickers: Generously donated by @gelomyrtol
Cooler: alpenföhn brocken
GPU: ATI 560 (something like that. I took the cheapest as I needed to fit a gpu into the budget, ryzen doesnt have integrated graphics units)

OS: fedora GNU/Linux with KDE as de (though i'm not sure wether i'll stay with it. I recently used cinnamon but it was too slow.

If i'm not on my desk, i'm either doing music studies, sleeping or i'm at school.

When on my deskj, I do
1) programming
2) Reading
3) watch nicob's danganronpa let's plays
4) programming.

My current projects:
clinl.org
github.com/wittmaxi/zeneural

Watched an action hack movie
Then designed a scenario to sniff around a bank and get the encrypted key and finally extract the key and omg!
I've broke into the bank !!!
But seriously, is it worth trying?
I'm not going to do any thing stupid like even taking a dollar , but is it just the way I thought it is?
Will anything unexpected happen?

I'm forced by my job to use this fucking unusable piece of horse shit also know as a Windows operating system.

And it's not only that I have experienced every fucking corner case bug that is possible to occur in our universe.

Not only that that for last 2 years I seen more blue screen than blue sky.

Not only that forced updates fucked my schedules so many times that now I'm really *afraid* to turn off my computer off because I have zero guarantee that I will be able to restart it in a reasonable amount of time.

No, neither of those broke me.

The thing that kills me everyday is, piece by piece ...

WHY THE FUCK THERE IS NO SINGLE, USEABLE, SANE TERMINAL EMULATOR ON WINDOWS

I JUST WANT TO TYPE SOME COMMANDS, COPY/PASTE TEXT AND SCROLL

IS IT TO MUCH ?????

FUCK CMD
FUCK POWERSHELL
FUCK WSL
FUCK ALL THOSE WANKY THIRD-PARTY EMULATORS
FUCK EVERY-COMMAND-LINE-REALATED THING ON WINDOWS

FUCKING USLESS SHIT
CANT EVEN DO SOME SSH COPY/PASTE SHIT
WITHOUT SOME WEIRD CHARACTERS POPING OUT EVERYWHERE.

AND FUCK THAT EVERY ONE OF THOSE MUST HAVE TOTTALY DIFFERENT SET OF KEY SHORTCUTS

AND THAT FUCKING BELL
WHY WOULD YOU EVEN PUT A FUCKING BELL SOUND AS DEFAULT SETTING ??

GO TO HELL MICROSOFT

I WANT MY LINUX BACK

You know as a FOSS developer with no company affiliation the "I am once again asking for your financial support" meme is truer every second

I'm sad and broke please help

I'm too broke rn, so can all my tech devices not act up and cooperate until I have some disposable income again?
I'd appreciate that lots.
Cheers.

Got ncmpcpp/cava/mpd working! (if you're wondering why it's ubuntu, just read a few rants ago :'^> ) and loving it. i gues i'll just open this up for people to post rices or any sort of pretty config. i still shill arch, just not if you like steam and have an nvidia graphics card! i'm in school and i don't really have time to sit down and learn what i broke and how to fix it, even if its a minor issue.

How I knew this was for me.... I didn't.
It kind of just happened in the natural order of things.

I was once a wii young lad who had a dream, and that dream became a smashing pile of being broke, jobless and unemployable, not a great way to start off that early life but hey, it was what it was.

So I looked at my computer one day, lousy dusty Pentium 4 with a massive 80GB HDD, in the corner, and went... fuck it, this thing is going to make me money.

So from there I picked up my old high school book on VB6 and on with it I went, forcing my self to make that calculator I couldn't do in school and a few other things, from there I got into a course for webDev, not uni, and after being dropped from that course ... that's a story for another time, I basically said fuck the system and my journey into webDev took on a life of its own.

Starting with frontend (back when layouts where tables and css was font colours) and IE5 was still a thing, and progressing into JS for a fucktonne of "onClick" events, then backend... I went down the .PHP3, PHP4 hadn't been released yet, but at the time .ASP was a thing too although it was complicated as fuck.

For many years it was just 1 thing after another, picking up MySQL, screwing around with databases, setting up linux servers, gobbling up Python a couple years later and started automating different things, just building site after site, until one day I landed a professional gig - not just casual freelance stuff, and from there when you think you know a lot, what I thought I knew got blown out the window and imposter syndrome sunk in, but I kept pushing ahead.

That saying "you don't know what you don't know", it has meaning here, you don't know what you don't know... but the moment you know you don't know enough, you either crumble or you keep waterboarding yourself in knowledge to reduce the unknown.

And somewhere along the line I accepted this path.
It may have taken me a few years to get off my feet but I'm glad I took that first step.

A few months ago I bought an e scooter to get from home to work.

The backstory to this:
My car broke down on the highway, my sister's car broke down on the highway and we didn't have another car apart of my dad's anymore.
Which means I had to look for another car. The cars between 1k-5k € are dogshit and when you want to register the car you have to have an appointment at a government building which happens to be closed when I'm getting out of my 8-5 job.
I had enough and bought an e scooter.

Now back to now:
In the beginning it was cool.
Could get anywhere I wanted to in combination with the Germany ticket. Except for the Netherlands where my beautiful girlfriend is.
There I can legally not use it but that's ok lol.

The German government is hyping e mobility and public transportation up, but for what?
E mobility currently sucks ass with all the shit laws for e.g. e scooters and when you want to transport it in public transport, people give you weird looks, the bus driver wants you to buy a bicycle ticket even if I can fold the e scooter and more. The scanners in the bus of the German buses cannot read my German ticket for some reason and every bus driver in my city knows that and they just look at it and are like "Ok, you're cool. Continue moving", but this old grandma looking ass bitch is like "No, according to the law you need to show it to the scanner and not to me". I fucking know. I've been doing this shit for a year and you know that but it doesn't work. It says to me that I need to show it to you instead of to the scanner bc this machine is fucking dumb and apparently I'm holding the people because I started a discussion with her. This driver ... ugh. The buses in my city come whenever they want as well.
Like sometimes 5 minutes earlier, sometimes up to 30 minutes later.
Inconsistent motherfuckers and I am the one making everyone wait? Suck my donkey kong balls.

German trains... well you know how that goes. It doesn't. It sucks ass.
Every single fucking train line has a problem. Either a previous train has something, or staff is missing, or a technical error or the train driver's ass is itchy and needs scratches from his assistant. There's always something.

When I want to travelled home from my gf I spent not lying 8 fucking hours on the trains on Sunday.
Normally it takes max. 5 hours with a train and 3-4 hours with a car.
I can also go on a rant because of the Dutch train system because it also sucks, BUT they are reliable. They are there when they say they are gonna be there. 99% of the times.
In Germany it is somewhere at 10%.

Now I realized that e scooters are uncomfortable and expensive toys who need maintenance just like a car but nonetheless they are reliable unlike the public transport.
In the winter it will be even worse.

Electrical cars are way expensive and affordable electrical cars you need to keep charging every few baby steps.

I also looked at 125ccm motorcycles which you can drive if you upgrade your existing car driver's license, but ngl that's a scam. Not worth it at all.

And that's why I am looking for a traditional car now. E mobility is not there yet in Germany and public transport is not doable at this moment.

Bloody scammers and bloody Paypal.
So I bought echo spot just to see how good it's voice recognition is and also wanted to see what the spot does different. So I found out that it was like hello world for AI. So I wanted to sell it on ebay-kleinanzeigen.de. It's a website from Ebay here in Germany where you can easily sell your stuff that you don't need anymore. I put it there and someone just wanted it so badly and he said that he broke his friends spot and he has no money and he need it very badly cheaper. My price was 98€ and I believed him and sold it for 85€. Now he got the device and wants the refund because the device doesn't match the description and the things he mentioned weren't even in the description. The message you see in the pic it says: It doesn't do skype and it is impossible on that device. First It is his responsibility to inform himself about the device features I'm not Amazon to write something like that in the description I've to just say how the device looks. Second it does skype and it is possible but both partners must have the same device and they should connect it to their smartphones.
But that is not the bad part that my money is ceased and got ownd by a scammer. The bad part is that I wanted to reply his message but the bloody paypal design won't let me do that. Remind me how old is paypal now? It's been there for ages and the footer is just stuck in the middle of the page and won't allow me to click on reply button. Of course I later managed to write a reply but paypal shouldn't have these kind of problems.
I'm so upset right now because these things are wasting my time. I've my final exame in a week and I've to develop a parameter based multilingual CMS, just imagine how long would just data structure take.

My fucking pixel XL just broke. Fuck me, fuck this and fuck every fucking thing

I hope I'm not stuck with this broke ass piece of shit I used to use.

So we had this legacy Objective-C codebase for a mobile app that was actually pretty good: I'd inherited the codebase and spent the past several years gradually improving it and I was actually quite proud of the work I put into it. So of course management decides to scrap it (with NO consultation from the engineers) and outsource a complete rewrite of the app in C# for Windows Universal.

Let me tell you. That code was without a doubt and without exaggeration the *worst* code I've seen in my close to 30 years of experience as a developer. I mean they broke every rule in the book, I'm talking rookie mistakes. Copypasta everywhere, no consistent separation of concerns, and yet way too many layers. Unnecessary layers. Layers for the sake of layers. There was en entire abstraction layer complete with a replicated version of every single data class *just* to map properties in pascal case to the same property in camel case. Adding a new field to a payload in the API amounted to hours of work and about eight different files that needed to be modified. It was a complete nightmare. This was supposed to be a thin client, yet it had a complete client-side Sqlite database with its own custom schema (oh and of course a layer for that!) completely unrelated to the serverside schema, just for kicks. The project was broken up into about eight or nine different subprojects, each having their own specific dependencies on various of the other subprojects in such a tightly-knit way that it made gradual refactoring almost impossible. This architecture was so impressively bad, it was actually self-preserving!

Suffice it to say it was a complete nightmare, and was one of the main reasons I ended up leaving that company. So just sayin', legacy code isn't always bad. :)

So, unlike normal people who just click on an mp3 file in windows explorer, I'm listening to music saved on my windows hard drive, accessed via an sshfs mount, using VLC running inside a HyperV linux VM and Xming/pulseaudio to make it show up inside windows like a normal window and play sound.
Why? Because this is my replacement for WSL which broke (Good Job on the updates as always, M$) and I'm celebrating that I got everything* to work.

* Nevermind the hours I wasted because I forgot to add a rule to the windows firewall allowing pulseaudio to connect and the fact that Xming can't handle vlc playing video

Not really a rant and not very random. More like a very short story.

So I didn't write any rant regarding the whole Microsoft GitHub topic. I don't like to judge stuff quickly. I participated in few threads though.

Another thing is I also don't use GitHub very much apart from giving 🌟 to repos as a bookmark. Have one hobby project there. That's all. So I don't worry that much. I'm that selfish and self concerned. :3

I was first introduced to version control system by learning how to use tortoisesvn around 2008. We had a group project and one of the guys was an experienced and amazing programmer unlike the rest of us. He was doing commercial projects while we were at our 1st and 2nd year. Uni had svn repo server. He taught us about tortoisesvn. He also had Basecamp and taught us how to use it as well. So that's how I learned the benefits of using versioning tools and project management tools. On side note, our uni didn't teach any of those in detail :3

After that project, I was hooked to use versioning tools. So until school kicked me out, I was able to use their svn server. When I was on my own, I had to ask Google for help. I found a new world. There are still free svn services that I can use with certain limited functions. That's not the new world; I found people saying how git is better than svn in various ways. It was around 2010,2011.

At first I was a bit reluctant to touch git because of all the commands in terminal approach. But then I found that there is tortoisegit. I still thank tortoisesvn creator for that. I'm a sucker for GUI tools. So then I also have to pick which git servers to use. Hell yeah, self hosted gitlab is the way to go man. Well that's what the internet said. So I listened. I got it up and running after numerous trial and error. I used it briefly. Then I came back to my country on 2012-2013; the land of kilobytes per minute (yes not second, minute).

My country's internet was improved only after 2016. So from 2013 to 2016, I did my best not to rely on internet. I wasn't able to afford a server at my less than 10 people, 12ft*50ft office. So I had to find alternative to gitlab which preferably run on windows. Found bonobo and it was alright. It worked. Well had crazy moments here and there when the PC running Bonobo got virus and stuff. But we managed. We survived. Then finally multi national Telecom corporates came to our country.

We got cheaper and faster mobile data, broadband and fiber plans. Finally I can visit pornhub ... sorry github. Github is good. I like it. But that doesn't mean I should share my ugly mutated projects to the rest of the world. I could keep using Bonobo but it has risks. So I had to think for an alternative. I remembered that gitlab didn't have cloud hosting service when I checked them out in the past. So I just looked into Bitbucket and happy with their free plans of 5 users and unlimited private repos. I am very very cheap and broke.

That's why I said I don't really care that much about the whole M$GitHub topic at the beginning. However due to that topic, I have visited GitLab website again and found out they have cloud hosting now and their free plan is unlimited users and unlimited repos. So hell yeah. Sorry BB. I am gonna move to cheaper and wider land.

TL;DR : I am gonna move to GitLab because of their free plan.

300 global variables.. THREE HUNDRED FUCKING GLOBAL VARIABLES?
Are you for real?

Now let me check the line numbers again..

hmm.. line 97 to .. yep line 410, just a few new lines to seperate some of them or.. group? Idk, I've given up on trying to understand those.

Now you may ask "But ThatPerlDeb, where did you see this and what was the intention?"
Low and behold, take a chair and I may explain this to you.

First of all: Fuck the dev that wrote this!
Second: Fuck all the devs that kept up with this practice or whatever you want to fucking call this!

Now, the application is our POS system that our customers can use for a monthly fee (That this piece of garbage even requires payment is disgusting) but anyway..
The global variables sometimes are declared for labels, sometimes for some frames, sometimes just for random values to be there.

We're using Perl for the POS system and Perl ain't the best at OOP, so in the dev's defense I can understand why you'd use a few global variables, but not fucking 300!! FUCK OFF WITH THIS BULLSHIT!!

So now I'm going through this torture slowly but surely deleting globals and putting them into some sort of scope and always MANUALLY test if something broke. Again, this company sucks ass and there's nothing that could even be considered a "unit test" or something like that, so fuck that, too.

After two hours I've brought down the count of global variables to about 260, so there's progress being made..

But then, there comes more!

"But how???" you may ask, and you're right, I've asked that myself.

Now to resolve the global stuff in each file some of the initial globals are used, we got about 20-30 files which do different stuff, all fair and square, at least there was an attempt at seperating functions but god this mess is so fucking fucked up. So in order to "safely" delete a global variable I have to check if any of the variables are used in another file, and if so, in which scope and how they are used.

Spaghetti would be a compliment for this fucking disgusting piece of utter bullshit.

Let alone the code quality of this "code"
Indendation? Dafuq is dat?
Scope? Nah, we got everything global anyway
Function size? Well, some are 5 lines, some are 900 lines, who cares anyways, right?

I'm so fucking glad once I leave this shithole, for real.

It is the year 2451 ad and mankind rules the galaxy with a lazy iron fist. There are roughly 14,000 civilizations, comprised of just over
17,000 intelligent species on a quarter of a million earth-like
worlds. And all of them call themselves 'the galactic empire'.
No one told them that twenty planets doesn't qualify them for the title "galactic."

Well, we could rule, if we wanted to. Most of its just backwaters that no one wants anyway. It turned out that the reason no one invaded earth before was because they were too busy fighting themselves. Stupidity it appears, is not a unique human quality.That and the sex robots. Theres more of them in the galaxy than actual meatbags. Many species had taken to artificial wombs and 'vatbabies', which is exactly what they are called. Those poor bastards will carry that label for life.

We never did break light speed, but most of the rich exist in hypersleep anyway. Most of them only wake up once a year or so. There are some that only creek out of bed to check their stock portfolio. I hear there is even one trillionaire thats up and about once a century to ask if we have broken light speed yet.

Despite all the progress over the last 400 years, historians all agree about the most significant event in modern history.
The lobster went extinct two hundred years ago on earth.
Theres been riots ever since.

* * *

In other news I'm still working on the game I guess. It's like totally the most okay indie game you'll ever play--if I ever finish it.

I put about a year of work into the NPC system, and then chatGPT came out.

After everything thats happened, at this point I may just make a game about an indie dev making a survival game, being stuck in the actual apocalypse or some weird political dysopia.

Put it on rewind, it was originally a zombie game. But at the time the market got flooded and steam sales for zombie games cratered. So I pivoted to something more along the lines of fallout. Then the flash market crashed, bunch of publishers folded, and adobe stopped support for flash (probably for the best). Then newgrounds, which I was gonna launch on for promotion (because actual marketing is expensive), ended support for flash.
Was going the route of kickstarter, and that year the KS market got flooded and the bar rose almost over night so you needed super high production quality out the gate, and a network of support you already built for months.

We had a brief nuclear war scare, and I watched the articles come out about market saturation for post-apocalypse games, so I pivoted back to zombies. Then covid happened and the entire topic was really fucked. So I went back to fallout meets rimworld. Then we had a flood of games doing that exact premise pretty much out of the fucking blue, so I went for a more single-survivor type game. Then ukraine happened and the threat of nuclear war has been slowly sapping the genre of its steam, on well, steam.
Then I was told to get a cancer screening which I can't afford. Then I broke a tooth and spent a month in agony.

Then a family member died. Then I made no money from the sale of a business I did everything to help get off the ground, then I helped renovate an entire house on short notice and sell it, then I lost two months living in a hotel
while looking for a new place to live. Then I spent two and a half years suffering low-level alcoholism, insomnia, and drifting between jobs.
Then I wrote amazing poetry. And then I rediscovered my love of math. And then I made out for the first time in over a year. And then I rediscovered my love of piano and guitar. And then I fell into severe depression for the last year. Then I made actual discoveries in math. And I learned to love my hobbies again, and jog, and not drink so much, and sing, and go on long drives, and occasional hikes, and talk to people again, and even start designing games and UIs again. And then I learned that doing amazing things without a lot of money is still possible, and then I discovered the sunk cost fallacy, and run on sentences, and how inside me there was a part of me that refused to quit because of circumstances I couldn't control, and then I learned that life goes on even when others lives have ended, even when everything and everyone never had an once of faith in you, and you've become the avatar of the bad luck brian meme..still, life goes on.

And we try to pick up the pieces, try, one more time, because the climb, and the fall, and the getting back up, is all there is.

What I would recommend, if you're thinking of making a game, or becoming an independent game developer, is, unless you have a *lot* of money upfront (think 50-100k saved, minimum, like one years income *bare* minimum), and unless you already have a full decade in the industry--don't make a game.

Just don't.

idk why I'm so anxious about money... I'm not broke, I'm better than most people my age, ffs i have savings, but whenever i think of spending on sh*t i need i start thinking about what if i get fired, what if i have to move back with my parents, where do i put my cat???
wish my brain was doing better tbh

2019 broke me
2020 opened my eyes
2021 I'm back on crack
2022 ape mode

I'm really not sure. When I was 7-8 years old, I liked to view source in IE, then I somehow managed to use Javascript in the browser. First only some dumb opening of windows. And I liked Batch, so I made some files for copying, backup and stuff.

Then I got to PHP during the years from some online tutorial about making dynamic websites. My website was more static than stone, but yeah, I did page loading with PHP! Awful experience anyway, because I had to install Xampp, get it work and other stuff. 11 years old or so. (and I used Xampp only as a fileserver between laptop and desktop later, because.. PHP4... just no.)

As 12 years old or so I experienced my first World of Warcraft (vanilla) on a custom server in an internet cafe and I thought it's a singleplayer game. When I found out that no, I googled how to make my own server (hated multiplayer back then and loved good games with huge storylines). Failed miserably with ManGOS, got something to work with ArcEMU. There I learned some C++ basic stuff, which I hoped would helped me to fix some bugs. When I opened the code I was like: "Suuure." and left it like that. I learned what a MySQL database is, broke it like four times when I forgot WHERE and still rather played with websites i.e. html, css, js and optionally php when I wanted to repair a webpage for the server. With a friend we managed to get the server work via Hamachi, was fun, the server died too soon. Then I got ManGOS to work, but there wasn't really any interest to make a server anymore, just singleplayer for the lore. (big warcraft fan, don't kick me :D )

I think it was when I was 13y.o. I went to Delphi/Pascal course, which I liked a lot from the beginning, even managed to use my code on old Knoppix via Lazarus(Pascal). At this age I really liked thoae Flash games which were still common to see everywhere. So I downloaded .swfs, opened and tried to understand it. Managed to pull some stuff from it and rewrite in Pascal. Nope, never again that crap.

About the same time I got to Flash files I discovered Java. It was kind of popular back then, so I thought let's give it a try. I liked Flash more. Seriously. I've never seen so much repetitiveness and stupid styling of a code. I had either IDE for compiling C++ or Pascal or notepad! You think I wanted my code kicked all over the place in multiple folders and files? No.

So back to Pascal. I made some apps for my old hobby, was quite satisfied with the result (quiz like app), but it still wasn't the thing. And I really thought I'd like to study CS.

I started to love PHP because of phpBB forums I worked on as 15 y.o. I guess. At the same time I think there was an optional subject at school, again with Pascal. I hated the subject, teacher spoke some kind of gibberish I didn't really understand back then at all and now I find it only as a really stupid explanation of loops and strings.

So I started to hate Pascal subject, but not really the lang itself. Still I wanted something simpler and more portable. Then I got to Python as hm, 17y.o. I think and at the same time to C++ with DevC++. That was time when I was still deciding which lang to choose as my main one (still playing with website, database and js).

Then I decided that learning language from some teacher in a class seriously pisses me off and I don't want to experience it again. I choose Python, but still made some little scripts in C++, which is funny, because Python was considered only as a scripting lang back then.

I haven't really find a cross-platform framework for C++, which would: a) be easy to install b) not require VisualStudio PayForMe 20xy c) have nice license if I managed to make something nice and distribute it. I found Unity3D though, so I played with Blender for models, Audacity for music and C# for code. Only beautiful memories with Unity. I still haven't thought I'm a programmer back then.

For Python however I found Kivy and I was playing with it on a phone for about a year. Still I haven't really know what to do back then, so I thought... I like math, numbers, coding, but I want to avoid studying physics. Economics here I go!

Now I'm in my third year at Uni, should be writing thesis, study hard and what I do? Code like never before, contribute, work on a 3D tutorial and play with Blender. Still I don't really think about myself as a programmer, rather hobby-coder.

So, to answer the question: how did I learn to program? Bashing to shit until it behaved like I desired i.e. try-fail learning. I wouldn't choose a different path.

My old mechanical keyboard broke, so I had to buy a new one. I'm Brazilian, so the local market for mech keyboards is either limited or very fancy (fancy as gaming keyboards).

So I got this amazing Logitech G610, which unfortunately is not sold with blue switches here, only brown ones. Very solidly built, well made, good extra keys and whatnot.

BUT OH MY, who ever thinks those LED effects are good for normal usage after 5 minutes of playing with them??? VERY distracting! <o>

Around 6 years ago I started at this company. I was really excited, I read all their docs then I started coding. At every code review, I noticed something was a little off. I seemed to get lots of weird nitpicking about code styling. It was strange, I was using a linter, I read their rules but basically every review was filled with random comments. About 3 months in I noticed, "oh! there aren't actually any rules, people are debating them in my code reviews!" A few more reviews went by and then I commented, "ya I'm not doing any of this, code review isn't a place to have philosophical debates." All hell broke loose! I got a few pissed off developers, and I said, listen I don't care what the rules are, you just need to clearly fucking articulate them and if you want to introduce one, I don't care about that either just don't do it in the middle of my review. I pissed off 1 dev real bad. Me and this dev were working together, the QA person on the team stood up and said "hey! you know what I love about your code reviews?!" The other dev and myself looked at each other kind of nervously, "I love that you're both right, these are all problems!"... 1 year later (and until now) me and the other dev are still friends. Leave it to QA to properly identify the bug.

I want a cozmo and a vector. 😛 (the robots, I mean)

I'm broke tho. Wishful thinking, this is.

I really need to get my shit together. Can't even begin to describe what's going on in my mind right now.

God damn I'm gonna rip anyone's ass who so much as came within 5 meters of me.
Few months back, my dad's colleague dropped his (my dad's) phone and broke the screen. She was a low pay nurse, so my dad didn't ask for compensation. Instead of repairing it, it would be a better deal to get a new phone altogether, so I got him one on Credit (I didn't have cash).

Now amidst all this horseshit 🏇 in my own office and this pussy of a boss, and my hobby of learning coding and trading stocks part time to make a little extra money so that I can help dad with home loan repayment, I forgot to pay the credit bill.
Had to pay $25 as late charges. Motherfucker.😣

Wow man. Can the day get any worse
Mother fucker creator of Android. Now I'm A long time android user, but
Android+Snapdragon 6XX chip+Moto= worst combo ever. Damn you creators, may You be deepfucked by a mad bison in heat. Cocksuckers.

The heat my Moto X play generates, I could make an omelette on top of it. And the newest feature, where you try to type, but you can't see anything happening, when 30 secs later, you suddenly start seeing the after images of all the buttons you pressed, all the text you typed. Why maybe I typed at the speed of light and android couldn't keep up. No.
NO! You dumb fuckin POS. NO. I threw my phone 20ft, broke the tempered glass. The case protected this shit. Once I can save enough, I'll either sell a kidney and get an iPhone or even better a OP5.
Nothing disgusts me more than slow hardware​.

I was nearly about to punch someone today.

So, this guy is taking issues with my 3D model, yeah? But it's not the model he has issues with, it's that "why doesn't this include the stuff """I""" need?". Well, you giant man-baby could have actually visited the model like two months ago when I made it, but noooooooo let's leave it until a few days before his massive demonstration is due. Plus, the pieces I received from someone else also didn't have this info, so, like, where do you want me to get them from? Oh, from the "other" model that was literally delivered by a third party like two weeks ago? Nice. Hold onto your breath while I go rip that model apart piece by piece and put the info you need, in the format you need, in this model. 😒

... Jeeeeeez. And my computer broke down two days ago. 🤦

Could this get any worse? It could, but didn't. Luckily, someone else gave me a hand, so now I just need to go to work on a weekend just to install unreal engine again just so I can rip the second model apart for this one piece that he "really needs".

The worst part? I'm sure all of this tantrum is actually so he can justify why his work is ... well... "not working".

Let the finger pointing games begin!
(Actually not afraid of that at all. My boss knows better so yolo)

Idk, my brain is eeeeeeeeeek.

I never understood or will understand my mother or positive energy that resides in her, so I'm going through a little tough time here, broke and unemployed and she just challenged me to shave off my 'stach and beard and something good will happen in my life, so I did just to prove her wrong

I'm rewriting a game from C++ to C just for the purpose of learning and adding more features, however; after I refactored the code, the game broke with a segmentation fault and I have no idea where the memory issue is.

I've been debugging for hours now and I've got nothing. FML

Fucking fuck shit monkeycocksucking gargling wtf!

I was getting some stuff done in my accounting software and it bugged me that the fields were dark and the fonts as well, thus seeing fucking shit. This was clearly a bad choice of a gtk3 dark theme, thus i switched to the fucking default adwaita, suddenly gnome session crashes.
Ok, i just log out and log back in.
Logout.... Nothing happens.... Ctrl-alt-backspace , nothing happens (and i knew i enabled that in the settings)
Ok let's do it a bit more forceful and restart the display manager... Gdm starts... I insert my credentials... It fucking crashes.

WTF!!!

I desperately try to debug it, xsession error msg'es? Nope. Something in /var/log/messages? Nope. Something, anything at all, nope sherlock nopedinope!

About to go batshit crazy, purging and reinstalling all of gnome, thibking that, what ever setting lust have broke it, it will be fixed now.

No fucking fuck desktop!!!

I lost my nerve and replaced gdm with lightdm, and i finally, after three hours wasted on my machine, i get my gnome desktop back... But in a state of mess! Extensions don't work and make it crash again, user themes? Nope, go fuck yourself with plain default.

I'm really losing my shit, business is almost non-existant, and now ly FUCKING desktop refuses to work like i want to. Everything is fucking broken to shits !!

I'm gon a go to my gf, and relax a little, at least i still have a working laptop.

Question is, for how long???

Fml

I broke up with Spacemacs. My configured Prelude, baby i'm in mood for you.

if you're gonna shitpost in devrant, make sure to tag as shitpost.

I like shitposts as long as they are acknowledged as such. The problem ones are unironical shitposts.

These lazy ass posts that seem to be written by someone bored in a commute are liquefying my shit.

I'm referring to 2 line posts like "it's hot in here" or "x broke today" with no development whatsoever.

Like people think this is Shitter or something and they can just spam shit about every mundane detail of their day to day.

That's chit chat, nothing wrong with that, but you don't chit chat in a forum, you dm your buddies.

I would like to have more time to work on the old, lonely, dust gathering site I started to build. There was a lot of new skills I wanted to test and train. But my personal life is getting stressful in the last time. Wife broke her leg and my son started in kindergarten.

I'm starting a new job in Dec, so I quit my current job. I had to reduce my work hours to collect my son from kindergarten. Sounds like I have much time now? Nope, there somehow is few time for programming. I enjoy bouldering (thats where the leg thing happend 🙄) and that's where even more of my time goes.

I see my project become ugly in the meantime, because there are even more new things I read about and would like to use...

I have "we do not outsource any development" very clearly written multiple times on my LinkedIn profile and yet I still get 10-11 messages a day asking me to hire their sketchy Ukrainian
/indian software devshop, moreover to handle my fucking PHP MySQL needs (I very specifically write multiple times on LinkedIn and elsewhere that we do not use those tools). I've just stopped accepting requests from India and Eastern Europe, and if their headline mentions recruitment, anything "specialist", or blockchain that's an automatic ignore.

The funniest part is that they all say the same "we specialize in your needs" are you fucking kidding? If you read any part of my company profile or my profile you'd know that your specialty is anything BUT our needs fuck right off

Edit: I'm going to also specify that I'm a broke college student with a tiny software startup, so not only can I not afford their devshop but also why would I outsource the only thing we do?

You know that point when your pc is just not capable enough? And you are on holidays with so many ideas that you want to code up?

I'm there.

Never thought being a broke student would be this bad.

My life! What has it come to ?

(I'm primarily backend but I'm broke so I can't hire the frontend devs)

Hopefully, you already know that the company controlled by the alledged reptiloid subhuman and olimpic testicle juggler formerly known as Mister Zuck My Tits is not to be trusted.

But as is always the case in this bitch, I've been forced into cowjizz flooded swamps' worth of stinking shit platforms for the sake of avoiding isolation.

And so, I've just found yet another way in which Facebook **THUNDERSTRIKE** ... the company, not the geriatric ward, is one of the CROWN ACHIEVEMENTS of human civilization.

Let me tell you something: some people are fucking broke. Hell, some people sleep on the streets, live on scraps, and willingly engage in acts of public defecation when provoked. But I'm not even talking about them no, just plain *broke*.

And so imagine being that guy who doesn't really use his phone much, except maybe for sharing cat pictures with mom because that's what being an absolute chad is all about. You don't get a new phone, because money is a __little__ bit tight. But THEN...

The dreaded CAPITAL strikes, and requests of you to bend and fall onto your knees so as to provide intense, intimate and manual -- as well as oral -- PLEASURE to the [NOT SO] METAPHORICAL PENIS of the """SYSTEM""".

Oh, what an abominable, drooooooling revenant that lies before you!

"Gimme your ass... " he says, menacingly, as you wail about in a futile attempt to guard and preserve the very last vestiges of your own anal virginity.

And so you fight, and kick him in the NADS with everything you have, down to the final shreds of vigor. Victory! Or so you thought...

"You must... " he mutters, mortally wounded "update WhatsApp... "

"Still you breathe?!" you exclaim, suddenly transformed into a heroic, sexy moustachoed arquebusier "After I'm done ~OILING~ my VICTORIOUS CHEST, I *shall* bestow DEATH uppon you!".

But as you rip open your shirt to apply sensual oiling to your marvellous frontal assets, your nemesis reveals it's portentous Portugal: "this new version of Android... " he gasps as he perishes "is incompatible with your device... "

"Ughh! Sacrebleu!" you shriek out in pain, realizing that you are now unable to ACCESS THE FUCKING DATA THAT IS IN YOUR OWN FUCKING HARDWARE BECAUSE OF A STUPID FORCED BINARY INCOMPATIBILITY.

That's right. Now even if I *do* get a new phone, I can't do shit about losing all of the family memes. And contacts and all of that shit, but the stickers are more important. A minor inconvenience, yes, and it didn't need all of this preamble but I was doing the dramatic fight scene bit inside my head as I was writing and I got into it.

Because the only documented way to transfer all of that data is to OPEN THE APPLICATION and scan some code, but everytime I go to do that, IT TELLS ME I NEED TO UPDATE. And every time I GO TO UPDATE, it says that MY PHONE is TOO FUCKING OLD!! AAAAAAAGHGHGHGHGHGHGHG!!!!

And you too, might be a dashing french man from centuries past, with both balls and tits down to your fucking knees, folding your arms in a position that exhumes smugness in a disgustingly irreverent and self-aggrandizing way, looking at me as a mere plebeian who cannot wrap his head around the mystical art of interacting with Google's black deuce box.

And you would be somewhat right in your judgement! But just having to fiddle about with these fucking pocket Elmo screens is such a traumatic experience for me that I'd rather lose my stickers.

[ADBREAK] Are you a debonair victorian undercover butt pirate, taking unparalleled care of your Falstaffian, highfalutin poils pubiens? Need your "sword" sharpened, as you browse through the pages of this magnanimous lexicon? Would you rather allocate final death to your coworkers than learn one more synonym for sonorous, supercilious and pontifical?

We all know that ALL you need to help keep that honor intact is slaying your enemies in high-stakes combat. But how to satisfy less gallant needs, when male prostitution is outlawed in more than sixteen duchies?

Look no further than BloodCurse, the ancient hex that will haunt your family for countless generations! With BloodCurse, you may crawl the earth as a mindless, shameless, piece of shit cockswallowing JUGGERNAUT that craves nothing BUT the consumption of scabbed human ass!

BloodCurse is easily contracted through consumption of the GENITAL fluids of highly-lecherous succubi, conjured through [EXTREMELY CENSORED]! This forbidden arcana allows the user to debour HIS OWN testicles in no time!

Get your bottle of scents, sensual Portuguese chest oils, and fucking designer-drug bath salts for the low, low price of a passionate, unceassing self-blowjob! And use my code FRONTALASSETS for 60% OFF in your next soul-robbing foray into the felational dark arts!

Big ups to BloodCurse for sponsoring this RRRRRRRR~$RRR$$RR%5RRRRR$0000:>A48CC50A E3A1B22A : 330D4750 7C24E5A5|.......*3.GP|$.. 5262E7D5 0D1C24E6 : 85594B39 1CB7593E|Rb......YK9..Y>

:~

My family absolutely did not support me. Throughout my life my parents wanted me to become an accountant (like my sibling) and encouraged me to pursue that. In 8th grade I initially broke the news that I wanted to get into software development and was told "computers won't be around for another 10 years (this was probably around 2010), don't go into something so stupid". For reference, we had 1 family computer up til 2008 which we had limited amounts of time with.

Every year after, up until the end of 12th grade I told them I planned on going into software dev, and they got angrier each time, before finally they stopped speaking to me for a short time over that summer after I told them I had been accepted into university for computer science.

Now, in my final year, they still think i'm throwing my life away. Their disapproval is what has been motivating me the most, to prove to myself that I can support myself and create good things.

Technical meeting

We were at technical meeting a while ago, they discussed our infrastructure implementation, all was good.

Then some motherfucker of our technicians, suggested that we should move to bitbucket, I fought fiercely to don't even think about leaving bitbucket.

Suddenly the cock swallowers bosses agreed to bitbucket, they submit their changes.

10 min after the meeting i broke into the biggest boss room, gave him my resignation letter, I just told him, signing your acceptance to move to bitbucket, you should sign this too.

Boom, assholes.
I'm free now.