Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "code not working"
-
TL;DR: Clients are dumb.
Client IT Lead: "Your code isn't working on our website."
Me: "Because you didn't load our code into your website. Do that, and everything works."
CIL: <proposes terrible alternative>
M: "No fix on my end will matter if you don't load our code into your website."
CIL: <more disagreement>
M: "Let me discuss with my team and I'll get back to you."
... later that day, in a follow up meeting with client's team ...
M: "Load our code into your website as was initially intended and everything works fine."
CIL's Boss: "That makes complete sense, and I'm not sure why we weren't doing that from the beginning. Let's make that happen, CIL."
CIL: "Okay."
——
👨🏽💻🤷🏽♂️🤦🏽♂️6 -
Code not working.
Comment out code.
Slowly rewrite it bit by bit till it works again.
Check against commented code.
They're the same.
Wtf.
Seven hours wasted on this shit :/3 -
CS Teacher: *provides shitty code written in (I kid you FUCKING NOT) Microsoft Word, sans font*
Me: *Submits beautiful, fully working and commented code*
Half a point off because I didnt write how many points the assignment was worth at the very top of the code.
ARE YOU FUCKING KIDDING ME YOU CUNT GOBBLER?! YOU JUST **HAD** TO TAKE THAT HALF A POINT OFF, DIDNT YOU? MAYBE YOU'RE INTIMIDATED BY THE FACT I DONT USE MICROSOFT WORD TO WRITE C++?? God, I hope you take a nail gun to the eye.16 -
At customer site with my boss.
Boss: let's check this code which is not working
Me: ok (starting the debugging session)
I found this code, which was failing during the writing on disk for some reasons.
try
{
....
writer.writeline(some data);
....
}
catch(Exception ex)
{
....
}
Boss: ok it fails to write data but we need to, let's manage it like this:
try
{
....
writer.writeline(some data);
....
}
catch(Exception ex)
{
writer.writeline(some data);
....
}12 -
Our company got attacked last month by what i believe was a code time bomb from a ex employee. And it was brutal, website hacked, email server not responding, locked out from database servers. The IT department asked for my help and I was more than happy to do it. Long story short I got every thing back working smoothly. The IT guys ask for a favor to not include this in my monthly progress report. Fine by me. But then they went out and tokd the top management that they are teaching me about the networks and servers so thats why I was working with them last month. Fucking assholes. Not going to help them any more.3
-
So, I'm programming a control system for a prototype aerospace vehicle. You know, the stuff that needs to work to prevent falling out of the sky.
Anyway, test day was today (was -- not anymore). Wiring all the electronics, everything is actuating and works well. Except for one part, a little thruster for stability.
I spent hours - literally, fucking hours - trying to fix the problem. Wrong address? Wrong syntax? I had absolutely no clue what was wrong. Queue the hardware guy, $stupid:
$stupid: "How have you not got it working yet?!"
$me: "I don't know, everything I'm trying isn't working. I've spent hours digging through this code and nothing is fucking working."
$stupid: "Well have you set it up for the new thruster?"
$me: "What...What new thruster?"
$stupid: "Oh, the one we installed this morning, did noone tell you?"
WHY WOULDN'T YOU TELL ME THIS?! COMMUNICATION 101!6 -
Wife - my site is not working, everything in the code looks correct. But it is only throwing me 404 all over
Me - "blaming the teacher for giving bad shit"
Wife after googling - I fixed it, you have forgot to enable .htaccess in the virtualhost
FFS how long have I been this stupid?12 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I was asked to present a code I wrote previously. This was not planned. I shared my screen and presented. Things went well.
One employee asked me to search a particular term which was possibly related to an advance topic in the domain we were working on.
I opened Chrome and the first page had a Quora post: "Why my dull co-workers try to act smart and are not yet fired?".
[silence]3 -
Just last month we finished a big project for a client. The company had their lawyers make a contract to transfer ownership for the website to them.
One of the requirements was to deliver all code in a word file. And just that. In the whole contract was not a word about transfering the production environment to their servers. Or supplying a working version. The files and database. No just the word file.
As of today still wondering what they where planning to do with a word file with hunderds of pages of code.
Offcourse we deliverd a working version to their servers. But why are there people making decisions about things they understand nothing at all.16 -
The recruiter in call today is a spoilt brat .
I answer him wether am I know PHP. So I show him my code in PHP (oop) I show should him how I build a restful API and connect to MySql etc.
He told me that's not PHP , PHP don't use define and class , and that's not how you connect to MySql (I'm using PDO) he confused that pdo is something from Java. He told my code is not working because it is java syntax (actually not even closed)
Then I asked him then show me the proper way , he showed me his code in PHP which is started by <PHP instead of <?php (this is fucked up)
And I told him that (after looking at his code), he yelled at me that "there's no mistake, do you really understand PHP? " And he ended the meeting
All this happen in a zoom meeting.22 -
Friend :- Dude i made some changes and the code is not working now.
Me:- Bro, Do you even GIT it?
Friend :- No i don't GET it how it happened and how to restore it.
Me :- You destroyed my pun and my faith in your development skills -_-.1 -
When the code is not working:
I have failed my parents, my job and everyone. I shouldn't have taken Software Engineering as my profession. All I'm doing is giving pain and frustration to everyone. *thinks about a clean way of suicide*
Then after a while the code works:
I am probably the best engineer to live on these planet.3 -
Do you agree to this rule given by my company ?
"Employees are not allowed to create any sort of library for any language after or during working hours, whether for personal or company projects. As they might somehow expose companies code to the open-source world."
Personally, I created quite much (not that much) of library , I created for fun, today I was told to delete ALL , so those who use my package , Im sorry :(73 -
I've a recently joined developer hired from campus sitting next to me.
She: I'm printing an array in Java but it's not working. Could you please check what's wrong?
I see this piece of code:
printArray(arr);
Me: Where is the printArray method?
She: (With a puzzled look) Oh, do I have to declare that?
Me: 😶😶😶 (lowered my head, walked away slowly praying for the company)9 -
How I feel working with code that's been worked on by at least three different teams at three different companies over the past couple of years and not a single person has left any comments or documentation.6
-
My computer science teacher is very sly: while you are working he stands right behind you for some time, so you start writing good code, functions for everything, perfect indentation... But you don't know if he is still behind you, and you're not brave enough to look back, so you write good code for the rest of the lesson.
What a good prof8 -
> make a change
> PR gets rejected
> IHATEFORALIVING! YOUR CHANGE IS NOT WORKING! EVERYTHING BREAKS!
> 3 hours long debugging session
> We find out a whole bunch of bugs
> Suddenly, everything works
> None of the bugs had ANYTHING to do with my change. In the instances where the app broke, my code wasn't even being called at all.
> My change was literally the one and only working thing
I wish life was like in The Office, when you just stop what you're doing and you drop the Jim stare at some camera2 -
So the CSS code I'm working on has a terrible vertical alignment problem on every browser except IE11. Using `display: flex` =_=
I'm not joking this alignment glitch is driving me nuts! Deadline tomorrow.15 -
Manager: How’s the progress coming along?
Dev: The section of code I’m working with is one of the more difficult ones so it’s a little slow
Manager: Ok well I didn’t write that section of the code
Dev: I’m not saying you did I’m just giving you the status update that you asked for
Manager: Ok well I can’t really do anything about that so how about you tell me something I can do something about instead of just complaining about code THAT I DIDN’T EVEN WRITE!! *Marks self as offline*
Dev: …10 -
piece of code: *not working*
me: okay, i can try this again later
me: *comments it out*
4 hours later
me: omfg why are there so many comments??? :( -
The music I hear while coding can describe my current mood:
Dubstep and other electronic music -> chilled and focused
Movie soundtracks -> everything I do today is working fine
Anime Openings/JPop -> in desperate need for motivation
Metal -> why is that son of a code not working?!
What kind of music do you listen to while coding?17 -
App nearing completion. Code tested, everything's working fine. Ready for release.
The client just calls me and tells me that they have decided to turn the app into two separate ones. Should not be a problem, you developers must have some tricks for that, according to the client. Of course, the release date remains unchanged.
Clients!, finally understand that there's no secret button for turning an app into two separate ones.5 -
Turns out the small company I'm working for is depending almost completely on the new SaaS system I'm building, to appease investors and not go belly up.
I just wanted to move to another country and code some stuff, this is too much pressure.10 -
Me, going on a vacation
"Fuck yeah, finally a break, beach, grill, nice. Im not bringing my laptop, theres no way im touching any code."
Me, 10 minutes after i got on the bus
"Oh, i figured out whys that one thing not working, let me just get my lapt...shit"6 -
Senior Engineer -
Hey. I have a code that hits API to get details and multithreading is implemented. Can you just change the URL formed to hit Api?
Me
Yeah sure why not.
Me
After some time I discover that the initial code itself wasn't working 😐
I realise i need to fix code, fix multithreading and then make the URL changes.
Just finished......Realised had to rant....1 -
I working on Twitter Cilent for android as school project, and I made code getting the logged in user own tweets, but it not returned anything, and after one hour trying I realized I never post tweet with example account....3
-
"I strive for code quality and maintainability. I actually do. And i will not work for a company that does not care about it and just wants something done as fast as possible.
The only time i will do something quick and dirty is if it's actually urgent. And even then with one condition - my next task will be to fix it properly.
I do not care about your deadlines. I will do my best to meet them, but not at the expense of code quality. I've seen too many projects fall into technical debt, where productivity is so low, that the only way to move forward is hire more people and start working on a project 2.0
And please do not lie about how great your company is, if it's not. These kind of things surface very soon, and you will have wasted both of our time, because as i said - i will not work for a company that does not care about code quality."
you think i'll ever get a job again if i put this on my CV ? :D10 -
Those developers working under non-technical bosses, i understand your pain.
1. Pain when they don't realise that output != number of hours put in. Aaaaaaand that acting busy doesn't mean someone's working.
2. Pain when chilling out in office is necessary, because mind jobs don't work same as other jobs. Wherein if you don't vent it out you're gonna screw up the code. Them not getting that.
3. Pain of "meetings".
4. Pain of changing the feature when you're done, and them acting as if its a minor change.
5. Pain of vague requirements.
6. Pain of a product not thought through, and them trying to blame the implementation.rant developers life office pain office politics office life developerslife non tech people programmer life non techie5 -
Wordpress :(
Here is another piece of garbage from a previous Wordpress "developer".
This is NOT the generated HTML, it's the actual source code within a custom category template.
The client has said their archives stopped working this year.
*** MASSIVE FACE PALM ***14 -
Yes! you made a difference.[image]
P.S.
started working at a startup as an intern(android app developer), Most of my work is like debugging the code, new feature implementations.
And the codebase is full of this kind of shit(even worse) plus literally zero documentation(not even for API's), not even a single line of comment in complete project(40K-50K), not any unit test/ UI test.
The funniest thing is when I ask for documentation he(boss | *) said: I am documentation.8 -
Spent 2 years slaving for a “start up” building not only the core framework but also handling clients, operations and logistics while being yelled at constantly for not delivering even though I was clearly over worked.
Once it finally hit my head that none of this was my mistake, quit, took a few months off and started working as a freelancer for no code development platforms.
Have been working with multiple amazing clients for more than a year now who understand and appreciate the work I do.2 -
In india
Teachers teach students to code, without any field experience
These students learns things tht they dont need in their life and becomes teachers
The cycle continues...
From my genius analysis, we can see that these students need not go to a company to work like a horse,
Why are we in a company working like a horse?13 -
For my school project that was due awhile back my group ran into the problem of a certain feature not working on a site we made. I had a test version of the site and it was working perfectly. Both the test version and the project site had the exact same code. We couldn't figure out why it wasn't working and so we just turned it in and took the point hit.
Today I was thinking about it because I was still annoyed/upset that the site feature didn't work. I started talking it through with a friend and in the middle of it stopped-I figured out why it didn't work. My teammate didn't actually update the database, he just downloaded the code to the database and was using an outdated version of it. I suddenly stood up and screamed, "F***!" At the top of my lungs.
I startled my friend so bad that she spilt beer all over herself.1 -
Fixing someone else's code who left the job.
Production suddenly not working, cannot debug locally, cannot deploy to a test environment because it does not exists anymore.
There should be a contract clause that developer need to support his project for 2 years after he leaves his job.9 -
Dev: My VM is not working. Something is wrong with VM.
Me: Have you made any changes to the code?
Dev: It shouldn't matter my VM is not working.
[I go and check the Dev's VM.]
Me: ಠ_ಠ The build output literally states your unit tests failed -
So a company I'm working at has this internal product. I just got employed and was put into that team.
"First task: refactor some of the code"
Alright, I start refactoring. Oh I may need to write a small class for this one. And then rewrite this a bit. And then rewrite that a bit. And then rewrite everything.
"Why are you rewriting most of my code?"
oh i would not have needed to do so if your code was not COMING OUT OF YOUR ASS and if all the teams had FREAKING PROPER API DOCUMENTATION9 -
*working on a programming assignment for a graduate-level course*
"We will provide you code that implements the protocol in the server. You do not need to touch this code."
*provided file has syntax errors, including a block comment which doesn't close before EOF*1 -
FRIENDLY REMINDER: Fucking save your goddamn work. Thanks.
- Your friendly neighborhood dumbass who just lost 14 hours of his life because his computer crashed.
P.S. Normally not a problem when working on code because I'm forced to save and commit with Git. Unfortunately I was balls deep in Adobe motherfucking illustrator working on wireframes, and didn't have doc recovery turned on.6 -
A senior engineer with about 8 experience in my team and company for almost a year now. Believe it or not, still hasn't setup local dev environment.
Every time we ask this person to set it up / refer to guide in Confluence / or just use the docker image the person says ok.
Starts sending code for pull request. The code would not even compile in most cases just from a quick scan. When questioned how was this tested, answer would be more or less 'oh my local setup not working, could you test it out for me.'
Doesn't know how to write tests. Fairly recently instead of storing string values in a list, (I swear am not kidding) decided to come up with 20 string variables.
8 years plus experience! I think this is retarded even for a fresh grad.8 -
Guess what's even worse than reading the code of someone else?
Reading your own code after not working on it for a couple of days.2 -
WTF is with the entire Angular2 eco system and "half instructions". Started learning it and every inch is a struggle, out dated docs and code samples and then this style of shit:
Google: "Angular2 and bootstrap"
Result: "Install ng-bootstrap to get native bootstrap components written in Angular by the Angular UI team"
Me: Install != work
Google: "ng-bootstrap not working"
Result: "You also need to install bootstrap css, heres how"
Me: Install, plus try component
Error: "Bootstrap requires jQuery"
Google: "Installing jQuery in Angular 2"
Result: <Instructions>
Me: Install, still not working
Google "Angular2 ng-bootstrap bootstrap jQuery"
Result: "Don't forget to also include Tether"
WHY DID THE FUCKING "ANGULAR-UI" TEAM NOT MENTION ANY OF THIS6 -
It's about a guy that knows better.
I was working as a subcontractor on a bigger system. We (subs) were not allowed to deploy code, we had to wait for contractor to deploy.
One day I got an email that my code is bugged and that my feature is not working on production. I checked it on test env, everything was fine. Then I checked if the code I wrote was deployed. It was not.
I send an email explaining that if they deployed my code it would be working. Then I got a response. There was a bug in my code.
Another email. I asked how would they know? Do they have a test on their environment that failed?
No. There is one guy that READ my code and he said it should not work, so he will not deploy it. He was not a programmer, he was a business consultant responsible for the documentation.
His issue was that I used a function that was not in a class. So if the function is not declared it's obvious it will not work. I had to explain to him in another email, that you can use object of another class inside your class and then call a function, that is not in your class. It was the last time this guy blocked my deploy.
TL;DR, I had to explain a non-dev how object composition works in order to have my code deployed. Took four emails.4 -
While I was working with my Android project that is written on Kotlin. One of my on non-tech colleague came and saw my screen and
said "Why are you overriding fun"
I replied him that we just not override fun we also have private fun and public fun.
Is it not funny translating code to real English 😂😂😂2 -
The time when we were not aware with advance features of IDE and version control.
(3-4 days before the project demo)
Me: This code was working fine last time. Now it is not compiling. Has anyone did some changes?
Team member: I corrected some spellings. So that our teachers don't correct us at the time of demo.
Me: (shocked, expression less ) We demo the application not the code. And you have not corrected on all the places.
Team member: You should do the rest.
(Based on true story) -
Self rant!
Looked at a code snippet I wrote last year and I thought to myself: am I geting stupid for not understanding my own code ?
Tried to re build it from scratch...
Failed and had to reuse it without understanding how it's working.
I guess I am getting stupid!5 -
So this one time me and my teammates had just started working on react (please note that we all were backend developers and no one has the basic understanding of javascript) and things were looking quite exciting..
But towards the end of the deadline we were sitting and refactoring each others code since we had not decided on the coding standards and practises and random code had been written left right and center.. It once happened that the same piece of code was refactored multiple times by only 2 people..
And it is obvious that we couldnt make it to the deadline and that code is sitting there like a mixture of weird things.. -
I guess I'm not the only one who sometimes code in my dreams while sleeping. Maybe it's because working as a programmer is like a dream come true.4
-
We do infra as a code, and one of my coworker worked on the project alone. Few months down the road, when shit hits the fan, he just message me this is not working.
First of all, I did not write that shit, and also I was never part of the conversation during the decision making. So when shit hits the fan what do you expect me to do? Do some black magic and fix it magically???1 -
So I just wanted to log back into windows. Typed in the password. Wrong password...
Then I tried being super accurate while typing and also checked keyboard layout, etc. Still, wrong password.
Then I noticed that the letter p is not working. Shit, keyboard seems to be broken.
On screen keyboard -> p is not working...
What the hell? What kind of error is this?
NT Kernel code has to be something like this:
if(timeSinceLastError > someValue)
keyboard.p.enable = false;
I guess you could also replace the keyboard error with some random error.
If you encounter this, restart Windows.3 -
When you're training a new guy who thinks hes better than you and completely overwrites all the code you've been working on because he thinks UX designed it wrong and it should look "correct". Thats not how corporate business works buddy...2
-
My manager thinks I am Superman! and he is so confident that can do any shit he wants me to do.
Yesterday he asked me to merge an ancient code hotfix (literally ancient) with latest branch of changes.
1. Hotfix is really old, most of the things are hardcoded, very specific to a stone age client.
2. Code documentation does not exist.
3. Developers of that code are probably dead.
4. Many Libraries which code uses are deprecated.
5. It's a legacy code, so no one has fucking idea what a particular clumsy block of code do, or what will happen if you remove it.
'if it runs don't touch it' policy by management.
Despite all this shit I successfully merged the the hotfix, refactored outdated code so as to run the application.
Showed this to my manager in full swag!
He was surprised at first, and asked me to show the code changes.
'Code review' was done by comparing files 😅
Manager: Dude, you have changed these lines, why? Explain.😧
Me: those lines won't work with new build, with new libs.☺️
Manager: then why can't you do old build with new changes?🙄
Me: umm.. wait... what???🤔
Manager: the code was working previously, it must be working even today without these changes.😡
Me: it was not working hence I made changes and now it's working fine see! ☺️
Manager: you have removed this, this and this!!! 😡
Me: but I also added that, that and that!😔
Manager: "don't touch it' if it works!"😡
Me: ... Idk what to say!
(In the back of my mind: "Don't touch it even it doesn't works!")😌6 -
Often I look at my seemingly perfect code 30cm away from screen, mumble "WTF", while asking me why it is not working.
My boss might think I'm retarded... -
Shit Project Managers say.. to my coworker when I'm not there :
"Hey do you think she's working hard enough ?..I don't know, she has only made 2 commits in the past week so.. "
Fortunately my coworker defended me and told me after but yeah.. As if you could measure efforts and work in development by counting lines of code, fuck-tard.5 -
When you work hard for something and you are sure that you gonna get it, but some ass licking guy who doesn't even know how to code gets it. Yes, it happened to me. I was working for an open source organization called PROBOT. I was working my ass off to get into GSoC with that organization. I created PR(pull request) after PR and solved most of their issues. But later on, I came to know they didn't even saw my single PR. Life surely teaches you some hard lessons but it's you who should not give up I would say. I do not regret working my ass off and writing those code and not getting into GSoC but I cherish those moments where I learnt many new things. And as for that organization, I would say they don't even know how to manage. This was my exact reaction when the result came3
-
Don't you just love it when the lead developer/project manager comes in and totally revamps your code even though it does the same exact thing as it was written before? And then when it's not working he blames you because it's in GIT as your commit...2
-
10 PM (after a very busy working day), CTO calls me and tells me: "We decided to hand in the new version to [random client] one week earlier, so they can test it."
Me: "I don't think is a good idea, the app is still unstable, we started working in it yesterday, it *will* crash"
CTO: "Don't you worry, at least they know we are working on it"
20 minutes later
CTO: "WTF why did you make my app crash?! I can't send this to a client!"
Told you. That is why that code is on develop and not on master. -
Writing a super extensive project in php. Twice so far, I have had weird problems of codes not working.
But everytime I copy/paste the SAME code from another file, IT MIRACULOUSLY WORKS!!!!
WHAT THE ACTUAL FUCK!!!12 -
Monday morning: The last straw.
After talking about in a previous rant about how my client wants to fix bugs that keeps popping out after bug fix.
Today I discovered, that all C-levels, worked all Saturday to "fix my code" because it "didn't work" and we "needed bug fixes not pretty things".
The app version I was working on for the last week is gone. Without mentioning that their "CTO" wrote a fucking crappy code to disable features that I added, breaking the build step.
This shit is enough for me, I'm done!3 -
Damn stupid me...
One of our customers told us, mails are not working with SMTP. They send us a working code example, which looked very similar to our implementation... I was not able to find out what was wrong for hours.
A colleague checked the code later. After 5 minutes: you forgot a ! before checkin the string if it is null or empty...
Shame on me ..3 -
started converting VB code to JS.
* lets refactor it when we are on it *
After 3 hours, with refactored code not working, uses the old logic.3 -
A Bad and Sad Day
Hello Monday,
Client : on weekend site went down for 7 hours? Why ?
Me : Let me check the logs
Client : bla bla bla
boss : check ur code bla bla bla
Reason : Some PHP service stopped on server
Client2 : I have purchased this software and you have to made minor changes
Me : Payment Integrations are not working?
Client : Whataa nonsense is this.. you are supposed to do this
Me : We are supposed to do minor changes. They do not have proper payment integrations. If you want we have to write complete code
Client : bla bla.. I gave you working software
:( Why don't you just fuck off .. liars2 -
I started a project at high school 7 years ago, I had no idea what's clean code or design pattern, just learn while keep coding. I eventually stopped because my code is so terrible I cannot understand it anymore.
Now, after 1 year of working, I look back those dirty codes and think it is actually not that bad. Within hours I even fixed a bug with concurrency.
I start to think, instead of learning to how to write good code, maybe I should learn how to read bad code. That's just much more practical.5 -
it is really frustrating not to be able to actually maintain and improve the code you're working with. i'd be happy to completely dig in and live in the code and get it all - not so much fucked up - , or, totally spitballing here, do some research on how we could improve the functionality and performance in general (which is not "nice to have", but rather ongoing customer pain points), but I'm not allowed to, because management hates having maintainable code or even an adequate number of devs. it rather has me doing hippity hoppity between different projects to make sure nothing gets my full attention. -.-
the only thing i can do is to clean it up a bit during bug fixes, but even heavy polishing won't fix this giant pile of garbage that is called our code base.1 -
Both apps I'm working on have legacy code:
iOS app has 100's and 1000's of lines of code with no documentation, no proper naming conventions and cut and pasted code off the net.
Android app has skeleton code from a Spanish taxi app + remnants of a funeral webcasting app, there's also the same no documentation, bad naming conventions and cut and paste code off the net.
The server is also as bad, it had methods that we're never used, I for one don't fully understand the server but from what I can see it's a mess.
I had a hard time understanding both apps and gladly majority of the modifications I made we're not including existing stuff, so I guess I just basically pilled my code onto of the already existing software.
I would have gladly started from scratch given the chance.8 -
Quick rant!!
Deadline in 2 days, working with a team.
Me: yo ! , How's the xyz feature? Is it working now?
Teammate: yah, made it work yesterday.
Me: epic! Can you present it to me?
Teammate: wtf, it's not working today!!
Me: no worries, you can sort it out!
Teammate: the latest release you worked on doesn't work properly.
Me: yah, merged code fucked up, I'm fixing that, I'll push a fix today.
And the cycle continues... -
Knockout JS.
I am not sure if the library itself is so bad or the code which I was working on was ugly. But since then I avoid anything that is related to knockout js.10 -
Boss only likes stuff he can see and that looks pretty. Doesn't understand code, servers, containers, DBs, etc. Praise is attributed by something looking nice in the frontend, whether or not it does crazy stuff behind the scenes.
Spent a week working on a project whilst boss was away. Got to about Thursday and thought, oh poop, I've built all this API stuff, but not much frontend. So I panic built frontend screens with no functionality just so I had something to show.
Wish I had another dev to share backend progress with (and code review)...8 -
Doing a python code review after working in Scala is all:
"Why the loop? Can you just put a function here and... oh yeah, right... python does not allow it. I could have written these 20 lines in 4 if was Scala"
Scala, stop spoiling me!!4 -
FUCK FIREBASE, FUCK CLOUD MESSAGING, FUCK GOOGLE, FUCK APPLE, FUCK PUSH NOTIFICATIONS, FUCK PROGRAMMING AND FUCK MY LIFE. JUST TELL ME MOTHERFUCKERS WHY NOTIFICATIONS IS NOT WORKING ANYMORE, I SWEAR I DIDN'T CHANGE A SINGLE LINE OF THE FUCKING CODE. AND IT'S BEEN ONLY ONE WEEK SINCE THE LAST TIME I TESTED IT.5
-
Context:
Me, Front-end Developer, Javascript stuff
---
Junior Dev: Hey xxzer0, could you help me with this? I spent the entire day on it and at this point, I think I just broke Chrome.
xxzer0: *---* Okay, let me see.
Junior Dev: Do you see it? I am updating the Javascript code but it's not working at all. The browser is not even loading it... Literally, the code I just wrote is not there.
**
Now be me, be the fucking idiot I was and I have been my whole life, I already knew what was going on because I lost a fucking day on it as this guy.
**
xxzer0: Well, let me see just one thing...
'Open Chrome Dev Tools' -> 'Network' -> 'Disable Cache'.
xxzer0: Now try again...
Junior Dev: What are you..doi........ IT'S WORKING! O.O
Chrome, I love you but sometimes I wish you could make this more "accessible" to newcomers.5 -
First Rant here.
So I was working on some integration test issues when I found this by accident made by a professional level SW engineer:
@Test
public void testMethod() throws ApiException {
Response res = null;
try {
res = serviceToTest.callMethod();
} catch(Exception e) {
assertNull(res);
}
}
Was wondering why tests were being green after some code changes I've made cuz tests could have not been green afterwards.
Together with a senior (I'm also professional only) I've tried to explain him for a good 1-2hrs why this code is useless and he still did it. Good thing there are no errors in the real implementation from him after fixing the tests as it's code freeze here and we are having go live in a few days 🙃
Also luckily he isn't working on our code anymore and has only been doing so for a few weeks.
Wasted a day with it and gonna check all of his code now before I run in the next surprise.1 -
Our (new job) dress code policy is "that's what the CEO wears, so you have to wear a shirt too", but not enforced while working remotely.
So, I'll never be in the office.8 -
There was an android project that I got from my senior.
he told me that another developer already completed most the project and all I have to do is minor changes...
Well when i saw, i was amazed that the code he commented is more than the actual working code without any structure.
He copied most of code from internet.
If it's not working, put in comment else use it.
It took me a whole month to figure out what's going on.
And another 2 months to fix the issues.
Well in last my senior told me that the developer took 1 year to write this code
(to be honest any normal developer can complete that project in less than 3 month)2 -
Lels
Before I was unceremoniously laid off by a shit company in which they tried to blame shit on me I was working on a opencv implementation of a proprietary document scanner.
I finished the Android prototype and was working on the ios implementation. It was left unfinished in the ios version because I was building it in swift and obj c to compare code bases.
They launched a shit unfinished Android app of their product without the scanner (they could not add the scanner lels) and have not been able to do shit on the ios version.
I did not give them the Android prototype. There was no binding contract that specified that what I developed was theirs. There is no record of anything.
The scanner? Is still in my phone and I still have the built project in my mac.
Unless them cheap assholes decide to pay another engineer for the opencv implementation, their vbscript php non theory knowing shit lead will have to figure out the required mat obj c swift java cpp code needed to build it.
Top kek -
I have been trying to understand why my student's code isn't working just to find this piece of code. Checking out code early in the morning is definitely not my thing.3
-
Pro Tip: If you spent all day debugging and shit's still not working, go get yourself an oversized, fully functional enter-key-pillow. Your code will probably still not work, but now you can at least spare your keyboard and smash that enter-key with all your built up rage1
-
A rant about people in general:
I am sick of people not caring, not giving a fuck, not valuing others.
Studying CS this is something I noticed the past year: people tend to not acknowledge that there are other human beings around them.
Some are just focused on getting their degree done and dusted as fast as possible, which is fine.
Some are working to pay the rent or student loans, which is fine.
Others just do their thing, code their stuff, criticize other's code... which is also fine.
But nobody's realizing they're interacting with other people! Other living, feeling human beings. For them it's just about getting it done.
And not just at university.
I've started seeing it everywhere.
At the job I'm working, people in the shops and on the streets.
I don't get it. We are all human on this rocky sphere in space. Why do so many not care for each other?
It makes me sad.3 -
So I’m working on a project right and I don’t run it after writing 104 lines of untested code and it doesn’t work.
Which is expected but then I do some stuff and fix that, I get a new error which is great cause I’m getting closer.
Cut to tonight. I’m trying to hunt and kill this bug. And after doing nothing but copying the code to another text file so I can upload that copy and get help.
I decide to run it with a little just print statement in it to make sure it’s definitely broken and I’m not asking online for no reason.
And.. it works.. WHAT???
I uncomment the rest of the function and get rid of the print statement and scream because ITS WORKING!!
I MEAN IT HAS BUGS BUT THEYRE BUGS I CAN FIX AND FOCUS ON AFTER I FREAK OUT ABOUT IT WORKING AFTER ME CHANGING FUCKING NOTHING.8 -
When i sit down and code, its like a conversation with women.
Im not sure whats going on, but it appears to be working.6 -
My biggest distraction at coding are my parents.
I still live in there house and it's really comfy.
But whenever I code the always come into my room with something random like "my phone is not working" or "how can I delete this?"
I love my parents and Im glad that I can help but always get off where I was after 😂7 -
Reviewing code for applications after not working on it for six months.
Client: so what is the first step to adding our new feature.
Me: I really think we need to redo the entire architecture from the ground up. It won't work any differently than it does now, but the code will be cleaner.
Client:😓
Me:😅3 -
My coworker is... something else. He's "coded in Java for six years", bear in mind and this is a bit of .py code he's written. First a doNothing() function (probably didn't hear about pass) and then there's about 400 lines of creating values. No iteration whatsoever. I have no idea how he's got the job. Not to mention that whenever he talks about anything technical it's like listening to Gertrude from Accounting talking about 'mouse not working'.11
-
!rant
Goodbye Java I will not miss you at all! I swear ...
I do like it when making web services (especially that I can use Java8) but for Android you have been a torture. Hello sweet Kotlin! I shall embrace you and treat you like my newly born baby!!
Story is:
Working on a new project where I need to talk to a web service (also made by me).
Started writing in Java, all is cool and unit tests pass.
Downloaded Android Studio 3 Beta 1 and converted my Java code to Kotlin, That AsyncTask did not look nice in kotlin, converted it to async & await feature and I must admit lots of code removed, no more need to create a new fucking AsyncTask every time the app sneezes for data!
I feel like I'm working with C# but with difference in syntax.
My life is now complete :)undefined java goodbye! am i drunk? koline: sorry i have a boyfriend hi there kotlin i shall not miss you what the fuck did i just use for a tag?8 -
-Writes a function that I'm going to schedule for django.
-works in development.
-adds it to production cron using django-crontab
-not working.
-spends 3 hours editing code, searching for similar problems and reading documentations but find nothing wrong and it's still not working.
-maybe it's django-crontab so I decide to just write a custom management command and call it through cron.
-still not working.
-calls function using what I'm telling cron to do.
-everything works.
-?????????
-adds logs to cron command (sorry for not making it earlier)
-mfw the code is not working because I imported 'patterns' in urls.py which has been deprecated since django 1.8 -
Forgot to change code in my api for rate limiting, after development. No unit tests.. because who really needs that right? 🤦♂️🙅♂️🤷♂️lolololol
Long story short, API went to production eventually, and stopped working almost immediately. Rate limiting was set for 2000 requests in a 1 hour time period. Not my finest moment.. fml 🤦♂️ -
Write a piece of code that works just fine and it's fairly extensible in 20 minutes.
Then proceed to spend the rest of your night rethinking and replacing said piece of code numerous times, with slightly more elegant code.
7 hours later and I'm still not done. Although a fine way to improve your skills, I seriously need to stop doing that for every single thing I write and start managing my time better. Got lots of other stuff I need to be working on...
Surely I can't be the only one doing this4 -
Spent 5 hours working on a solution for a hash difficulty comparison/scaling algorithm. after a bunch of different iterations and approaches, I find that my problem can be solved by the attached equation. Its such a simple answer but no way in hell would you be able to discern the amount of time and brainpower that was put into it. The git commit is literally 10 lines of code total, but I guess its not about the amount of code, but the time spent thinking about it thay counts?6
-
We receive an email from Splunk when errors go above a certain threshold, and a particular service has been especially problematic this week (throwing hundreds of exceptions). Email response from the team mgr responsible for the service.
"We are working to address these errors. We don’t currently have a way to prevent a user who’s account is locked from logging into the service and performing work."
The exception? NullReferenceException: Object reference not set to an instance of an object.
The code? (paraphrasing)
var user = GetUser(request.Login);
if (user.CanPerformWork) ...
<facepalm>
I'm doing my best not to reply .."Really? No way? You do realize we can read code, right?"4 -
Let's try this.
In the project I'm working there is an strict rule : NO COMMENTS!!!
I mean wth, the times I've spend hours trying to understand the crappy legacy code in VB.Net that has been there almost decades, that wouldn't happen with comments, I know i know there are some supernatural developers that think in binary and their eyes work as compilers, but I'm not like that, so seriously go to hell.
P.S. Of course I follow that rule, after all, my code is so damn perfect that even a baby can understand it.
jkundefined devops etiquette stupidest pichardo for president stupid stupider stupid stuff jk rant code smells comments3 -
Thought I would only do frontend-stuff when I started working. Boy I was wrong. I thought it would be easy coding in a real company and not just in schoolprojects, boy I was way out in the blue. But when your code works and is actually used by people, I never could've imagined that would feel so good!4
-
I've got a confession to make. I.. I just love hand-obfuscating JS-Code. Not because, i would prefer working with obfuscated code.. I just find it extremely satisfying watching the code shrink and being the only one being able to understand it..
It's out. I feel better now.4 -
Two states of a developer every day:
• Fuck this job. I hate everyone and everything. My code sucks. It's not working. Why did I choose this career?! I am so miserable.
• It works! I'm a programmer god. Oh my goodness I'm smarter than everybody.4 -
Why won't you just approve my PR???
Whats wrong with you?!
I don't understand your cryptic one-sentence feedback. I'm not even sure you understand what you're asking yourself.
What the hell does "make it a transaction" mean? Don't give me pseudo-code examples that don't even work fucking asshole!
Its a small change that does NOT need a canary build dammit. Don't go testing the ORM, its a goddamn standard library. Why does working with you make everything so complicated?!?!
The code fucking works! There is no need to make it comply to your specific tastes goddamn it. Working with you is like pulling teeth!
/endrant9 -
Made a change.
Patched some files.
Ran the app.
App not working as intended.
Freak out.
Check code.
Think of random solution.
Waste an hour.
Realise that files weren't patched properly.
Kick myself in the head. -
When you hack up some spaghetti code which works right off the bat and you don't even know why but you take it for granted anyways. Week later someone tells you that it's not working anymore and you have to find out why.3
-
IHateForALiving: I created a trigger on the model, every time you perform a save it should fire an event. You're calling the same methods I am, and the trigger is NOT firing. Are you sure we are running in the same process?
TheTeamLeader: I'm manually starting this whole piece of code in your same process, there must be something wrong on your side if it's not working
90 minutes of debugging later
TheTeamLeader: there's the thing! Your hooks are registered in a separate process, of course they are not firing
IHateForALiving:rant and that explains everything i'm seeing as target practice for knife throwing your mother used your forehead1 -
fuck this!
spent an hour trying get my website working (on a raspberry) ... no errors, dev tools gave nothing, php gives nothing mySQL related... weird.. debugged my code for an hour when it me... db on my pc for testing is not the same one as the "production" server. i am so fucking stupid... i need some sleep3 -
The scrum master for the project I'm working on decided to help out with changing some code (I'll add he's got a master's in software engineering and very proud about it..aka..big ego). It took him two days...yes two days to write the attached code.
I reviewed his code and sent back a response (code took about 15 seconds to write) including the link to the logging documentation explaining what fields were and were not necessary. Not sure how will look in devrant ...
var data = new InformationalDataPoint
{
Properties =
{
["RMANumber"] = rma,
["InvoiceID"] = invoiceId
}
};
Logger.Log(data);
He's stopped talking to me. Our next scrum meeting with the product owner should be ...um...awkward. -
After 1 year of working as android dev and coding in java, finally switched to another startup where everything is in Kotlin where I will be the only one maintaining that project.
Me: This code has almost no comments
Senior dev: Code is pretty self explanatory
FML
At least she spent 4 days with me and walked me through the code, so I'm not totally lost which is great!2 -
After being an active developer in the industry for about 5 years, I still have some bad dev habits on which I'm working on:
- Starting off with the code first without a proper design in mind/paper. (Trust me, I'll always regret of not having a proper design later)
- Writing long method bodies and not refactoring them later. (Because sometimes I turn out to be a lazy ass)
- Duplicating code in some places without reusing some.1 -
Going through legacy or other developers code which don't have documentation or even comments. Plus the author of the code is not working in same organisation anymore to consult. We have to understand the code like deciphering any ancient language. 😥2
-
Scenario A:
Your code is working. You run again, now it's not working.
Scenario B:
Works on production. Next day it doesn't.
It is nothing you just experienced alternate universe. You probably with your manager temporarily jumped into another timeline where your code is not working.
Next time it happens tell your manager it's not your fault.
Eureka!6 -
My baby sister told me she wanted to learn how to code, her reason being; she visited a startup incubation center at her school, my alma mater, and she thought they looked so cool and collected.
Hahaha! I told her to try visit when they are having a deployment or when someone's code is just not working.1 -
Story about my old boss:
I was doing a lot of work in an area that had a data property and a method to build an object. I noticed a reset method that iterated all that objects properties, found the matching data from the data object, passed that data through some logic to format it and then assigned that value to the object property.
As part of my PR I removed that method, since data wasn't changing, and simply called the create method again with data.
The result of tidying the code base and putting it up for review before a merge? I get told I have no respect for my boss's code, that I am undermining him, that I need to be more considerate and respectful of other people's work and that I am no longer allowed to change any code he has written in the code base (half the code base) without talking to him about it first, before it goes up for review. Also if he is working on an area I cannot change anything - not even 1 character (he is working on the core of the app).
Every day there I was so confused :D5 -
Note to self, don't fix a minor bug that will not effect the demo right before the live demo. My program that was working great didn't work anymore during the demo because of my quick bug fix I figured I had a few minutes to add to my code.1
-
Went to bed last night with my code not working. Woke up, ran the app and IT WORKED! I have no clue what I did last night it's all a blur, but apparently I fixed the problem in my sleep. #SleepCoder2
-
One thing I learned early on was...
"If the bug is not where you are looking...look somewhere else."
I just spent 2 hours looking at 50 lines of code pulling my hair out why it wasn't working. Guess what...those lines were correct. The bug was somewhere else.4 -
Product Owner: There is a major bug with your code it's not working.
I then spend hour looking at code to find out.
It's a content problem! -
Not only dev related but remember to constantly backup your important info of your Hard disk constantly... specially if those disk have not only the lastest code you are have been working on but photos of you and high school friends back in the day when the original Iphone was just released that you havent properly printed yet.
I think that is one of the nearest thing I can think of that I regret lately aside from simple being "my life" in itself1 -
<html><body>shit everywhere<meta>more shit</meta></meta><\meta>countles garbage code lines</body><head>[copy&pasted html code that actually works <img ... />]Tons of shitload</body></body></html>
Me: what are you reading?
PM: some email code that doesn't render well in the browser...
Me: let me see... OMFG!!!! who was the author of this garbage?
PM: Oh! it is not that bad! It was working well 'till today...
Me: But... but... this is really bad! you can't send this to customers!
PM: I think that the problem is the "/" at the img's end...
True story. -
!rant
My mother got me a programmagle calculator this year for christmas, a Casio fx9750gII. Needless to say I'm already hooked. Casio BASIC might not be the best language I've ever used, and working with string is pretty much impossible but I'm actually having real fun. Hopefully I'll finish my snake code by this week (will update with pics :P).4 -
Working in a organization that hire people that don't know what they doing and can't ask a question correctly...
HELP WE'RE GETTING AN ERROR IN OUR CODE WHILE TRYING TO GET DATA FROM YOUR DB... PLZ FIX IT
WTF IS NOT WORKING, WHAT ARE YOU QUERYING, WHAT IS THE ERROR?
**Sends a SQL query but with ? for all the parameters**
WTF..... U PPL ARE IDIOTS.... CAN'T EVEN ASK A QUESTION CORRECTLY OR PROVIDE NECESSARY INFORMATION... CLEARLY YOU HAVE NO IDEA WTF UR DOING..
EVEN GOD CAN'T HELP YOU... -
GIT LOG VERSION 110
---------------
a9c2934 I don't believe it
fb8d2e6 I am Root. We are Root.
6be9078 FINALLY FIXED THE FUCKING BUG IN THE CODE, DO NOT EVER EVER FUCK ME AGAIN YOU MARON
3d08a88 THIS IS THE FUCKING WORKING VERSION
013faed THIS IS NOT WHAT YOU ARE LOOKING FOR, GO TO A PREVIOUS COMMIT
af5d013 We'll figure it out on Monday
49e238b de-misunderestimating
a40351b happy monday _ bleh _
a5f345d Fixed unnecessary bug.
485a26a pay no attention to the man behind the curtain
c4fcbde s/import/include/ -
Trump: I pay taxes as little as possible!
Me: I write code as little as possible!
I have written less than 2000 lines of code in production in 5 years(about 2 line per working day)but with my luck, I earn more than average wherever I live. God, I live this profession AND my luck.
Note: I write fewer sloc not because I am lazy but because of my industry.7 -
How to NOT handle dates!
Do not put the date to "mdy" format, today would be 050217.
Working on an intranet for some multi-billion corporation, and was wondering why events from last year were showing.
Last year's events were 28th of October, 2016, and was showing as upcoming events :)
Checked the code, and saw this. Quick fix, turned dates to UNIX timestamp, and it worked.undefined maybe put it on the bill for the client my back hurts today will this get many ++ i definitely have to buy one love this not laughing at all dateformat date right now i don't know what to write how long can the tags be how many tags can i put?2 -
Question: is it a red flag if I'm "not supposed to" blog about tips and tricks I've found at work (not even code level, just organization and general design patterns)? Reason given to me: "we need to be careful about due diligence and intellectual property for our investors to be satisfied". Am I working with idiots?7
-
Remember about this project of mine? Maybe not because I deleted the rant, but after a long pause I re-started working on it. In -just- 1 hour I wrote this code that picks a random number, goes from 0 to 5 and, if found, it prints the match.
This is my most (useless && senseless) project by far.4 -
Not being able to write code only using pen and paper :/
I had one job interview where they ask me to iterate a tree using my preferred language. I felt so uncomfortable.
And my problem is only the pen and paper.
I'm able to write working code without any code completion even without highlighting in any shitty editor. But when it comes to write code by hand on paper it feels like my programmer brain side turns off.1 -
Writing my code, go to run it and boom its not working. I pull up stack over flow to get some insight. At this point i was working on my code for countless hours and became a bit annoyed so i decided to copy what someone wrote on stack over flow delete my code where i thought it was flawed. I run it and Blam bugged the hell outa my code. So i undo go back to my original. Turn to a friend and ask what do you thinks going wrong. He resets my browser and there it goes it works. I just kind of gave him a blank stare and thought to myself Im a dumbass!1
-
code not working?
comment code and try to run
uncomment piece by piece
code back to original
running...
apparently, the code didn't know it was right3 -
So today I started working on a code base someone else wrote and stubled across this and thought it was worth sharing.
Why somebody would be doing something like this is beyond my understanding.
Not commenting on the empty catch block keep in mind the whole snippet has nothing to do with rest of the code...
WHY!!!!!?!?!?!?!13 -
Got back at work after 2 weeks off
Useless to say I did not remember what to do or where to start…
Today I was working on a feature and while thinking about code organization I found an empty function ready to be filled with the exact name I was about to type.
My 2 weeks ago self prepared it for me… it was so kind of him -
I'm in my first internship, they gave me their only company owned product. They always made interns work on that, and it's something I really appreciate (I like when people give to others any possible chance of learning)... But apparently they made a mistake: for the first year they never reviewed interns' code. And now that software is huge and full of bugs.
After two weeks working on that I said to the tech leader and to the PM that we should spent a couple of months rewriting more than half of the code, and surprisingly they listened and agreed (the TL already knew that, and the PM is not a dev and he listened to the TL).
After two days of code rewriting ("refactor" is a too weak word) the boss calls me and orders to stop, telling me basically "I agree on this decision, but not now; let's first make it work and then we make it great!".
Okay I respect that, but what he didn't understand is that the two things are strictly related!
Result: last week we had a first official release (with some client's testers, so they were expecting a few bugs) and nothing was working, so me and the tl started a really hard rewriting work (that didn't finish) and managed to release a very bade made software that works by chance.
After easter we'll keep working on this, and I think at the end it will be great.
First working experience, in two months I learned a lot (not only about code/tech).3 -
Just opened a project that I'll be working on for work, first thing I notice is C++ like code formatting, which hurts my eyes (keep in mind this is Java)
But then decompiled Hybris classes came at me with not only that, but three newlines between methods.
I fear what I have yet to see...4 -
*using random JS for website*
*finds stuff not working*
*opens JS file*
(mesh of code)
*select all*
*Format Selection*
I love you, Visual Studio :')4 -
Just got upset with a coworker due to not understanding the code written, logic, lack of documentation, comments. Nothing!
Other coworker: But Dave, you added that feature last December. Remember?
Me: So what are we working on today? -
Got rejected from a really nice opportunity today. Irrelevant experience as it seems to the company.
As it turns out I'm an unlucky beginner in the industry who's stuck with a wrong, legacy code project. Doesn't mean I don't know anything and I can't learn new stuff. They were not judging capabilities, just judging people by the project they're working on in their current firm.1 -
When it’s 3am and you are working on an exception for more than 2 hours and have optimized your whole code just to be sure and remember you are writing swift not java: some ints have low max value like UInt8.3
-
I've been working for 6 months now, and the boss tells me he's not satisfied with my work compared to someone that has 15+ years experience. He clearly states that for him - it's more important lines of code, than planning and defining the architecture which he don't like because that doesn't provide anything...
Of course, I can just jump into the code if that is whats important. I've seen the code produced by the other guy, and its shit.
The guy is a talker, and knows how to talk. I'm more like, hey lets create a simple design prototype or do some UML diagrams to get a better visualization of what we need.
Anyway, its just annoying to be compared to someone with many years of experience, its not that I can achieve it overnight...11 -
One good thing about working at a shitty place is you end up knowing what not to do by just pure pain.
I once consulted for a company who had the latest tech - kubernetes, bit bucket, you name it. But it didn't matter. The code was shit. It's not about the tech, it's always about the people that use the tech.5 -
Trying to understand other people's code like:
- 6 README, in total 7 lines (that's all there is for documentation)
- 40% of code is commentary like (original code, not altered...)
// if(a = b)
// c = d; // this is not working -
Hmm. Seniors have the half working experience as I do and I am the only not senior one in Dev team.
I adapt code only to "taste" good for code reviewers, but they allow themselves to commit without caring and just saying :"oh unit testing is boring"
Enough with the kindergarten. Time to prepare myself for the next job.1 -
THE TYPESCRIPT DEFINITIONS SAGA CONTINUES
> IHateForALiving: so, I don't really know which field we're supposed to use here, but that's your entity I'm working on, so...
> TeamLeader2: wait, what is this? Why does your code have autocomplete?
> IHateForALiving: Every time I worked on some parts of the code I've been writing some type definitions along the way, and it's adding autocomplete if you type hint your code... but I've been told not to write them anymore, so I stopped
> TeamLeader2: But why tho? It's so fucking handy
> IHateForALiving:3 -
I feel like a lot of us write code without thinking it through beforehand. I spend more than half my day working everything out via diagrams on paper or lucidchart or with a coworker/previous maintainer (if applicable) before line #1 of code is written. Ideas are to code as source code is to build products - the latter is made (essentially by rote) from the former.
I'm glad I work from home thanks to 'rona, but before that, gah. Everyone else was visibly grinding away, and here I am staring into space thinking about the problem/project I'm working on. I'm not gonna sit there all day debugging code I once rushed. There's a reason the sites I maintain stay up and untouched by hackers (I think, you can never be sure...).3 -
Always make your code readable before you stop working on it.
Not just for other people to learn from but also for yourself.
Context: just lost about 3 months of progress because everytime I look at this file I feel like starting over... -
Optimization issue pops out with one of our queries.
> Team leader: You need to do this and that, it's a thing you know NOTHING about but don't worry, the DBA already performed all the preliminary analysis, it's tested and it should work. Just change these 2 lines of code and we're good to go
> ffwd 2 days, ticket gets sent back, it's not working
> Team leader: YOU WERE SUPPOSED TO TEST IT YOUR CHANGE IS NOT WORKING
> IHateForALiving: try it on our production machine and you'll see the exact same error, it's been there for years
> Team leader: BUT YOU WERE SUPPOSED TO TEST IT
Just so we're clear, when I perform a change in the code, I test the changes I made. I don't know in which universe I should be held accountable for tards breaking features 10 years ago, but you can't seriously expect me to test the whole fucking software from scratch every time I add an index to the db.1 -
Boss asks if the project will be finished today, I reply ‘yes’ and then realised I’d not pushed my code after working from home the previous day! Doh!1
-
I've only been working for a about 6 months, so this is the best I got.
I'm working with a software/programming language I've never worked with before this, so sometimes I have to go ask my co-worker if what I did is correct, or ask him where some information is stored.
So sometimes I do someting, and then go ask him if it's ok and I can continue. He looks at my code, starts asking questions and (sometimes, not always) says something like "this is not it, let's do it together". Alright, I understand that, I know I still make a lot of mistakes and I'm still learning how to work with this. It's all still very new to me.
We start looking for stuff, making queries, programming, etc. and then we end up with the exact same code that I had made... But, somehow, now it's correct...
This happens so much, I hate asking him things now!8 -
I wanted to rant like 10 times today but was on a tight schedule (yes its fucking sunday), so here is everything:
*********
Fuck you, i dont give a shit that you need to present data tomorrow, its weekend, you cant just fucking call me to get things done asap. Im working from the code of a dead guy do you know how fucking hard it is to ask a dead person whats their code do?
*********
I really wish devrant had some kinda longboard/skateboard in the profile pic
*********
Im still not a fucking designer i can make like does-not-make-you-barf tier designs, JUST TELL ME WHAT TO FUCKING CODE JESUS
*********
whys the new rick n morty episode not out yet wtf
*********
Yo i love linux but set the fucking privileges right you dipshit, i cant exrcute my damn code on your crappy ass 2008 xeon server fuck you3 -
The website I'm working on went down because of a 500 HTTP error and halted my company of working
I should not code in production1 -
that BS thing you do when your too lazy to code and just copied a code from an existing class and renamed the vars even if it does not work or not being used just to show your boss that your working hard as f*2
-
I know by heart that "premature optimization is the root of all evil" but not when I'm coding, no! I premature optimize the shit out of my code until I get crippled down and then I undo everything and make a working version no matter how terrible it is.6
-
You do not own your companies code. Of you hate working at your job, don't let the feeling of responsibility for the codebase keep you there. I keep learning that lesson.
-
1.Working on a repo's 20 day old version without pulling the changes first
2. Then blaming me to not tell him
3. Ultimately sending me a see screenshot of his code to incorporate in my code ( which he himself didn't write, but asked a coworker to do it)
WTF DUDE. Atleast you could have realised your mistake and not blamed me for it -
Today was a bad dev day working on a shitty React project. Not that React in itself is bad, but it can be hell to work with when the code is a big pile a crap full of anti pattern code. I spent the day refactoring to try to fix a bug, but to no avail. It would take days if not weeks to put some order in this mess and to prevent such bugs.6
-
When you have to debug a system made by a freelance agency that only had to get it working and not maintain and support it, leaves you with that feeling;
Their stack: https://m.xkcd.com/1636/
Their tool chain: https://m.xkcd.com/1579/
The actual resulting code: https://m.xkcd.com/1185/
And nobody can see why performance is suffering — it's all so simple and beautiful...undefined front end web dev tools stack wars my stack is bigger than yours tooling other people suck -
Title: The problem with "good enough" code
Body:
I'm a software developer, and I've seen my fair share of "good enough" code. You know the kind of code I'm talking about: it works, but it's not pretty, and it's not very maintainable.
The problem with "good enough" code is that it's a slippery slope. Once you start writing "good enough" code, it's easy to fall into the trap of always taking the easy way out.
Before you know it, your code is a mess of hacks and workarounds. It's hard to understand, it's hard to maintain, and it's a nightmare to debug.
I've seen projects go down in flames because of "good enough" code. The code was so bad that it was impossible to fix, and the project had to be scrapped.
I'm not saying that you should never write "good enough" code. Sometimes, you just need to get something working, and you don't have the time or resources to do it perfectly.
But if you're going to write "good enough" code, you need to be aware of the risks. And you need to make sure that you're only writing "good enough" code for a short period of time.
Once you have a working prototype, you need to start refactoring your code and making it better. You need to make it more readable, more maintainable, and more testable.
If you don't, you'll eventually regret it. Your code will become a liability, and it will hold you back.
So next time you're tempted to write "good enough" code, think twice. It might save you some time in the short term, but it will cost you in the long run.7 -
0. working PCs
0.0 technically they are working, but they are too slow to even open up eclipse
0.1 maybe this gets better at university
1 coding on paper
2 not using google + usbs + network drives for code sharing
3 if it might be applicable PLEASE ENABLE THE FUCKING CMD! OR LET ME USE ARCH ON MY STICK! C'MON2 -
Spent 2 weeks writing code in different services
Today D-Day for integrating all of it. And guess what, Friday evening and it's not working.2 -
Build pipelines are awesome. What's not awesome is forgetting the 'pipeline' bit.
Sure, let's have each TeamCity job in the 'pipeline' build the deployable from different places! You must manually merge your code from dev to test to release.
What's that? The functionality working in dev isn't there in production? I wonder how that happened. -
I’m either going crazy or someone just dropped a table from a database I’m actively working in. I don’t have a drop script for any tables in my code, not anywhere. One moment it’s right there, the next it’s gone? Luckily it’s pretty much empty, only generic data. On my way to check permissions.6
-
Hey devs!!
I just can't stop myself from sharing this.
Its been two years now ... my junior is working. and now she is handling standalone WP projects.. but somehow her task got stucked so I was asked to help her.
So I just said check the count of variables and she messaged me with code .. Ma'am this isn't working .. Haha.. I mean come on she better can google out atleast for syntax :(
<?php if(count($content2 == 3) && count($interestt2 == 3))
{
print_r($content2);
print_r($interestt2);
}else{
echo "not checked";
}
?>2 -
The moment when your code is like,
Yeah I'm working, not throwing errors, but not doing anything closely related to the things I should do.
Fuck this construct, I'll recode the whole thing and stop using any two-year old legacy code, for this project -
I've been vibe coding not knowing that it was called that until yesterday. I always give up before I reach anything interesting because I get about 4 or 5 good responses before it starts forgetting things and breaking already working code. And it's not even that complex of an idea.
There is no way people are coming up with whole applications with any level of complexity with these things.10 -
FFFUUUUCCCCCKKKKKIIIINNNNGGGG GGGGGGGOOOOOOOOOOOGGGGGGGGGGGGGGGGGLLLLLLLLLLLLLEEEEEEEEEEEEEEEE.......
Spent 2 days trying to figure out why the template app didn't work, debugging and commenting out code....
The solution was somehow the XML elements need to be flipped... AKA... the template ***written by a Google monkey*** is WRONG!!!!
https://stackoverflow.com/questions...6 -
Release on Monday === almost 10h of code today... Though it's just an internal release, so not that serious really. Though it's be fun to have something we've been working on for half a year working decently the first time people actually get to try it... Well, well...
-
Today I got bug report on code that I thought was fairly well unit and manually tested by me while I was writing it.
What happened:
Our QA was testing other feature and asked someone to deploy into his env other branch, without these changes, and reported that this feature is just straight up not working at all.
That report was kindda big deal1 -
Gonna give up on Advent of code.
I know I'm not really a programmer and while I had fun solving the challenges so far it feels I fail to translate the idea of solution into working code. i.e. I know how it should be working, but when diving into the code I'm losing focus and getting lost in the functionality.
It was also good reality check of my skill level when a task took me 50 min while TOP100 is below 10. Can't really fit the time it takes me to come up with a solution with other activities I should actually be doing.5 -
This just crossed my mind. The company i applied at was working with the freaking Wordpress for webshops and still they think i’m not good enough for them. Next time better check the code i send better. Insane. Bunch of fuckheads3
-
Colleague (Lead Engineer): Hey, check my code. I'm trying to group a list of Request objects by their id. Something is not working here
Me: * saw his code, had a lot of shitty loops, called all for a quick meet, changed his shitty mess to one liner
list.stream()
.collect(Collectors.groupingBy(Request::getId))
Walked out like a boss*
😎 -
The few times i have pushed code to the repo when it's not ready.
Granted it was so i can carry on working on it elsewhere but it wasn't my proudest moment.4 -
I value our most senior developer. His code is certainly clean and structured. He is the ultimate at KISS. However he's not a fan of testing and instead just says, well, did it compile? No matter how much I show him how great testing is, he comes back with how it's pretty unnecessary. Somehow, in the deep dark parts of the web, he finds articles that comply with his standing. I'm okay with him not making tests, I do it myself. But then when working extending or implementing his code, many of my parts are untestable because the parents are. Oye.6
-
How do you deal with a manager like this?
My manager is close with 2 colleagues who constantly suck up to them and who they're pretty much friends with.
I don't particularly like to do stuff like that and don't really like the manager either (in my opinion they're incompetent) but now, often when I write code, the manager will have those colleagues "check" it. Not peer review, as I never get feedback. Just occasionally I'll find out they "checked" my code to see if I work/do my job right.
This is despite me being more senior than the both of them, having contributed far more actual code to the project than both combined and one of them can not even write proper code!!!
I'm honestly tired of sitting here and working on boring long tasks, and then being treated (behind my back) as if I am not working.
It's building up this paranoia in my head that this problem is also making other colleages/my boss think that I am slacking.
I used to be so close with everyone at the company, but now I feel completely alone and alienated...28 -
VS Code, WTF is wrong with your tab stops?
I set to 2 and you still use 4.
I say use spaces for tabs and you still put tabs in my document.
Tab settings by doc type? Not existing or working.
Damn you!
Just work5 -
Aaaannnd again a failed interview.
Just because I didn't pay enough attention to the question.
Did that ever happen to you guys? Like you just write a huge pile of code, you look at it, you're proud, but it ends up not working because you forgot one little thing that makes it completely incorrect?5 -
Thanks I hate it, I hate the fact that typescript will still transpile this. Not an exact copy of the code I'm working with, but close enough. Also this code targets es3, but we generate tsconfigs that say es5 (which don't actually get used) which leads me to believe that we generate them soley for the benefit of ides, and because if they said es3 the ide would show even more errors7
-
first time working with android. using threads debugging is not working like it should. app works great when I'm not debugging. code doesn't get executed WTF i really need that stressball FML
-
So my friend had an idea for a game and asked me if I could help him develop it. Now, he understands how the code works and can even write quite a bit himself. On several occasions (including today) this happened:
*writes code*
*tests code*
Me: Hmm... this isn't working like it's supposed to
Friend: It looks pretty good, maybe check to see if everything is in the right order
*checks code*
*tries alternative solution*
*checks again*
Me and friend: Well this is even worse than before
*presses ctrl+z a lot to go back to the original*
*opens new project*
*writes new code for same purpose*
*checks code*
Both of us: IT WORKS!!!
*checks again just to be sure*
Both of us: IT STILL WORKS!!!
*compares new code to original code*
Me: It's the exact same code with different variable names!!! Why did this not work before?
Friend: No idea
*puts new code into main program*
*it still doesn't work*
Reasons Java makes me cry sometimes4 -
One intern showed me an issue he was facing. "Delete" button was not working in a HTML page he had developed, but edit button is working properly. I checked the code both buttons had same id "edit72-btn". I said to him you need to use unique id in a page.
The thing he said next made a speechless. I was just looking at his face.
He said "edit72-btn and del72-btn are almost same, couple of characters are different. Are they going to work?"1 -
For the new/aspiring developers:
1. If you are still looking to learn more, but you don't know where to go, start brainstorming. Make a list of projects you could make and sort them by difficulty. Put the ones you could do now at the top of the list, and the ones you aren't sure how to do yet, at the bottom of the list. As you go through them, if you want to do something but aren't sure how, just hop onto an irc chat and everyone will be glad to help. As you go through the projects, your logic and program design skills should improve, as well as your knowledge of programming.
2. Put comments in your code. Seriously. If you are working on a project and suddenly stop working on it for a week or more, you will go back to look at that code and be extremely confused. If you are making something open source, its even more important. If people can understand the code, they are more likely to contribute to it.
3. Try not to focus on code for too long. The longer you work, the more tired your brain gets. Eventually you get tired and make really stupid decisions in your code.
4. Don't code while tired (look at #3)
5. If you are writing code as an assignment, make sure to rename all variables to proper names before submitting it. The instructor will likely not be pleased to see variable names with the f-bomb in them. -
Ok the ionic datetime component horror ended. I got it working good enough but I'm not proud of my code. The whole thing is a giant hack parsing dates to and from strings, switching locales, setting months and days and using the month as a daypicker as this fucking component does not allow me display day names in it, only month names. Such a mess... at least now I can work on the stuff that matters.
Actually though about making this open source... I reconsidered.8 -
Management has reviewed DevOps which is already being shown to customers and wants to introduce a code coverage metric to show customers how good the code is. Code coverage now has to be 80% or higher across the board, it's been decided by management, and there is no discussion on this topic. The front-end presentation layer has minimal business logic and most of the code that exists is generated objects to shift data to the backend (which in turn mostly shifts it to a 3rd party API that does a lot of the business logic). I now have to write thousands of pointless tests while also being 85% billable to the client.
I think code coverage can be used as a tool, but should not be used as a metric to promote the product.
I suggested an automated e2e test might be better placed to prove that things are working, but have been told we're not going in that direction.
I'm close to writing a code coverage test that uses reflection to touch all of the code, catch all exceptions, and return a positive result.6 -
Tldr:
Can't fucking figure out why I'm the only one who can't solve a DP problem in code, when me and friends use the same idea and no one knows why only mine doesn't work...
We are given a task to solve a problem using DP. My friends write their code with the same idea as a solution. Copying the code is not allowed. I follow the same idea but my code won't work. Others look into it, in case they find errors. They can't find any.
The problem (for reference):
Given a fixed list of int's a = (a_1,a_2,...,a_n) and b = (b_1,b_2,...,b_n), a_i and b_i >= 0, a.length == b.length
We want to maximize the sum of a_i's chosen. Every a_i is connected with the b_i at the same index. b_i tells us how many indexes of a we have to skip if choosing the corresponding a_i, so list index of b_i + b_i's value + 1 would be the position of the next a_i available.
The idea:
Create a new list c with same length as a (or b).
Begin at the end of c and save a_n at the same position in c. Iterate backwards through c and at each position add the max value of all previously saved values of c (with regards to the b_i-restriction) with the current a_i, else a_i + 0 if the b_i-resctriction goes beyond the list.
Return the max value of c.
How does that not work for me but for the others?? Funny enough, a few given samples work with my code. I'm questioning my coding ability...7 -
Three hours of debugging the program.
I also wrote a thread in a forum to ask for help explaining all the test I made.
My database is working in Sql Management Studio but not in the code. It done well only using the trusted connection.
The issue? I was using the windows note (Win+v) to paste the connstring since the beginning and in the string there is a / instead of \ in the instance name. I'm writing here to not smash everything...1 -
Install .net -> install vs code -> install C# vscode extension:
extension not working.
Great job Microsoft!
Booting back to Linux partition.11 -
Working on an assignment in Java. Was making a test, but no matter how hard i tried the test would never run. Went through the code several times changing it entirely.
Realized after four hours that it was the test that was wrong, not the code 🙄1 -
Working with a pointer-linked graph. With pointers referencing pointers referencing pointers referencing pointers ref....
*explodes*
it's not (only) bad code, its my life now.1 -
so, I am trying to implement a caching solution for my CI/CD (because, you know, BitBucket CI caching sucks ass big time). This time I was writing a module in Python. I spent 2 evenings in the evening building it, debugging and testing, implementing several features making it a flexible solution.
So, yesterday I had a pretty much well working version. Before pushing changes I wanted to drop the cache and give it another round of testing, just to be sure I was pushing a truly working code. I rm-rf the cache directory, restart the engine and I'm greeted with an error message saying the module I was working on cannot be found.
wtf..?
Out of a sudden the IDE stopped showing all the project files as well.
wtf happened....?
oh, of course.. I rm-rf'ed my project directory, not the cache directory. Deleting EVERYTHING I had.
fuck.
I should not be working half-asleep4 -
What is the point of removing code that will literally be added back in on another story? I just don't get it. I am in the code. It took two seconds to fix it but because it is not part of the story that i am working on someone is going back and ripping it out even though the next story is to put it in. Don't fucking complain to me because we are behind on this fucking project.2
-
At work, when I try to find the best place to implement some code, I read the current code to get why it's here, and if I'm at the right place to do my stuff.
Sometimes the previous dude writes a shitty code because, well, Drupal 8 and he didn't have much choices to make his stuff work.
But some other times just reading the code feels like double checking if I did all my vaccinations. When these moments occure, I activate the annotate mode in PHPStorm so I can see who wrote this piece of dumb shit code, so I can insult him in my head while doing my stuff.
Sorry pal, I'm not paid enough to write a WORKING code for you at your place, but at least you'd know that if you were drowning, I'd share my point of view about this planet's overcrowding. Fucker. -
When your co-dev keeps forgetting to push his code to the remote repo and you're stuck during the weekends without his new changes and he is not working1
-
Taking over from/working with an external dev company on an existing project.
Listen Mr CEO, I'm not here to mess with your firm's code and undo all of your work. I'm just doing my job. Stop telling me that the only thing left to do is "data" without any context. The site that I'm here to work on isn't even finished. -
Lots of code not working, lots of job problems, lots of troubles in life, lots of sleepless nights…
But hey, I have marshmallow chocolate cookies :)6 -
Love this open job position of node.js developer on BMW Group.
Working with cars and open source code its a Saint Graal.
But not this time. -
That moment when you’re debugging, and you realize that your output files are not empty because your code isn’t working but because your code IS working... 😑
I changed the test files I was using so I wasn’t expecting that particular behavior. None of the input data met the requirements hence nothing was being written out. It wasn’t until I tried a larger test file that I realized my code was working.
A simple discussion with a teammate would have solved this. 👀😂 -
I was ok with microsoft taking github
idk wich faults is but lately when i try to
$ git pull
it says that is "up to date" wich is cleary not
I checked the repository on their website.
SOOO here i am copying the RAW code from github so i can have the same version of what im working on rn
¯\_(ツ)_/¯8 -
I went to a vacation leaving my colleague a working code that she was supposed to use and commit as is. Coming back a week later the code is unrecognizable, not committed and doesn't work. Now I need to fix it again while she went home. Plus I hate it that we're forced to use svn, the change is 40 files strong already.1
-
My team still use console.log for debuging instead of breakpoints, I don't really care about it when the code in development, but I really hate it when it goes to production.
I search in the project and found total 231 of console.log with allow console rules above it, I mean why don't you just delete it after the code is working, it's not that hard rather than to delete all console before goes to prod.6 -
"Long" time lurker here... Doing my master's thesis, nothing works (Gaussian Mixture Models hate me) and there's less than a month left until opposition. No results, no working code, feels like I don't understand anything. I can't relax anymore, not even on the weekends. Several times I've just felt "Fuck it, let's just not do this", but I feel like I'm close to the finish line... Right now, I just wanna start working instead. I think.6
-
I start on paper by describing what a basic version of the code should be able to do. Then I write down some ideas of improvements to the code, more functionalities, etc. This allows me to write the basic code already thinking of what I want to add next.
Not that it matters anyway, 95% of my codes never lead to a working product 😅 -
Am currently handling a very bad code, once you add any feature the app crash and you have to fix the whole POKER application ( as you know poker is a really complicated and everything related to each other). The app crash and every single line of code goes wrong. As well i do barely have a break and am working overtime and during the weekend.
In addition to all of this i have a very complicated design and animation to the chips. Adding to this am the only developer working on this project.
Summing-up am working 10 to 11 hours per day 7 days a week. And still the manager is dissing me as if am not a good developer.
I feel so bad, i cant describe how am currently feeling.
So guys do you believe handling a very bad code might reflect your coding skills ?3 -
The moment, when you just about start a demo on your project and the code is not working at all, is pretty awkward. What makes it worse is that even the master branch is useless. The good thing is that noone noticed it, since the demod feature worked well.1
-
I was looking at the code from my first project after i started working. It was initially created by a consultant who in his own words "had no idea what he was doing". I found this wonderful comment. Its swedish but roughly translates to "This is completely wrong... Or maybe not" (It was) :D2
-
"hey, can you please help me out with this, it isn't working"
"What's it say?"
"I dunno, It's giving (not throwing) some exception/error" (no clear distinction between them)
Well, shit. Did NOT expect Java to do that in case of some undesirable flow in code! Stack trace, error message, what was happening when the exception (or actual error) occurred as inferred from logs... Nope.
Great! -
All summer I've been working at a company doing some full-stack development. Starting my last year in university, I really wanted some real life experience that ties into my studies.
I did not expect to find horrible, undocumented, code that has been written 5 years ago, where the senior developer who wrote it doesn't even know what it does. The worst part? They are STILL not documenting! I tried to document, but got this in return "you don't have to document everything. Especially if it is understandable". But they don't even understand their old code!
Monday morning, we had a meeting and they asked what I thought of working here, seeing as I am done this week. I respectfully told them that their code is not readable, and it will make it hard for new employees to understand. The boss in return says "you're the third newly hired employee this summer to say this... Maybe we do have a problem then"..
No shit. Please for the love of God, comment your code!2 -
I'm starting to get sick of working with handed over projects that previous devs think they are masters of programming and their code is nothing but pure chaos ....
I'm given a project written in Java & Swift, API class is initiated a million times in same view, has access to android context, custom font is applied by creating custom text view instead of applying customization in styles file ....
Still haven't yet looked into iOS code but I'm not expecting much ...
Sometimes I wonder why I chose working with code4 -
When I get stuck or don't understand why something is not working the way I think it should, I like to walk my self through the code and explain it out loud to myself.1
-
So made this component that my colleagues also use.
Today i checked source control...
What did they do to my creation?
Lines commented out here and there. Features destroyed by rewriting it, instead of just using it. Related unit tests broken of course. It had everything. And why not ask me?
According to Source control they helped each other. Working together as a team, desecrating my code.1 -
It is quite a hard pick either generally coding with friends for fun or getting my first ever program done completely by myself (and I don't mean Hello world but rather my first small 'project') . But I'd probably go with my first ever program. Even though retrospectively the code is let's say not that great, it was still an awesome learning experience to actually create sth working out of code
-
Wanted to know what you guys think about "Dev" jobs that also include making slide shows and presentations?
Eg. Imagine working on an analysis engine. And just when the core functionality is working, your boss wants your team to make presentation for every client that it's going to be used for - using the raw data given by the engine.
Instead of maybe adding that function to the engine itself.
Suddenly your work is now 12+hours of MS office instead of 8 hours of coding.
And a year later. You have 10 unfinished skeleton code architectures, poorly documented and 90% of the test cases never written.
And most of the devs who were on the initial project have either left out of frustration or have been fired because apparently fresher's who can not code with a senior coder level proficiency is not performing well.9 -
>Weird Windows 10 glitch occurs causing text in dialogue boxes and other various things to not appear until you restart your computer.
>Is working on a program in C#
>Presses button in source control.
>Yes or no dialogue appears.
>Presses yes.
>All flies in working folder disappear.
>Restarts computer to fix visual glitch.
>All files in working folder don’t actually exist anymore.
>3 months of work nowhere to be found.
>Downloads decompiler.
>Decompiles previous versions executable file.
>Continues to work on project with decompiled code for the next 6 months.
>Gets sick of everything and painfully rewrites the entire program in NodeJS.
Moral of the story: Never gamble with Windows.4 -
So I was thinking about learning to write some Go code. I downloaded it and it didn't work. I struggled for hours just to get it to execute a file, but I could not get it working for packages.
Never have I stumbled upon a language that's working AGAINST me.
I gave up, Go beat me. I removed everything on my computer related to Go. Fuck Go!8 -
Sitting on a hot chair in this hot weather working on a hot laptop to fix some ..... not very hot code.1
-
That moment when you fcked up in a technical interview and realize oh I need to sharpen my skills, I need to improve my skills! I am not a worthy programmer now 💔
Then you go to work next day and have a busy day working as a project manager!
Now I know why my skills got rusty, and am not able to code as I used to be 😭😭😢2 -
triggers {
cron('H */1 * * 1-5') // 23 every working day
}
I hate when comments are not updated along with code.
Even more when git blame points at me xD1 -
Is there a good place to post code and have people comment on the style or the logic? I'd love to start getting feedback on my code and break bad habits before they become too ingrained. Plus, our first project is a blackjack game, I'm working through it pretty well but I'm a little stuck and I think it's completely because I'm paranoid I'm not doing it well/right (even though I probably am).2
-
So over the past few weeks I have been smacking my head against the table tying to solve my work problem and failing to... Today I spend a few hours at work not working and playing with code making something fun and easy. After this I go back to the headache and if my magic get something working.
-
Am I the only one thinking that maatwebsite/laravel-excel package is poorly documented?
Trying to make it work for excel file reading I have to do. 4 attempts (every attempt by 6h) - shit's not working like intended. Poor examples, code itself - just..not connecting dem dots, m9.
Just had to let it out from my system.3 -
Joined a new company as front end developer after working for a legal tech for 3 years. The codebase is shit here. There is this ReactJS developer who has done everything except for following standard code practices. No modularity, no reusable components. Some files go beyond 2000 lines of codes. It is a literal nightmare.
The worst part is, he does not understand that he has written the worst code. I dunno how to handle this now.8 -
New piece of code which should work perfectly and solve your problem but it is not working just because you forgot to remove an old piece of code you were trying to fix the same problem! Fuck my life!1
-
!rant
The code I've been writing the past weeks has finally been activated in production mode yesterday, thousands of items have been processed and I'm so proud as a junior developer to have this 100% self-written program working and, above all, to create value for my co-workers :D
The code is not as beautiful as it can be, but it's a truly one-off thing that can be deleted afterwards, so it doesn't matter :)1 -
Sometimes i like to break my code on purpose, to force me to refactor those parts and rewrite them more efficiently.
I find it hard to improve existing, working code, because it limits me and it does not inspire me to come up with something better -
Oh noooo! During the last retrospectives we, as a team, decided to not refactor things to make it nicer, better or even more loosely coupled, as existing mechanisms are working properly and as such the refactoring is not absolutely necessary. But now someone in our team suggests to refactor something that is ready for deployment. Just because it will make the code better and more maintainable. Yay! Lets add another 2 days of work just to refactor out 3 lines of code.
-
Remembering of when I first learnt about the importance of version control.
There I was, working in Visual Studio, laptop unplugged; the laptop suddenly shuts down - battery dead. Not too worried, might just have to rewrite a few lines I had not saved. Restart the machine, open VS, the file I was working on now contains strange characters - totally damaged.
Google for help, find a question on stackoverflow with the same issue (comforting moment). The answer I get:
"First question, why wasn't your code on source control?"4 -
Working in IT all day at work (not coding), yet I am excited to come back home to code and learn new stuff I don't do at work... Difficult to resist, too much cool stuff out there every day!!!3
-
Weekend of our big re-platforming finally comes. I'm not invited for overtime work during this transition. Boss emails on Sunday wanting me to test some code.
What the actual fuck? HAHAHAHAHAHA!! Nope. Office could be on fire - not being paid? Not working. 🍺🍺🍺 -
I just found this in the code I'm working on:
function checkDateValidity() {
function checkDateValidity() {
...
}
}
Obviously a bad copy/paste. Not even sure how it was working before; it probably wasn't.1 -
My process starts with a problem and trying my best to solve all other problems(read bugs,errors,oh god the code is not working ) related to the parent problem.By gods grace I have a great buddy called google search engine who tought me everything...But I still am surprised everyday that I know so less of coding and fall in love again with it...
-
Commenting the code at the end of the day. Not while working on them. Usually end up having comments of create action on update action.
-
learning to code while working as not a dev. Gives freedom but zero experience. Need experience but lack confidence :(6
-
Can someone help me? I'm getting this error in VS Code while working on my Unity project. Everything was working fine for last few months. Now I'm getting false positives, because everything works fine in Unity. The problem's gone when I open "ObjectInfo" class file and save it, but I have to do it every time I start VS Code.
The type or namespace name 'ObjectInfo' could not be found (are you missing a using directive or an assembly reference?) [Assembly-CSharp] -
The most scary moment about running the code for the first time is when no errors are displayed and you're sure it's not because everything is working as intended but because the error is so critical it won't show itself so easly1
-
For me the most frustrating thing about working on someone elses project, is when you try something and it just does not work, you dont even know the code to try think about what the problem might be to begin with. What about you guys ?
-
I'm working on my own smarthome project (how rare nowdays...:) ). I'm using microsoft's git repo. I'm not make my project open source, not because I'm a douchebag, but because I'm a very bad coder. My biggest fear is not the fact, that it would be commented as wtf is this code, but receiving pull requests from pros and I wouldn't even understand their code.
This is my "training" project (python, flask, apscheduler, sqlalchemy, bootstrap2, mqtt, micropython)
I'm thinking to make it public without accepting external pulls, just for me to learn more.
I'm just wondering your thoughts on this.
Thoughts?1 -
When asked if i will code for stock options or profit shares, i might remind the prospect that in most countries, i would own the entire codebase if working for no pay. Most work for hire agreements put ownership of the system and code into the paying clients name, as i understand it. so if youre not collecting pay, you would own (possibly the only copy of) the code. If that doesnt scare the client away, maybe i should remind them id be legally allowed to sell the code to their competitors. Then do so if i see a bettrr paying client (i.e. any paying client) If anyone knows if im making legal sense id appreciate it.
-
So you need babel to run es6+ on node js because node js can't handle es6 yet. 🤔
Why can't the node guys work with the babel guys to integrate babel with node and save me the extra stress of having to figure out if my es6 code is not working because of a syntax error or because I didn't transpile properly🤷♂️17 -
I write code as part of my job but also tend to have a lot of pet projects I think about in my spare time. A lot of those projects are not specifically targeted at solving an actual real problem but are just a curiosity (like my Duktape/ECMAScript thing that could import and call DLL routines.) I often find it difficult to choose which one to continue working on and end up not working on any of them because I can't decide which one is more interesting at the time! Or I get stuck and struggle to find a way around whatever roadblock I've hit.1
-
Best: getting some awesome code buddies, making my first game for my college event
Worst: not able to work and even abandoning a game dev project I wanted to make for 2 years due to college stuff
But I hope i will start working on the game again next year🤞1 -
Hey fellow ranters. Please help me with some trouble in my code :(
http://stackoverflow.com/questions/...
I think i'm losing hope in me and in my future as a developer... This is actually a pretty easy thing but nothing it is not working... Please help me!!8 -
Am I right? Is this micro management?
So, in my new team, I have another coworker is my buddy, we are same level and I doubt here coding techniques as I have seen very bad code written by her.
The thing is, whenever I need to pick up a new jira, she starts telling me what code I need to change, without me understanding the ticket or the code.
She forced a code change which was obviously a bad one.
She asked me what did I do yesterday and said that I could have worked on this jira.
Although this is a start but I don't want yo waste my time working with someone who is trying to micromanage when I clearly have the potential to be working without her micro-managemnt.
The problem I see is that her priority is not learning but I don't know what is that but she worked on the tasks which are clearly not our teams work, in the initial informal chat she was too concerned with people being young in the company like who is married who is not etc.
I don't see her as a good developer.
Should I move to other project? or am I overreacting?7 -
Okay, I know that osTicket, code-wise, is a fucking joke but know what? We upgraded our server to PHP7, osTicket stopped working. Okay, I need the newest version that it works, I downloaded it. It failed at database migration cause it's not PHP5 but I need it cause it should support PHP7...Wtf??!
-
Studying. I decide to study for an exam and not only the "coding-zone" is here, but I have an infinite amount of new ideas. Yesterday I fixed some old bugs in the matter of 30min, did some piece of working code for chrome-like notifications in 10min (working, not pretty) and today passed the exam. Slept 2 hours though.
Brain is insane, what do you want to hear... -
Was working on OAuth2 in unity (first time oauth attempt)
Could not get my token for like a month... Then a friend was line per lining my code, ; =\= :
It worked after that :'(2 -
Working with microcontrollers is like another level of frustration.
Beside the code not working you are on another level, which is the hardware not working...
Once spent 6 hours searching for a bug and in the end the "bug" was swapped cables for communication.2 -
not only using a static factor to resize a freeform, user uploaded image into thumbnails, but also defining this "const" in every method that uses it ... with the same values ... gotta love working with this code ...
-
!(rant)
I'm a student and I'm currently working on a project.
How do I get it to execute blocks of code depending on the type of value it receives in a variable?
or maybe
Should I just use some other method or workaround to do it?
I'm not sure if I should post my question on SO.
(I think it's a dumb question)
--
If it gets (request.getParameter) a string { execute code }
else if {
//gets an int
execute code
}4 -
Not happy. On my side project things all of a suddenly stopped working in the browser. Debugging shit is a pain as the JS code is generated.
I still don't get how it was working before and now it doesn't, when I basically think I didn't touch anything.
Hate feeling like a n00b. -
Ok......so we working on this system with a friend
we have deadline today
he's the one who wrote the code
I'm just implementing some features
maaan the dude is just not responsive to questions
and project structure and code is bad AF no comments or docs
WTF!!!!!!! -
So I've been trying to debug a bug for the whole day. I've been trying and trying to discover why my update method of my User class wasn't working.
I've tried a lot of stuff, searching and searching through my code possible reasons, adding debug prints everywere...
Guess what: it was working. The thing was that I had the user modified in the DB so I wasn't able to modify it since it was already modified. I even tried to find the bug inside the get method saying "hey, that's not the actual user in the DB!"
Thanks, brain!1 -
FOR FUCKS SAKE. I HAVE THE RIGHT URL FOR THE SQL DATABASE. WHY WON'T IT SHOW SAID DATABASE IN THE SERVLET FROM THE URL!!!! It conects to IntelliJ without any issue, so why isn't the servlet running it?
God am I really going to go to stackoverflow for help? I need sleep.1 -
It is really really really sad, when you tried to make a complex thing work in many days. When you tested, it was working amazingly. When you were about to finalize delivery after one week, it fucked and stopped working. Now either you fix it, or find another BLOODY algorithm! 😠
-
Working on maintenance suck, but that's why most of the software developers do. Stable job and higher pay. Mundane tasks like fix bugs or modify small part of the software.
Working on an idea is interesting in startup. You don't see shit code and code from the ground up. The work is creative. But the pay is low because the company is not profitable.
Which one is your choice?1 -
I need some advice, you guys.
I'm weeks away from graduating from my code school and working on a capstone project with a group and there are several people who I'm having a hard time following their code.
No comments, no documentation, just "30 hour sessions" and opinionated, undocumented code that doesn't mesh with the project plan 100%. It works, it get's the job done, but it's over complicated, undocumented and hard to follow.
Starting to feel like the 3rd wheel in a 4 person group because I'm the only one that is having a problem and I'm not sure how to get them to document their code for me. They try to explain it and just end up literally reading their code, which doesn't really help.
I feel like I'm working in a group of individuals who don't really want to work together and I'm worried it's going to be a problem.1 -
Hey hackers,
Let's talk about the problem statement first!
In software engineering, engineers often procrastinate when it comes to writing comments for documentation purposes. As they delay properly documenting their codebase, they are even more likely to procrastinate on updating their previously written comments when they make changes to their functions or code. This can lead to chaotic and buggy code, and if not addressed, it completely obsolete or even counter intuitive the purpose of comments in the code.
Solution!
A tool that automatically detects changes in a function or code and compares them with the current comment description. If there is a discrepancy between the code and the comment, the tool either automatically updates the comment or allows the user to manually select the code and its associated comment to directly make changes using LLM's.
So, my question is: Is this idea worth working on? Is it a real problem, or am I just overthinking it? If anyone has a better idea, please share it in the comments. Also, if someone is working on this problem already or planning to work on this in future, we can collaborate. This will be an open-source project.
Sign out, Peace!
github: priyanshu-kun/project-kento12 -
Has anyone experienced being able to run a build of an electron app that runs successfully, then run the same app that was zipped/tar'ed and then extracted and no longer works? Currently facing a "module not found" error after the application was archived and then extracted. The code im working on is open source and has plenty of documentation if you would like to take a peek!
-
The comments on a community site that was live for 6 months were not working. I looked at it and there was some dreadful code that threw an exception every single time, the previous devs solution was to wrap a try/catch & return 😨
-
Since I am working with a pretty large codebase at work and also some ugly parts I do not fear to look into a fat ass open-source repo and get into it (fix something, ..). Never let the fear of it be your excuse.
But if the code looks like golumn, rewrite that shit yourself and do better. -
Inherited a project from my lecturer. He's been working on it since 2014. Over 200 classes and not a single line of javadoc. He's even written his own library code for things like task executors. Sometimes I wonder what obscure deity I pissed off in my past life to deserve this 😂😥
-
How does a new employee ask for questions and don't get - "search on Google"?
Like doing a code-review together. It seems impossible these days, everyone is so busy...
I need that social interaction, and besides Google can't answer all questions thus mostly is information-based, and not something someone has been working with for many years that is targeted towards the place you work at.7 -
Or when I'm working on some legacy mess of php code and changing nothing and then reverting even that causes the whole code to act in some nonsensical way with three buttons hooked to the same code doing three completely different things and none of them having any remote connection to what is in the code. Sometimes I get it to get its act somehow together by fucking rebooting my computer (???). What the fuck is wrong with php and wordpress in particular? Could it be any more of a mess?
I literally commented out my whole fucking code, rebooted the server. Is there some cache I'm not aware of involved? It all feels like some fucked up nightmare.6 -
I don't even know that i should say it was a good problem or a bad one, i was programming a magnetometer sensor in both spi and i2c. I was tired of not working
I touched the sensor it dropped off!!! It was not soldered well!!!! At the problem was not from the code1 -
swagger code gen not giving a useful error message of which part is causing the error, fuck you, plus I'm working off an example of a thing that worked fine
References to other documents are not allowed -
I'm not working as a developer for money, sometimes it's hard to find the motivation to code on a recent project. The result are 10 projects that are all not finished -.-4
-
XML? NO <SHITSML>
I have been coding my app ( pc ) using android studio for weeks and some reason the xml code isnt working >:( its very dumb whoever made xml can stick it up their blowhole its useless! its just data store that people can edit lmao all ya need is a text editor and a decompiler and i can basically turn a switch into a button :/ the xml has not been working for 2 weeks and mum says i develop useless apps / games and i need to study more7 -
Handed off my code to Devs working on main products. Long presentation explaining everything.
Have discussion afterwards about what it does, but not how it looks.
They say thank you, I say you're welcome, and since this is my first bigger project, if they have some pointers or glaring defects in the code I'd welcome the feedback.
They all start laughing. I do too but in my head I'm like "wtf, I ask for feed back and you laugh? That's."
It's been bothering me.2 -
I just spent around a fucking week questioning myself, my sanity, my code and a 3rd party api to find out I was submitting bad data to my correct code in a separate part of the product.
Fuck my life and my self inflicted stress and guilt over this. Hopefully edge cases are already covered, I fucking had working code or so i hope until the next bout of debug hell.
Also fuck you spring for not letting me see request body of an outgoing post request. -
Being greedy is good at some point, but when you're so greedy that you take up a project without any tickets (JIRA Sprint) and requirements over Skype.
That being said, managers should not get greedy all the time.
I mean when the previous developer left he made is so difficult(I am assuming) to run that hourly job, that it took me around
> 4 hours to fix spaghetti code still job not running,
> Fix missing parameters still not working
Finally said to the manager that the configurations are not on the server which are being used in the code. -
So... Here it is
I am working in a web application thay only works on IE (I know, it is not my fault), and I asked the programmers that started this project, if we can start using it in another browsers but they told me that it is not possible because 'some javascript may not work in other browsers'.
Is this really possible or they just don't want to code for compatibility with other browsers?3 -
Guys, I'm refactoring a server code from es5 to es6 and I would like to know how to get es6 errors like when I'm working with React. I have installed babel, and I can compile es6 code but I get errors that target the es5 (compiled) code so it's not easy to find the bug sources5
-
What a big surprise that developers have burnout. It used to be that working code that was halfway decent was good enough, and now the industry demands of you that you produce Martin Flower/Google engineer-level clean code at the high speed of a senior dev with thirty years of experience. And this is not a joke, it's the norm. I've been asked to meet this norm and sustain it. What a piss-off. How is anyone supposed to keep up with this pace?1
-
I don't know game development but idk I accepted an offer for game development competition..
the fuck I didn't even knew how to make one...
Now I. am working with Ursina Engine....
even the code on google does not work........1 -
Wasted 3 hrs on this today:
-Wanted to control pi gpio pins from php web server
-shell_exec(gpio write x x) wasnt working for me
-made a python script for gpio toggling which i wanted to execute with shell_exec
-still not working. Changed permissions, changed code , did everything possible SO MANY TIMES!
-Turns out if i had added a '-g' in the gpio write command..it would have worked in the first place!
FUUUUCK!!!!!!! -
I am working on a java project and I want to know where are compilers and interpreter stores machine code? According to this post https://interviewbit.com/blog/... Compilers store machine code in the disk storage but not an idea about the interpreter. Any suggestion5
-
I was going out of the office... I saw "all the code for the admin work fine, it's perfect like the Monnalisa"... 23 minutes later 4 mail about bugs, problems with the back end and some columnin the db which become void without reasons... So now on I will say "the code is not working"
-
I am that kind of a person who writes the function of each function() in comments above the def.
I hat people who do not do that properly :/
If you are working as a part of a team or wanting to distribute your code, you should do that. :)2 -
After my third "requested changes" I've officially lost all dignity I held. Spend hours working, wrong solution. Revert, not working. Fix, removed functional code. I think my brain is just broken. Or maybe this project is just massive and I just can't wrap my head around it properly. Or maybe I'm just clueless. One day I'd like to be at a level where you hear an issue and immediately know the solution, where the problem lies in the code, how to fix it, and how long it will take. Hell, I'd settle for even one of those right now. The learning process is so stressful.
-
Does no one check the dev console before comming to you about site code not working?
It says it right there!
You can't load a src with http while the site is https. -
Are dev's pussies everywhere now ?
https://github.com/yellowfeather/...
Simple error.
He did what most people do and said 'oh this is already working. always was working, never would not work.'
add a fiddle indicating, 'no, whatever update was added for some reason most emphatically is NOT working'
get a 'code of conduct' suggestion, for mentioning the circular bs around and around in time when the original guy is probably dead.
betcha anything its not fixed :P
betcha he left the code in place :P
god its like overnight devs decided to be grumpy assholes in a sneaky way, like the faggot barry I described at one point, because they wilt when directly approached and emotion is added in besides their weird bug eyed, watery eyed, teary eyed, horrified because they're now all baby touchers, bullshit.18 -
Me: I spent some time cleaning up code because our server was crashing every time I called this api I needed for the new feature we are building this sprint.
Scrum master: why are you working on things that were not planned in this sprint
Me: .... -
not sure what i changed, if anything
but my previously working code calling another microservice now fails because invalid jwt token
fml4 -
I was working on a project a while back making a language system, we obviously wanted to know what language the user had set so I looked to adding it to the database.
I've seen messy code and I'm not a gold standard but fml..
I ask the other dev who wrote the code and we end up spending a while getting it sorted. I had never seen the database before... 100+ fields on the main table...
I quit not long after. Hated that job and I have many things I can rant about from it. -
Hey fellow c++ devs, i have a question. I am currently working for a company that has a system with more than 300 000 thousand lines of maintained code and it is written in C++03. A lot of it utilises boost and custom performance work arounds and migration is currently out of the question, but I would really love to see some Cpp11 sugar in the code-base. I know there might not be too much business value to this potential endevour, but what do you think?1
-
I just love when all my code is perfect and clean... then I compile it to see my changes... and everything is fucking broken.. so I think "okay, let me see if I missed something or forgot a space or something stupid."... nope not that *recompiles* nothing is showing up.
"That's cool too, who needs a working website anyways."