Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "loose"
-
Government on crypto currencies
Government - "You could loose all your money"
Government Again - "You could loose all your money"
Government in loop- "You could loose all your money"
News - "Government planning to ban crypto currencies"
-Market crashed
Government - "Told Ya"71 -
So, my broadband internet is not working. Naturally, i called my ISP and complained.
He enlightened me, "Turn on your TV and watch the news. Theres a deadly computer virus on the loose and it is affecting banks and businesses and everything. So we decided to help our customers by turning our services down for a few days."
What the actual fuck?
Its like to Not eat anything due to a bird flu.
Oh! and i have an exam tomorrow.
Thank you muggles.17 -
Few months ago I made an app for my buddy. Because it was simple soundboard app (it literally took me 15 minutes) I haven’t took any money. He said it’s for personal use only...
So he released it under his name on Google Play Store... And now he asks me to add advertisements... For free... When I asked him what can I get from it, he said “you can add your name to Credits”
That’s how you loose trust and buddies!22 -
Free advice take it or leave it
A few days ago I completed my one year work anniversary(is that how it's said) at my first job. And this rant is basically stuff I learnt and stuff I wish someone had told me when I was starting out. Here goes:-
When you are starting out your first job you would be a fresh out of college and people around you in college are your friends where as people around you at work are colleagues. Your friends can like you, but you have to earn the respect of colleagues.
If you sit yo ass too long u will become fat(started going to the gym again).
Don't bother your seniors too much. they have their own shit to deal with.
Don't bring your personal shit to office I don't want to hear how cute your dog looked while it took a dump on your carpet.
Avoid the person who gossips.
It's a two way street.
Whatever you find amazing your boss may not you know coz you are a geek and your boss isn't.
Don't talk to people when they are coding.Yeah just don't.
Avoid "below the belt" humor you may look funny but you loose respect in the long run.
Keep upgrading yourself don't stop learning.
Admit stuff you don't know don't Bullshit.
To sum it up it's a game of respect, respect of knowledge,respect of skill and most of all respect of attitude.7 -
Software engineering is doomed.
The next generation of developers is going to suck as fuck
I've come across a lot of situation that made me think this way.
The most notable examples are right here on devrant.
I've seen a shit ton of rants blaming languages for "bugs" when in fact those "bugs" wouldn't have happened if those fuckers would have read the specifications of said languages.
This new generation doesn't read, when they've got a problem they just fucking go to Google for answers, they don't bother reading specifications, language books, rfc, etc, they don't bother reading where the true source of information are. The documentation ? What's that ? Let's go to stackoverflow first, let's think second.
Same back in school I've seen people in the highest grades that couldn't fucking decompress a tar archive.
In the coming decades we will loose the high skilled people, the people that made the software world as it is today we will be left with fuckers only able to blame things for stuff they don't understand.
This is my first true rant. This is me being pissed off.27 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I hate everybody who says JavaScript is the best language because of loose typing and its easy to learn, YES OF COURSE IT IS EASY!
ITS FUCKING JAVASCRIPT! IT WAS MEANT TO BE EASY! AND THEN SOME ASSHOLE CAME ALONG, CREATED NODE AND THOUGHT THAT IT WAS A GOOD IDEA!
NOW WE HAVE TO DEAL WITH THIS SHIT EVERYWHERE BECAUSE PEOPLE WHO WROTE CODE FOR UX NOW THINK THEY KNOW WHAT NEEDS TO HAPPEN ON THE SERVERSIDE!!
GOD FUCKING DAMNIT I HATE THIS ANALTOY OF A LANGUAGE.
YOU THINK JAVASCRIPT IS THE BEST?! DO YOU REALLY??!!! OH YEAH!?!
WELL FUCK YOU AND GO TO HELL, YOU ARE NOT A DEVELOPER IN MY EYES, GO HOME KIDDO, LEARN C OR ASM OR HOW A FUCKING COMPUTER ACTUALLY WORKS!!
AND THEN TELL ME AGAIN JAVASCRIPT IS A WELL DESIGNED AND PROPER LANGUAGE!!
I'M OUT!32 -
1. Move to new house
2. Setup electricity account to auto-pay every month
3. Wait
4. Receive "disconnect" notice from electric provder
5. WTF
6. Call. Oh, yeah, our website doesn't tell you that you have to pay your first month's bill before you can setup auto-pay. It's in the fine print.
Okay people, here's my rant - if you manage a website that supports auto-pay and you're not PREVENTING your customers from signing up for auto-pay until there is a $0 balance in the account, then you're doing something wrong. Don't let your customers think they're about to loose their electric service because of a frontend guardrails issue.7 -
Last weekend I witnessed the most infected computer I have ever seen in my life...
I went on a private party. A girl had her laptop plugged to the speakers to play some music. This thing was literally 99% cancer. The first thing I noticed, when I looked at her opened browser, was that nearly half the screen was taken by toolbars. Also any popular website you could visit had additional ads INJECTED into it. The fist 10 YouTube search results: always porn. No idea how that didn't make her suspicious.
Precisely every 10th click (anywhere not only in the browser) would open up a window with either more ads or an aggressively blinking message saying: "A virus has been detected on your machine. Click here to download our antivirus programm. You have 60 seconds left before your firewall breaks!!!".
Also physically this device was on the edge of completely broken. The power supply had to be taped to the socket because it was so loose. Every little jiggle would immediatly shut the system down and Windows had to be completely reinstalled (which of course didn't solved any of the "software issues").
First I wanted to use that laptop to show some friends a new web project of mine but this thing probably would have DDoSed the shit out of my recently finished work or something.
I couldn't decide if I should laugh or cry...9 -
1. Buy a connected armwrist that tells you the time, how good your sleep is, your heartbeat and stuff like that
2. Manage to loose the cable that charges the device
3. Get mad
4. Finally decide to buy a new one after digging in your 50 m^2 flat in vain
5. Your stuff is coming in 12 years, I mean days. Have a lot of advertisement of this particular cable wherever you go for the next two weeks
6. The thing finally gets delivered. Let's not be stupid like before and put it in a logical place, like permanently plugged in the usb port above my computer tower.
7. Find the supposed lost cable at said place.3 -
Never loose your hope ..
.
.
because once upon a time javascript was used just for form validation and jquery animation.6 -
LISTEN UP! This is a robbery 🔫👺. We wanna harm no one. We're after devRant's 500++ - not yours. Your 500++ is protected by dfox. You're not gonna loose a stress ball. Think about your code. Don't try be a hero. Now shut up, and stay down. And this will be over in no time!9
-
At my first job, I got tired of having to type a user name and password every time I debugged the web application. Thinking I was clever, I put in a hack so that if you launched the application with the query string "?user=Administrator" it would log you in as the administrator. So much typing saved!
A couple days after the next release, I realized it shipped like that. In absolute horror, I walked into my boss' office, closed the door, and told him the tale of my mistake.
He just looked back at me, and after a moment or two said, "Loose lips sink ships."
And that was it.4 -
My biggest personal challenges as a dev are these two:
1. I tend to work too much (by choice), which impacts my personal spare time heavily.
2. I tend to not let loose of a problem until it is solved. This often results in longer work hours or me not taking brakes...4 -
Few weeks ago I was having a few beers and messing around with a Minimax AI that could be used for different games as long as you fed it possible moves and win/loose-conditions. Could be used for like Tic Tac Toe on a 5x5 field, connect four etc.
I hadn't got it to work yet as I tried to implement alpha-beta pruning to optimize it. When I was playing against it I thought "Damn you're stupid, why would you even make that move" but still finished the game.
Before I knew it I had fucking lost. It outplayed me like 6 moves before I even knew what was happening.
And that's one of the top coolest feelings I've had as a developer, got destroyed by my own program.3 -
Tried to switch to Manjaro from Ubuntu.
Everything good except ethernet not working.
3 hours wasted, updated the kernel, three network managers changed, realised that the ethernet wire was loose at the modem end.
FML.11 -
Don't apply for a job that you don't like. You're gonna hate your life.
Don't ask for a salary you know you're not worth.
Work in a tech company as much as possible. If you don't, you're gonna be treated as a powerpoint presentation expert, office installation expert, video editor/movie maker expert, IT support guy, loose plug/broken headset repairman, facebook hacker, and a dark magician all at once. Most (not all) tech companies know who you are better. They understand your needs better.7 -
Valve:
*makes good games*
*gets fame and money*
*sells other peoples games*
*announcing future games*
*stops making games*
*sells virtual items for a ridiculous high price*
*get sued for gambling in their games*
---
*getting criticized for not making games*
*people hope*
*devs and writers for their popular games leave*
*people loose hope*
---
*valve experimenting with VR*
*not making games for over 10 years*
*still calling themselves a game developer*
---
*valve buys successful indie game developer*
*valve claims they're making games again*rant hope dies last portal i don't like that valve cooperation valve news network in a nutshell half-life16 -
> me on call
> had to much wine
> suddenly, phone starts making sound
> holy shit, I am on call and I am not supposed to drink
> Calls taxi because shit is looking bad at work. Everything look down according to the sms I get, I had to pay the taxi from my own pocket.
> 40 min later, arrive at work. Walk into the serverroom.
> Go to the the server that is monitoring everything.
> Check networkcable, it is loose. Push it a little.
> Goddamnit, that was it.
> Realize I never doublechecked if stuff really was down from home....5 -
Eh ehe hehe he eh ehehe
On top of burnout, codebase issues, spec issues, burnout, the product butt that keeps on crapping, burnout, burnout, loathing for my employer... My local Apple SSL cert expired. I can’t finish this and push it anywhere for testing. I can’t even run my own specs anymore. And I don’t have permissions to make a new one. I can’t do anything at all.
Ehe he hehe
Deadline is in two days, and I’m just sitting here laughing quietly to myself. I might finally be going crazy
I found a loose bit of tangle, started to pull, and the world decided it was time to fall apart. Reality said it’s time to go. And I wasn’t even a good screwdriver dev. Byeee ~random root’s mind says no specs say no ssl says no ehehe sanity says no product says more more more! codebase says no screwdriver says no 🤪 reality says no burnout says no11 -
Today, I dropped my 5900x while cleaning the computer. It's dead. pins got bent and one pin got loose.
I feel like crying... please send prayers and thoughts.
R.I.P AMD Ryzen 9 5900X 5900x 12 Cores 24 Threads 70 MB Cache 3.7 GHz up to 4.8 GHz. You will be missed.16 -
Manager: How’s the progress coming along?
Dev: The section of code I’m working with is one of the more difficult ones so it’s a little slow
Manager: Ok well I didn’t write that section of the code
Dev: I’m not saying you did I’m just giving you the status update that you asked for
Manager: Ok well I can’t really do anything about that so how about you tell me something I can do something about instead of just complaining about code THAT I DIDN’T EVEN WRITE!! *Marks self as offline*
Dev: …10 -
On a tiny vacation in another country. Don't have a converter plug (for the power sockets) so borrowed one.
*connects laptop to charger* (old charger which might die soon)
*nothing happens*
*slight panic*
*tries different sockets*
*nothing*
😨😲😭
"you might want to check your phone with that thing as the socket seems loose as hell"
*tries phone with charger that definitely works*
*nothing*
😰🙌
That was a fucking panic attack right there 😅2 -
Lost half a work day because of an ISP outage. (Testing mailers doesn't work without a connection)
Turns out it was a loose cable on our modem that happened to coincide with the ISP outage elsewhere.
Ugh.1 -
Once crafted a beautifully executed use of Polymorphism with intuitive interfaces and classes with a concise and loose code just to watch my boss get rid of the interface , because it had no code in it, and fill the fucking code with an ugly switch statement to choose which class to instantiate.5
-
Does anyone else suddenly loose the ability to type properly as soon as someone is watching/pairing?7
-
I am on the fucking verge of throwing my coffee cup at a coworker.
I am sitting in an office with someone who has to vocalise everything that he thinks.
It started this morning, I was trying to solder the board on my headphones, because there was a cable that had come loose, and every fucking time that I start, some shithead phones, and then a few minutes later, he comes in and talks shit. Burnt myself.
Now I am trying to maintain some code, and every fucking time I start typing and getting into my code, the need to talk has to fucking arise. I have literally thrown the last 45 minutes out of the window because I cannot fucking concentrate. Nothing helps. Throwing a coffee cup will probably just inspire more to talk about.
Phenomenal, another motherfucker just came into my office and decided that it is decent to use the phone to phone his buddies.
Fuck this shit.10 -
So, my eyes have been bloodshot for a while now. It's been gradually getting worse. I've also had bags under my eyes for years.
Bit of info:
I'm soposed to wear glasses when I use my computer, or do anything up close for more than a few minutes because of some sort of focussing issue my eyes have. It's so that my eyes can stay at the same level of focus when I switch from short/long range.
Also, I don't spend all day on my computer and phone. So it's not like I'm constantly getting blinded by a screen. It's not unlike me to loose myself in thought, and pace around for hours on end. Some times in a day I will barely touch my Phone, and not even touch my PC.
That said, I'm going to do an experiment. I am going to cut out my Computer for three days, and reduce Phone usage to a minimal, and see if I can eradicate, or serverely reduce this redness. There could be something seriously wrong with my eyes, and I'd just be blaming screen fatigue. I've taken pictues of the current redness (which current blocks out half of the white of my eyes) and I'll use that as a reference.
Wish me luck!11 -
DevRant is the best. I just gave Imgur another try. It still makes me depressed and loose faith in humanity. All those stupid people. DevRant is much better. Here we have smart people that know how to approach problems and understand jokes.8
-
Fuck Firefox's CSS engine! Why is it so fucking buggy?
I needed to position some elements in a circle, so I used Math.cos(Math.PI / 2) to calculate their x positions. So, mathematically speaking, that should return 0, right? Turns out in JS it doesn't (because fuck precision). It actually returns 6.123233995736766e-17 and I was using that in the style, like top: offset + that.
In chrome it was working perfectly, but in Firefox all hell broke loose. All animations stopped working, scripts stopped working, demons were eating people alive.
And I lost hours hunting that down. My fault because I should have tested it immediately on other browsers, but fuck!11 -
PM ordered me to not use encryption for customer authentication links because we want to be able so send same link if the user loose it. "we have to prioritize usability over security". At least I can tell future hackers it's not my fault..10
-
So yesterday I said to my private laptop update and shutdown...
Fast forward to this morning. Hell breaks loose. Have to fix it asap! We have downtime. But fucking windows update!!!
You fucking peace of shit should have done this yesterday. And why does it have to take so long.11 -
Lemme be frank for a moment
Just because the compiler tells you that you need to do a certain thing, DOESN'T MEAN YOU SHOULD SEE THAT AS THE ONLY FUCKING SOLUTION
DON'T START FUCKING UP THE SINGLE-RESPONSIBILITY PATTERN JUST BECAUSE THE COMPILER SAYS YOU SHOULD, HOW DENSE MUST YOU BE TO THINK THAT'S THE FUCKING SOLUTION?! PERHAPS YOU SHOULD DIG A LITTLE BIT DEEPER? I CAN'T EVEN LAUGH ABOUT IT IT'S SO SAD. DEADLINE IS GETTING CLOSER DAMNIT
Oh btw, another instance:
"I'm doing X to achieve Y because I'm more familiar with step 1 of X"
Fine, but that takes more time and can be done in way Z, in that way, you don't loose precious time and can just work on the other steps in the proces that contineously get harder.
* Person proceeds to do X anyway and get stuck, in the end having nothing done *
🙄
I like helping people, I really do
But I'm not going to loosen the knot around your neck if you keep tightening it9 -
It was not me doing the screaming but one of my colleagues. He is a super programmer and joined our team early this year as my partner on frontend development.
We're a React/React Native dev house and he has always been uncomfortable with how loose it goes here because of dynamic typing. He has been advocating typescript and Angular since he started and I even allowed him to use typescript on one of the projects.
A month back I started to make jokes about how dead angular was (trigger alert) and he almost lost it. We are good friends so he as been taking it in good spirits.
Last week our boss allowed him a chance to propose a Tech stack for a new project. Naturally he started comparing Angular vs React. I chime in to trigger him again with "why would we work with a bloated zombie framework", he picked up his chair and almost threw it at me while screaming " React is just hacky ". I was laughing so hard and in the end we both did some research. We are proposing Jquery to our boss... (Evil laugh)1 -
Bout to loose my shit. Fucking hate it when clients push and push to launch the system as urgently as possible. Say they have run through the test version and understand what they are getting and sign it all off. Then come back 2am the day after launch and bitch and moan cause its missing features they thought where there when they weren't part of the original planning and always use the excuse "i have just bought a bunch of marketing, your loosing me money" or "I have an important even with important people that need this tomorrow" and try make it your fucking problem.
Firstly, fuck you
Secondaly, fuck you.
I cant even comprehend your lack of logic.5 -
So I just made a throwaway SO account because I had a 'risky' question and I don't wanna loose my 22 hard earned reputation points on my main account.
Maybe it's just me but I think it's very sad that asking a question on SO that doesn't get downvotes is so difficult.
Anyways, if anyone knows about UMDF drivers, here's the question: https://stackoverflow.com/q/...5 -
Hi hackers!
Just not sure about this one:
Is this true?
The closer i get to the router , the more packets i might be able to sniff.
And something else:
I might loose the traffic sent to the other APs while i'm close to one another.
Is there any way to capter all packets?
(I also have wired access to network but since the socket isolates the traffic let me know if there is any other method)
Thanks16 -
So I was interviewing at company X, through recruiter A. It all went well - one of the best feedbacks I have ever received actually, but then they went quiet for a bit... only to have the recruiter A call me about 3 days later and tell me that apparently the project they had planned to get me on, was a no go for a while and that they would contact me again within a month or so.
Meanwhile, recruiter B called me up and sent me to company Y and asked me what my situation was at other interviews. I said that I was interviewing at company X and that they came back to me and said the project is delayed and they'll contact me within a month or so.
Recruiter B starts a rant about how he hates when companies do that and that he, as a recruiter, would loose trust in that company if something like that happened.
And now company Y goes quiet for 2 days. Recruiter B calls me and says exactly the same thing.
So naturally, I say - "ah that's a shame, you must be loosing trust in company Y now."
He pauses and says - "Well umm"... another big pause. "I see what you mean, but umm..." another pause and this awkward silence.
"thanks", I said and I hung up. ¯\_(ツ)_/¯7 -
So the CEO called me down about a super urgent bug that needs to be fixed or we will loose several hundred thousand pounds of business.
I rush down to his office and there he has a graph "look the values are barely moving i would expect the values to be more erratic this time of day"
*i look at the graph*
"Errrr your looking at 02:00 in the morning, it's 14:00"
Boss: ahh good spot *looks at 14:00* yea that looks good, great job.5 -
Might be a loose interpretation of 'vacation', but I was running a marathon using my phone for tunes, when suddenly I got a call from my boss; our application server had died and he had no idea how to restart it. So while running the race I was timing my exhales to give him the step-by-step instructions for reset-to-restart. The good news is that the miles just flew by as he read the logs, and I responded with commands. Suddenly I was at mile 22 and was actually feeling pretty good; didn't finish the race with a PR but was happy with the result and did get the server back up.2
-
My manager wonders why I don't respond to people in a timely fashion.
I'm watching 83 Slack channels and private messages, I get 45 emails an hour, I'm on-call, and I have 125 servers to monitor.
Number of Jira tickets I received in the last 3 days? One single fucking ticket.
Open a damn ticket and I'll shove you to the bottom of the backlog, just like everybody else... I mean, I'll be able to track your request and not loose it.6 -
Anybody's a father here? My 10 months kid is giving me hard times waking at 2am and not going to sleep till 4am (it is 4 now, here). That's a really repeating problem. I'm loosing my focus at work, tired after few hours of coding, couldnt mange to learn after hours. Makes me frustrated. My PM understands situation (actually he have 5 kids!), tries to help. But can't figure it out how to overcome this. Any ideas fellow dads in code? To make it clear - I really love my son, but if I'll fail to keep my level at job I could loose it one day, don't feel like beeing able to find new decent job with current exhaust level. Also I'm the only one who makes money in our lil family, loosing job for too long means loosing the roof under the head for all three of us. My wife is barely living after beeing there for son whole day, so please dont point at her. Our kid is really demanding on attention and love, and thats like a sweet poison. Love kills.22
-
Think I am drinking an expired coffee.
Taste is a bit .. funny and loose.
Oh it might also be the ants. I found few ants in the sugar but I couldn't be bother removing them so I just poured coffee directly.
I should just stick to my energy drink or coke :311 -
Microsoft Teams can burn.
Who the fuck thought it would be an excellent workflow, when you want to COLLABORATE IN TEAMS between users in different domains, that each sorry bastard needs to manually log in to a second Teams tenant and loose all the context from their main Teams tenant !?
On random occasions the fucking authentication token expires. I send messages to my team mate in another domain. Three days later I am pissed off because they don't answer. It turns out their authentication token has expired so when they are on their main tenant they don't get any notifications before they manually log in to our tenant as a guest. HOW FUCKING GREAT IS THAT AS A NOTIFICATION SYSTEM ??!
Would it be that fucking difficult to maintain a notification bar with all tenants and note with an exclamation mark or something REALLY FUCKING SIMPLE to hint about an expired token ? It's not like this is magic, Slack does it already.
FUCK !7 -
My refresh button on my mouse is coming loose and is about to fall off, how dare this £11.99 mouse not last for upwards of three years, it's an outrage!
-
How to piss off a developer?
1) Make your SDK bundled with an IDE and provide no way to update only the SDK, forcing them to loose all of their IDE settings and customizations.
2) Make GNU tools bundled in the SDK that are compiled 10 years ago and haven't been updated.
3) Provide a Linux version of the SDK, but only save all files in Windows-style line endings.
4) Provide SDKs that introduce bugs and break builds.
5) ???
6) Profit!6 -
I miss old times rants...So i guess, here it goes mine:
Tomorrow is the day of the first demo to our client of a "forward-looking project" which is totally fucked up, because our "Technical Quality Assurance" - basically a developer from the '90-s, who gained the position by "he is a good guy from my last company where we worked together on sum old legacy project...".
He fucked up our marvellous, loose coupling, publish/subscribe microservice architecture, which was meant to replace an old, un-maintainable enormous monolitch app. Basically we have to replace some old-ass db stored functions.
Everyone was on our side, even the sysadmins were on our side, and he just walked in the conversation, and said: No, i don't like it, 'cause it's not clear how it would even work... Make it an RPC without loose coupling with the good-old common lib pattern, which made it now (it's the 4th 2 week/sprint, and it is a dependency hell). I could go on day and night about his "awesome ideas", and all the lovely e-mails and pull request comments... But back to business
So tomorrow is the demo. The client side project manager accidentally invited EVERYONE to this, even fucking CIO, legal department, all the designers... so yeah... pretty nice couple of swallowed company...
Today was a day, when my lead colleague just simply stayed home, to be more productive, our companys project manager had to work on other prjects, and can't help, and all the 3 other prject members were thinking it is important to interrupt me frequently...
I have to install our projects which is not even had a heart beat... not even on developer machines. Ok it is not a reeeeaaally big thing, but it is 6 MS from which 2 not even building because of tight coupling fucktard bitch..., But ok, i mean, i do my best, and make it work for the first time ever... I worked like 10 ours, just on the first fucking app to build, and deploy, run on the server, connect to db and rabbit mq... 10 FUCKING HOURS!!! (sorry, i mean) and it all was about 1, i mean ONE FUCKING LINE!
Let me explain: spring boot amqp with SSL was never tested before this time. I searched everything i could tought about, what could cause "Connection reset"... Yeah... not so helpful error message... I even have to "hack" into the demo server to test the keystore-truststore at localhost... and all the fucking configs, user names, urls, everything was correct... But one fucking line was missing...
EXCEPT ONE FUCKING LINE:
spring.rabbitmq.ssl.enabled=false # Whether to enable SSL support.
This little bitch took me 6 hours to figure out...so please guys, learn from my fault and check the spring boot appendix for default application properties, if everything is correct, but it is not working...
And of course, if you want SSL then ENABLE it...
spring.rabbitmq.ssl.enabled=true
BTW i really miss those old rants from angry devs, and i hope someone will smile on my fucking torturerant marshall_mathers worklife sugar-free_tateless_cake_decorant_figure_boss missolddays oldtimes_rants5 -
Anyone else suffer from this.
Have a brilliant idea, start computer, open you IDE, write a few lines of code as proof of concept and then just loose interests coz it's no longer a challenge !6 -
>Be me
>Loose job just before Covid started its crap
>About to get new job
>"We'll be in contact after the lock down"
>Fuuuuuuu.jpeg
>Months later, country starts open up little
>Starting to look more proactively again
>Company from before "no positions atm"
>Really liked that place, so Fuuuuuuu.jpeg again
>Talking to recruiter, they have something in mind
> Need assessment. Understandable
>They send a separate assessment for every single language on my CV and the cake thief thing
>NotImpressedMikalya.jpeg2 -
My worst bad practice:
Saving my Linux Root SSH Keys on a Cloud Storage company.
Have them there, so I wont loose them ever. I password protected them, but you never know what the NSA/FBI/CIA can do 😉1 -
Storm: No internet for you!
Me: *switches to 4G cellular data which seems to be mostly unaffected* Take that weather!
Storm: *all hell breaks loose outside*
Me: mkay... Going to bed anyway...3 -
Let me just get right down to it.
FUCK YOU Hewlett-fucking-Packard FOR YOUR SHITTY LAPTOPS! Don't you even keep your customer's needs in mind when you design these things? Besides all the bloatware you stuff into the Windows you ship it with, at least make the quality of your shit better. These flimsy screens and loose hinges, I've had to get that shit replaced multiple times in just the past year.
Want to upgrade to an SSD or plug in more RAM? Guess what! I've to tear the whole thing apart! Keyboard, palm rest, all if it! What even happened to just popping a cover at the bottom to swap out the hard drive!? I have to fucking congratulate you, you fucking cunts, for making an easy process as difficult as it can fuckin possibly get. You guys deserve an award for this, preferably presented to you, shoved up your asses.10 -
PSA to /[devs who things it's a good idea|management who thinks it's a good idea to force your devs]+/g:
There currently exists 1543 (and counting) top level domains. My email addresses follow the pattern: /^[a-z]+@panduro\.guru$/ and I die a little inside whenever I get told my email addresses aren't valid because you thought it was a good idea (to force your devs) to hardcode "valid" top level domains. There is a reason why the filter for input type email does not include top level domains.
And you can't even begin to comprehend how mildly annoyed I get when I message their support and tell them what the problem is (because I'm nice enough to do that) they instead of telling me "thanks for informing us we'll look into it" they tell me "well just get a gmail or something". I should not have to order social status reducing items with my school mail (especially not since I'll loose that email ¾ pairs of years)7 -
Java. AGAIN. 😡
so, I am trying to get a csv opened and read, and then search through it based on values. Easy peasy lemon squeezy in python, right?
Well, damned be java. You need a buffered reader to read the file. Then you have to "while(has next)" the whole damn thing, then you have to do something with the data that you read one by one, right? Well, not to be disappointed, they do have json libraries, but you **have to install** the plugins for it. Aka you have to manually add the libraries or use some backwards manager like maven.
Gotta admit, jdbc is neat if you're anal about your sql statements, but bring the same jazz to csv, and all the hell will break loose.
Now, if you just read your json data into multiple objects and throw them in an array... Kiss shorthand search's ass goodbye, because this mofo can't search through lists without licking the arse of every object. And now, you have to find another way because this way, you can't group shit you just read from csv. (or, I haven't found a way after 5 hours of dealing with the godforsaken shitshow that java libraries are.)
Like, I'm devastated. If this rant doesn't make much sense to you, blame some java library for it.
Shouldn't be too hard.24 -
"UPDATE table SET field = 1"
Neglected to include "WHERE ClientId = XXX"
1800 users loose access to thier software in the middle of the day
Restored in 10 minutes thanks to disaster recovery policy.3 -
So salty. Just got off from a long day at work with my coworkers after a significant sprint, so we all go to karaoke to celebrate and let loose. But naturally I have to be under 21, and the karaoke place cards, so I end up taking an Uber home by myself, which felt really fucking embarrassing. I wish there were venues in the city that didn't require you to be above the magical number of 21 years of age to have a good time.5
-
Leave company loyalty in the 1950s where it belongs. A job will cut you loose at the first sign of trouble! 🚨3
-
Software Engg here, applying for PhD after working 2 yrs @top5 giants.
Everyone is saying, without any "research experience", I stand ZERO chance of admission.
So, I'm expected to leave my 7 figure job, be someone's bitch for 6m to get a paper , and then maybe, JUST maybe I will be eligible for admission. WHY CAN'T I JUST LEARN IN THE 1ST YEAR OF PhD ?
STUPID MOTHERFUCKERS FROM ALL OVER THE WORLD GET INTO PhD ALL THE TIME. EVEN SOMEONE WHO CANT CODE FIBONACCI USING DP, GETS IN BY SHOWING FAKE RECO LETTERS(CASH), HIGH GPA (GATHERED BY LICKING EVERY TEACHER'S ASS), AND "RESEARCH EXPERIENCE" FROM PRIVATE UNIVERSITY BECAUSE THEY ARE TOOOO DUMB TO GEY INTO GOVT UNIVERSITY . (Seen myself)
I SWEAR TO GOD, IF I Don't get into PhD, this year, I'll probably loose my shit.10 -
I need to stop finishing my sprints work within the first 3-4 days of the sprint.
I get so excited to get work that I loose my sense of time and space so I finish it all in one go...
Now I’m gonna be bored again for 2-3 weeks 😫8 -
I'm a teacher myself (for basic Html/css/js and sql 101) and there's nothing like the feeling of seeing your pupils progress. Makes me warm inside everytime :3
As a student though, i remember a friend of mine used minecraft and redstone for a logic circuits course. The teacher, which i guess wanted to show himself, was like "Yeaaah right redstone, i was doing that 20 years ago ...". How to loose credibility 1018 -
Something that really annoys me is when people abuse the lax semicolon rules in JavaScript. Personally I believe semicolons should be a standard and always used in a language like JavaScript, and while the loose rule on semicolons may be considered convenient when one is forgotten every now and then, it is /not/ meant to be abused and semicolons completely unused. It's particularly annoying when I have to work on a group repo at work and the standard is to not use semicolons. JavaScript to me is much more similar to a C style language than something like Python, so even though the language is built to be loose and easy conventions such as bracket scoping and semicolons should be kept and practiced.4
-
Love it when testers loose there shit and take loads of screenshots, arrows everywhere, the lot...
But no explanation of what they are actually trying to show.
😂 -
I loose it big time when developers in my team say "it's not working" and don't even care to explain what is not working and what were you trying to do....2
-
This.
Not the worst but almost all of us (including me) handle strings like fucking morons.
If the input doesn't need to be an exact match we use a explicit comparison operator, when the input should explicitly match we do a loose comparison operator.
I'll format the crap out of a number, convert it, validate decimal places, check for float rounding hell, give it a absolute value and return it correctly formatted for the users locale but half the time I forget to trim their input. 🤦♂
Like I said - just a tad fucking moronic isn't it?3 -
I’m so fucking sick and tired of !devs telling me how simple a feature should be to implement.
Like motherfucker the most complicated thing you’ve ever done with a computer is attempt (and fail) at working with tables in Microsoft Word and you’re trying to tell me how long a new feature/K8s architecture/noSQL aggregation should take to implement?
A monitor cable wiggling loose paralyses you for hours but I’m supposed to bow down to your understanding of what is causing a bug?6 -
Another day, another job description
# Benefits
- Flexible work hours
: You'll be coding to midnight
- Ability to work from home some days
: But watch out for those other days..
- Our office space provides free coffee, beer and soft drinks as well as an amazing modern workspace
: Our tax expense will get you gee'd up and tipsy til you loose track of time. (Future diabetes health insurance not included).
- Growth and future progression opportunity
: Pinky promise!
- Receive valuable company equity
: Plus a set of steak knives for four easy payments
- Latest MacBook Pro
: We own this. We own the thoughts you have while looking at this. Plese think many thoughts.6 -
Had an intern go configure a bunch of workstations for our employees over the summer - we gave him a checklist and let him loose.
Several months later... Try to support a user with their workstation and find out that $software isn't installed on said workstation. Check other workstations. No $software on any of them.
Ask intern "did you follow the checklist we gave you??!"
Intern: "Yeah, I followed it."
Ask intern: "So why is $software not installed on the workstations?"
Intern: "Oh I didn't have a copy of $software so I skipped that step."
What.
So he's probably getting shitcanned soon...7 -
[Warning! - Sob story ahead, you've been warned]
Dear devRant,
today someone who interviewed me in the last days, said they want to hire me.
Good news, right?
Professionally speaking yes, but... i don't know.
I always been a freelance: never had much work, but i was always free of doing whatever i liked and whenever (no fixed working hours).
I have a room in an office with 2 other people. People i love to hate (it's complicated).
But now i'm thinking about this new work they are offering me: no more freelance, no office, no flexibility. All with a 6 months contract.
What really scares me is that i will lose what i have... even the 2 co-workers that i hate/love: i have never been able to make friends, they are the thing that comes closer to friends in my life.
I'm feeling a void in front of me:
being an adult (35 years old...) and choose a work that pays, but loose... essentially what i am, what i have hardly build...
OR decline the job, and going on "Peter-Pan-style", living at my pace: free but constantly hoping of something good to happen to me
I don't know, really don't know... so many feeling are overwhelming me now.
And tomorrow i have to make a decision5 -
Boss activates encryption on dashboard
we installed the software
2 machines get locked out coz drive got encrypted with bitlocker
No one received the 48 bit key from bitlocker
I loose all my work coz the only way to use my laptop was to format the drive
Me as the technical guy and knowing how encryption works i just formatted the drive
Boss blames me for the cluster fuck8 -
Alright, so I am going to start doing dev streams
twitch.tv/retraxa
I am going to stream with @ewpratten at some point tonight. Were gonna be working on robot code and my personal website. I have literally 0 reputation on Twitch so if this doesn't work out I can't really loose. If y'all wanna stop by and give us some stuff to converse about, cool articles or extreme politics and our belief systems go ahead.6 -
I mean, I really, really like Linux, don't get me wrong but I don't know if it's my Pi or something I've done but I've always gotten issues with it after a few weeks/months.
Everything will flow smoothly until it crashes, and it won't start the x server, and pretty much everything tells me there is a segmentation fault. A fresh install fixes the issue but I also loose all the stuff I've done with my previous install. Really annoying and I haven't found a definitive answer as to why this happens.
Oh well.7 -
Crazy... Hm, that could qualify for a *lot*.
Craziest. Probably misusage or rather "brain damaged" knowledge about HTTP.
I've seen a lot of wild things when devs start poking standards, but the tip of the iceberg was someone trying to use UTF-8 in headers...
You might have guessed it - German umlauts. :(
Coz yeah. Fucktard loved writing everything in german, so why not write custom header names in german.
The fun thing is: It *can* work, though the usual sane thing is to keep it in ASCII range for the obvious reason that using UTF-8 (or ISO-8859-1, which is *not* ASCII) is a gamble you gonna loose.
The fun game was that after putting in a much needed load balancer between services for monitoring / scaling etc suddenly *something* seemed off.
It took me 2 days and a lot of Wireshark hoola hooping to find out why, cause the header was used for device detection aka wether it's a bot or not. Or in the german term the dev used: "Geräte-Art".
As the fallback was to assume a bot, but only rate limit based on IP, only few managed to achieve the necessary rate limit to get blocked.
So when I say *something* seemed off, I really mean a spooky kind of "sometimes IP blocked for seemingly no reason at all".
Fun stuff. The dev btw germanized everything. Untangling the code base was a lot of non fun. -.-6 -
I quit smoking yesterday.
By a coincidence I had a pack of cigarettes named “Kresty” – the brand from russian prison.
Just gave it to Stephen Paul Taylor. There’s no reason to smoke again, just don’t want to loose this kind of story.4 -
Took notes in a meeting few weeks ago about things left to do. Now I can't read my own fucking notes cuz handwriting looks like ants with dirty feet were let loose on the paper.
Welp, FML.8 -
!dev
i made some dice for displaying health, when playing Magic the Gathering.
They're not exactly fair, but you also don't roll them. I ordered the numbers in a way, so whenever you loose or gain health, you don't need to look for the next/previous number, since it's always nearby.
They're made using a resin printer and painted with oil based lacquer.8 -
I tried so hard and debugged so far
But in the end it didn't even matter
As I rewrote function call to loose it all!1 -
100,000$ budget for a website that mixes all YouTube, Facebook and Twitter features as per today.
The guy has a lot money to loose. I don't have enough time for this shit.6 -
Fuck. The entire day to do this shit.
The screen was my first experiment, but because of a bad module (i2c) it didn't worked.
Today I finnaly got it to work.
Starting making everything almost like in the picture, everything mounted (and lots of black hot glue, no wires showing...
Didn't work.
One hour breaking everything apart without damaging the screen... Was a loose wire.
Started again... Didn't work...
The pot is also damaged, sometimes it works, others need to turn it hard.
New pot.
New set of wires.
Soldering everything right, testing all wires so no mistakes this time... But it takes so longgggg... Making everything in modules this time (to reuse without having to sordering again. And finally... It works.
By this time I should have 3 or 4 learning projects finish (I really wanted the screen to adapt all output in text, no serial, no blinking less, everything in modules, code prepared so, when I get my 40+ packages from China I already have a prototype tester ready.
10 hours... Fuck I'm really addicted, or else I would just solder everything together :D28 -
So my coworker is gonna change computer and for the past two weeks is "annoying" me to install Ubuntu for her...
Look ... I'm a dev just like you... Get your shit together and do it yourself or wait.
So Wednesday I gave her the task to backup her shit because I'm gonna do it today... Guess what she told me? That I'm better at it and if I could do do for her...
Sure.. Yeah... Gonna rsync your /home/user folder to the new machine and fuck you if you loose anything, that's not my fucking job you useless piece of shit.2 -
As you guys may or may not know (or may or may not give a fuck), I'm currently part-time studying to get a diploma and get the fuck out of my country. Since I have to write a 40-pages long "end of study dissertation" about something we personnaly have interest in, I decided to teach myself about DevOps.
In order to prepare it, I decided to get a Raspberry Pi, install Docker and Jenkins (as a container) on it, and handle my multiples websites on it, and build a huge fucking website around which I would write my dissertation about.
But man, I'm starting to loose hope, I get to bed at 2 AM every night because I'm trying to make some basic shit work until I realize that I just CAN'T what I want because of tons of reason, so I try to lower my expectations, and it's frustrating. Yesterday, a Ruby on Rails image I created was perfectly working, tonight MySQL throws an "host not authorized for this mysql server" error, and I don't know what the fuck is happening nor if I can do anything about it.
I love teaching myself new stuff, but I have to admit, it's waaay harder than I expected2 -
Serious question here...
I understand alot of devs have had some pretty rough times but things aren't going too flash for me.
I personally know I'm just having a tough patch when it comes to luck but everything is just building up and up to the point it's effecting my personal life and even programming isn't helping...
Normally I will just build something completely random and not related to any 'main' project I have but now everytime I fire up the IDE I just loose all motivation and care for programming...
Just want to know if anyone can sort of recommend anything to just help me get back to working on shit and be sort of myself again and not this mopey me...12 -
When you loose 15 minutes looking at why "padding: O;" isn't working... it's time for bed.
...
Yes that's the letter 'O' instead of a number '0'.8 -
Trying to work with an API that has no response object (it just returns empty arrays if something breaks) and it's JSON is not key-value.. just a bunch of dynamic nested values. just wow.3
-
So... Had a burn out cause of overwork...
One of the bosses treats me like shit cause my education stops me to reply at his low level...
Had enough...
One white hair to make a complaint...
In Portugal if someone makes a complaint to the authorities the company gets a full inspection... I'm sad cause I love the owners... And they will loose most certificates... And that's lots, lots of money from a company that works with porche, ferrari, audi....10 -
Check out LSD microdosing guys.
Sober or coffeeinated I used to loose context everytime I put down my headphones to get refreshment or have a piss. With 10-20 mcg of LSD after breakfast my thoughts tend t stick a lot better.
There's an interview on the web with a Cisco hardware engineer describing his experiences. The subreddit /r/microdosing also provides a good start.13 -
My file structure:
Documents -
- That one impeccably structured folder that I never remember to put anything in
- Gigantic project folder that will some day kill me in my sleep
- That one unrelated folder that all of my non project scripts just end up in. No structure whatsoever
- about 2 billion loose files5 -
Student dev : "C++ is C but with OOP features"
Teacher dev : "C++ is a OOP language, you'll loose points if you don't use OOP"
Me: "Time to leave this school"3 -
Rant?
So... I've been to the doctor's, I have a high blood pressure (I'm only 30 ffs).
She says I'm too grumpy, over thinking and should loose weight.
FML I'm gonna die young... At least the wife will get my life insurance...17 -
File hosting like GitHub?
Basically.. I want to let my Patreons download major updates to my game before I upload them to Github. Now, I will get a GitHub Developer upgrade once I get $7+ per month from Patreon, and host the updates on a private repository for a few days before uploading it to my main dev repository, but I something until then. Some place I can host the loose files, or a .zip at a static link for free. (that can only be accessed by that link) ^~^12 -
Goals for 2018
Finish all my udemy courses I purchased back in 2016 and never watched
Learn to write tests for all my work
Figure out the shitty api in Drupal 8
Redesign my apps so they look pretty and make me more money.
Learn to Automate my app feeds
Redesign my company website to look more professional
Sell my townhouse
Start running again
Loose weight
Be a better husband and father.
Learn new tech and make something fucking awesome!
Go to tech Meetups
Hang around smart people and learn to be a better coder.
Battle my demons and autism.2 -
My favourite dev tool? I would't be able to do my work without any tool, which's in the list. I love IntelliJ IDEA & Webstorm, Java, JavaFX, Maven, Git & Gitlab, TeamCity, Upsource, YouTrack, Artifactory, wtf that list's kinda the complete tech stack. But I completly hate AWT & Swing (AWT fucks up on my Linux install, such a frame creates in about 10-20 seconds, if you test the app locally, you loose approximately 15 seconds per minute, and Swing uses AWT internally too), I hate Gradle (screw Google for standardizing it), and so on. Wow that's like my complete tech stack, what the fuck happend? The question was one tool, help me.1
-
Oh my god, this client. Everything is equally important. When finishing a feature halfway, a new future gets priority. Nothing is finished, this whole app is a bunch of loose ends. FML.3
-
My macbook base is missing four screws (I'd upgraded a few weeks ago...and I lost the screws) and now the base is all loose and wobbly :@2
-
I am a little bit old fadhioned when it comes to new dev tech stuff. I am at first, not an early adopter ( others should proof it first) and second I like to read books. If there is someone who has understood the matter and has written a book, then I go for it 😁 and third, when I have to use an early technology then the simplest thing is to read the doc to get a grasp what this is all about. Youtube as others describes is lame, because if you are forced to watch 40min when you are just interested in one small thing, you will loose a lot of time finding the relevant piece of content..
Positive on reading is, that you have to think for yourself!1 -
Somewhere in the svalbard vault where github buried all our code is about two hundred megabytes of pictures of my ass and other pornography stenographically hidden in innocous pictures hosted on github. Why? Because I can.
I did the same thing with stock photography back when I used to be a photographer. If you've used pixabay or a dozen other stock sites theres a good chance you've unwittingly looked at my magnificently sculpted ass (and other parts of me).
Future shenanigans include massive (and unsolicited) deliveries of half finished dildos (courtesy of dildo factory dumpster rejects), public accesible blue tooth speakers put in inaccesible spots, deepfakes of opposing politicians banging uglies, public book burnings not because we hate books but because who the fuck reads anymore?
And orgies, lots of orgies.
Its the end of the world. Let loose with the craziness and party.6 -
Around 6 years ago I started at this company. I was really excited, I read all their docs then I started coding. At every code review, I noticed something was a little off. I seemed to get lots of weird nitpicking about code styling. It was strange, I was using a linter, I read their rules but basically every review was filled with random comments. About 3 months in I noticed, "oh! there aren't actually any rules, people are debating them in my code reviews!" A few more reviews went by and then I commented, "ya I'm not doing any of this, code review isn't a place to have philosophical debates." All hell broke loose! I got a few pissed off developers, and I said, listen I don't care what the rules are, you just need to clearly fucking articulate them and if you want to introduce one, I don't care about that either just don't do it in the middle of my review. I pissed off 1 dev real bad. Me and this dev were working together, the QA person on the team stood up and said "hey! you know what I love about your code reviews?!" The other dev and myself looked at each other kind of nervously, "I love that you're both right, these are all problems!"... 1 year later (and until now) me and the other dev are still friends. Leave it to QA to properly identify the bug.
-
I run update without where on mysql console on production database Today.
CLASSIC
Just because I needed to fix database after bug fix on the backend of the application.
I thought I wrote good sql statement after executing it on my local machine and then everything got bad.
Luckily it was only one column with some cached statistics data and I checked that it was not important data before I actually started fixing stuff but still ...
Almost got hard attack afterwards.
Made a script to fix this column and it took me only 15 minutes but still...
Bug was caused in part I got no unit tests and application grow after 3 years of development from simple one for one customer and volumes of documents around 50k to over 40 customers and volumes over 2mil per month, don’t know how many pages each, just in one year after we completed all needed features.
I have daily backups and logs of every api operation but still.
I think this got to far for one backend developer.
I got scared that I will loose money cause I am contractor and the only backend developer working on it.
I am so tired of this right now I think I need a break from work.
Responsibility is killing me so hard right now.
It will take a week to get back to normal.2 -
Used sails js for production
Worst decision in my life made me loose 1500$
Fuxking shuld have used laravel....8 -
I was flash developer once, it was great when macromedia was around, then adobe acquired them, now flash is gone.
Years are passing and most of industry is the same as always. Trying to drag you into this rat race of learning new amazing technologies, amazing projects that are actually doing same job as 50 years ago but using more memory and cpu cycles. Because all has it’s roots in algorithms from previous centuries.
So youngsters loose your best life time, be innovative by doing nothing more then copy paste from stackoverflow and duck typing shitty code.
Be a slave and sit in the amazing office, that has everything but not your real life that meanwhile is sucked by corporate squeezer till your last breath.
Be piece of shit that can be kicked around.
Watch youtube, facebook, instagram or whatever social network that shows you pictures that are fooling your mind that you’re someone special and you need this stuff.
Then be ready to suck some dicks to earn money and buy stuff you don’t need, live where you don’t want and do what you don’t like. You piece of shit.
Well that’s what disappoints me from my tech stack.
Now chill out, turn off your electronic gadgets, go out and enjoy real world.1 -
story - u get a new job, u really like the boss and work env, have been assigned a v ambitious project.. which involves v critical deploy control, data backfills and multiple level of integrations, takes 2 quarters to complete, in the mean time ur fav boss left for a better job and new boss doesn’t seems to understand the gravity of the project and thinks u r just sitting there twinkling fingers...anyways fast forward to d-day : deploys go fine everything working great... time to run some post deploy scripts for some data consistency, a single change to another piece of code done by some one else 2 days back triggers an additional logic and damn suddenly the app users loose ownership to part of the data they owned... u run history reports, do data loads to assign them back, some data errors out, u r about to manually set that up - u drop ur laptop from ur table and it refuses to restart - and all the Prep data is gone and all the scripts are gone and it’s a weekend so no IT Sypport... u r without a laptop for next 24 hours... the struggle continues... next update on Monday1
-
How to clear the lunch of developers: Shout as loud as you can from the office that ZEPTO is loose on the network drives and watch everyone scramble to their computer.
Actually happened at work today, somehow the boss let it in. To top it off, we had customers in the house that watched the whole thing happen.
It wasn't pretty.1 -
TL;DR
I signed in at a few sites like freelancer.com , you did it you understand this nightmarish post.
for every fucking job, there was a full team of fucking lowcostshitters that took it for 0,50 $ . When I say this number, I mean it literally.
Translations
Data Entry
Ios app
Android app
Java
Python
Websites
Games
Scripts
System Manager
DB creation
Porting
...
And if you think this was the only nightmarish thing, you have to check the jobs descriptions and their spec.
You'll loose your sleep for sure.2 -
I've never been a frontend guy, I only could modify existing FE code and had some clues about how to write a hello-world using angular.
I've just refactored ~150 files in an Angular project, created half a dozen new modules and modularized lots of loose artefacts.
And after recompiling the project still works! And is now more maintainable!
I think I now can safely add "Angular" to my resume :)
P.S. Damn it, Angular is cool!!!9 -
Let’s play a programmer game. Every time you see a missing semicolon in JavaScript take a shot of coffee.8
-
Just wanted to share about what just happened today.
So I graduated with a CS degree 2 years in EU and since then worked in two companies for a year in each of them, where I was paid 18k EUR gross salary in both of my jobs.
Just today I accepted an offer in Sweden for 48K eur/year and they will help be with relocation!
I am extremely happy and starting my new position in 6 weeks. Going to exercise, try to loose some weight and get better clothes, just to look sharp! Also going to sharpen up my skills as well as have 2 weeks holiday before I start.
Morever I will maintain my current job as a contractor where they will pay me 27EUR/hour so every month I will get 50-100 hours of extra work. I just hope that I will be able to balance main job+contractor job+side projects. I know it wont be easy but I wont be in a relationship so it should be manageable!3 -
Sorta related to previous rant
https://devrant.com/rants/2961085/...
Get message from recruiter on LinkedIn around 10 last night "Are you available immediately? I need a Java dev urgently based in [my city]. Please to [email address]"
I reply, send email, accept connect request
See the post they made about position , literally says "Apply today, interview tomorrow, start Monday"
I could really do with this. Made sure to be up and about by 9 in case phone rings/to reply promptly
Hear nothing back. Check in around mid day "Yes, I got your CV. My emails have been flooded. Will get to it asap" Well, that was yesterday, still nada
Linked post is about other challenges in my job hunt with a different recruiter2 -
I love programming drunk! I can't sit still and always want to do stuff. When I'm drunk / tipsy I come up with ideas and start working on it. Most of the time in the morning, when my mind is clear, I'm not so creative and open minded as I'm drunk. Sometimes my ideas ain't that bad, but I loose interest in developing it any further. So I stop working on it.
This is a while == true loop -
Oh my god, I'm basically at the verge of self-destruction! I've been trying all day to set up a simple Node server with react, but it's never that easy, is it? You need Babel to transpile ES6 + JSX to ES5, and then you need Webpack for god knows what reasons, and there are so man configuration files and options, and there are 1000 tutorials with 1001 ways to do something. I've created probably 20 new project because when I complete a tutorial and try to do something on my own, all hell is loose and I get some cryptic error message and am unable to ever get it to work. Holy cow, I need a drink... Am I just a retard? Greetings from Norway, by the way!7
-
Got a promotion and had a loose definition of what my new tasks were. I got overwhelmed with being the go-to for project and account managers, and 75% of our devs, on top of my own work I had to complete for clients.
Eventually I wrote up a 2 page document of things I had to deal with daily/weekly and how I don't have time to do my work, so why should I even bother to do it.
We got it resolved, my boss took some of the tasks off my plate (like training the new hires) and allows me to work from home whenever I need to finish up work.1 -
MOBBING DICTIONARY - 2 -
Sentence
(behind the back)
- he/she has no time, don't tell him/her these problems, don't speak with him/her, just speak with me
(explicitly)
- you have no time do this!. Let me/somebody else do it.
Purpose
- cutting the target out from the rest of the team. Redirect all communication in order to shield the target.
Result
He/she will loose the general vision. He/she will not understand anymore what the problems are. He/she will loose relevance and will not be able to manage his/her own time anymore.
He/she is probably working a lot, and doing a lot of effort. He/she will probably know how to use the time, and he/she needs the team to help with task no take the task out of him/her.
He/she will slowly burn out, specially if he/she discover that such things are happening behind his/her back.
The situation will add psychological problems to technical problems. He/she will be crushed to death.5 -
I got a contract with this schools to build a student portal,
I do all the needful and the project whatever guy insists that I use their current shared hosting to host this MERN stack application.
first of all, cPanel is my least favorite place when it comes to deploying, I actually dont do deploying I just hand it over to whoever is the IT guy there.
I discovered there's no provision for nodejs in their current plan, I go through all the stress of contacting the shitty customer support and the process of squeezing out useful information from them.
I'm only doing this because the project whatever has refused to pay me until their site is deployed. throughout the process of creating this project I had setup continous deployment on heroku and netlify and I had to beg this guy to look at the changes and review them.
well, today I asked the former guy that built the current site for the login details to the schools dashboard on the hosting providers site and he says he used his personal details for it, according to him projects from other organizations are there too.
I swear I'm going to loose my shit, freelancing sucks3 -
!rant, throw everything away
When you spend 9 hour at work, 2 hours in that fucking exploded bus, tries to spend time with friends and family, spend enough time with that one special person, try to sleep descently and manage to work on your personal projects during that two hours in the bus, and that each day, each week, the whole year.
You need a lot of motivation!
But when today I loose two months of work because of a hardware problem and that (because I don't have internet in the bus) I didn't backup on GitHub , I just have lost all motivation and will!
I just can't anymore!
FML5 -
WRITING CODE ON PAPER...smh
I know many people wrote about this already, but writing code on paper is one of the worst things of a CS class. I’d rather get a computer with no internet access and use a notes app to write code instead of having to write everything by hand. It takes so much more time that you could spend thinking about the problem. Not only that but also my hand gets tired of writing...ughhhh
I need to convince my teacher and the school to switch to writing code on computers! I will not loose this battle ahah8 -
I'm a developer, member of the A-Team. Actually I'm the leader of the A-Team.
We are incredibly skilled. Our problem solving capabilities is amazing, almost 100 times more effective than the rest of people. We produce code 10 times faster and better than anybody else. We have THE knowledge.
We can save the company in case of emergency.
For that reason, it's of paramount importance to nurture and protect the A-Team.
- When there is a bug, A-Team will not correct it. Because, if A-Team is busy, and bad shit happens, the company could be destroyed and we couldn't help
- When there is some important features to develop with a deadline, A-Team will not participate: A-Team must stay alert and ready in case of emergency
- If huge catastrophe happens and long hours, night and weekend are needed to fix it, A-Team will not risk burning the A-Team because it's the only high skilled team we have. The company cannot afford to have an A-Team member exhausted, underpaid, unhappy leaving or sleepy. Therefore, the company will sacrifice other less important people.
A-Team is company biggest asset and must be protected in any kind of situations.
The company should also pay training for them in order to increase their skills and make them unreplaceable.
These are my conditions. I'm the leader of the A-Team. You can't afford to loose me.7 -
@Gilles had a similar rant and reminded me of a story...
As a kid I learned QBasic. Moved to VB5 and later VB6. Because of this 'knowledge', I was the one who had to maintain legacy applications at my previous job. All of those applications were in use at various banks. On first work day in 2011 all hell broke loose - no date input control would accept the date anymore. I quickly discovered that the max year on date inputs was set to 2010. Later, I was told that nobody expected these applications would still be used in 2010 so they entered it as a distant future number. The funny part was that one bank was still running apps written in VB3 and I had to go back to basics. Didn't even know how to edit basic controls in that interface :D
Good times :)1 -
So I finished a contract (developing some webapp for a ministry in a foreign country). Well that's done. And they have the code and the fully built package that they just need to upload to a webserver.
Then I still get mails 'we were not able to deploy, plz fix your stuff!' without more detail.
Sometimes I loose all my faith in my fellow developers over there. Wow.1 -
A close friend of mine and i talked a while back and it went a little like this.
friend - "You like programming right"?
me - "Yeah"
friend - "I got a great idea"
She never really told me what the whole idea is. She said its easier to explain face to face but i can guess it's dev related.
But here's the issue. I have a tendence to just suddenly loose all motivation for a project (look at my github) and i'm afraid that i'll loose motivation for the thing she wants to do with me and i'll disappoint her.
Do i help her with her idea or not?
Keep in mind that i'm not a actual dev. Its just kinda my hobby. I can do it for free. Thats not the problem.7 -
!rant
Just an observation.
According to Stackoverflow's survey, it suggests that developers with more experience are less competitive. I still can't understand this. How can developers loose their interest over time?18 -
Today, a few thousand dollars of potential equipment being replaced was prevented by deciding to follow the network cords and finding out that the switchboard had the power cord knocked loose.
Payment was in candy.3 -
That feeling when you spend 2 hours debugging circuit + code, to find out that the arduino had gone loose in the breadboard...1
-
I've lived in this apartment for four years.
Tomorrow I'm moving out.
I've never ever lost my keys.
But today, the day before I'm moving out,
I LOOSE MY FUCKING KEYS!?!!?
What the actual fuck is this? If there is a god, which I'm quite sure there is not, fuck you!15 -
Love my mother to death. But whenever she asks for help such as how do you save a word file, and where to find it - I loose it.
-
One of our servers had a disk fail this week. Luckily it's 1 of 3 in a RAID5 array. And, luckily, it was our mostly-dev box and didn't have any production stuff on it, except for some support things. We scheduled a disk replacement with the hosting company, took everything down, waited. Somebody at the hosting company apparently didn't know we'd scheduled the replacement, saw the machine was down, and brought it up again. Sigh. Finally they did the replacement, got it back up, but now we're seeing an ethernet port flapping, suggested they have someone go in and make sure all the jacks are fully seated, maybe one got loose when they were doing the disk switch. Bureacracy reared up again and we got the boilerplate "if there's a hardware issue suspected please boot into rescue mode and run the tests"... sigh...8
-
Let's play a game.
Dev-ops roulette, loose it all or walk away a lucky boi.
Run this command
sudo [ $[ $RANDOM % 6 ] == 0 ] && rm -rf / || echo "You lucky boi";4 -
I've just been asked to give my opinion of a dev as they're on the chopping block.
I don't want people to loose their jobs over my verdict 🫠
Any advice?10 -
So, in roughly 2 years?
- Having my driver licence
- Get my graduation (should be in a few months but still)
- Find another work
- Get a better pay
- Loose 40 kgs
- And a GF would be a bonus -
Set all my editors to autosave when they loose focus ~
Makes me go nuts when working on other machines :/2 -
I choose to believe performance self assessments are useful. Not for, like, my actual job, but they keep me grounded. Nothing like seeing your entire body of work for a year summed up in 30 to 40 bullet points to deflate your ego. Also it gives me a chance to work on my skills in what some of you might consider "lying" though I consider it more along the lines of "creative truth telling" and "having a loose grasp on reality".
-
Our approach is to get a loose feel for what the client wants, lift some visuals from Theme Forest then spend the next few weeks persuading the client to use our crappy server rather than their preferred AWS solution. Then once the project is behind schedule we break the work down into disparate tasks each of which gets a single line brief from the PM (such as 'create admin' or 'do css'). These then get assigned to different devs with no consideration of their skillset. The PM is available for 10 mins every day to answer queries, the rest of the time our devs are expected to work autonomously. Meanwhile we'll tell the client that we're back on schedule and arrange a demo for an impossibly short deadline. We have the mantra ”dont worry about it” which the PM uses to quash any dev's concerns up until the day before the deadline at which point we'll swap some devs on to unrelated work whilst others concentrate on getting "just the pages the client wants to see looking right" (we have a policy of making it look like it works before it actually does.) Following the demo we will announce all the missing features we had forgotten about from the initial undocumented agreement and set the project aside whilst we service another client.2
-
I cant keep this inside anymore I have to rant!
I have a colleague that is an horrendous loose bug-cannon. Every peer-review is like a fight for the products life.
Now I understand - everyone makes bugs me included and it is a huge relief when someone finds them during peer-review. But these aren't the simple kind of bugs. The ones easily made when writing large pieces of code quickly. Typing = instead of == or a misshandling of a terminating character causing weird behaviour. These kinds of bugs rarely pass by a peer-review or are quickly found when a bug report is recieved from testers.
No the bugs my colleague makes are the bugs that completly destroy the logic flow of a whole module. The things that worst case cause crashes. Or are complete disasters trying to figure out what causes them if they are discovered first when the product reaches production!
Ironically he is amazing a peer reviewing other peoples code.
But do you know what the worst thing of all is! Most of the bugs he causes are because he has to "tidy up" and "refactor" every piece of code he touches. The actual bugfix might be a one liner but in the same commit he can still manage to conjure up 3 new bugs. He's like a bug wizard!
*frustrated Aruughhhh noises*9 -
@retoor you wanted something IT related.
"During the early stages of the war, the army gave sweeping approval for officers to adopt Lavender’s kill lists, with no requirement to thoroughly check why the machine made those choices or to examine the raw intelligence data on which they were based. One source stated that human personnel often served only as a “rubber stamp” for the machine’s decisions, adding that, normally, they would personally devote only about “20 seconds” to each target before authorizing a bombing — just to make sure the Lavender-marked target is male. This was despite knowing that the system makes what are regarded as “errors” in approximately 10 percent of cases, and is known to occasionally mark individuals who have merely a loose connection to militant groups, or no connection at all."15 -
I don't like many sudden unplanned meetings appearing during your estimated development hours. It consumes some development time and destroys your momentum.
We follow the 2 weeks sprint that contains sprint ceremonies like sprint planning, demo, retro, daily stand ups and backlog grooming meetings. My capacity should be less then 80 hours since there are sprint ceremonies and unplanned meetings that happen during development hours. Unfortunately, my capacity is still set to 80 hours and meetings hours are not deducted. This puts me to a disadvantage as I need to do unpaid OT/weekend work just to make up for the lost time consumed by meetings.
Those 1 hour/30 minutes meeting piles up thus consuming development work hours. So a simple example is that you have 32 hours estimated to finish a big user story but sudden unplanned meetings and sprint ceremony meetings will consume some of that 32 hours. I will bring this up in our next retrospective meeting.12 -
There’s lay offs in my company.
So far:
- slackers and incompetents are staying
- Part of the leadership team is in holidays
- No one said the word lay offs but use the sentence “changes to come”
I am going back on monday and part of me hope I will be kicked out as I will have nothing to loose then, and a full month to say whatever I want.2 -
Spend 2 hours migrating my old NASs ubuntu zfs pool to the new freeBSD NAS, which has new fancy stuff like a crossflashed raid card new hyper efficient psu and so on. Sadly, the pool just wont import, many drives are missing. I debug. For hours. Trying to test cables. Interesting. No matter which SATA cables i switch, this one drive always starts... Hm... Must be the controller then. Maybe the controller doesnt spin up the other disks, because i removed the boot rom! That must be it! Wait... Why is this cable lying in here... Wait, this is the power cable attached to all missing driv ARE YOU FUCKING KIDDING ME?! I WASTED SO MUCH FUCKING TIME ON THIS SHIT HOW COULD YOU DO THIS TO ME!
Unfortunately, one power cable become loose (i dont know how, these cables have plastic thingies to prevent this...), but it works now. And its better than before. -
When marketing gets overly excited about analytics requirements and you have more code in a page for stats than actual functionality
-
Ubuntu 16 lts wifi drivers have problem and i am unable to fix this shit, everytime there's a new problem with ubuntu I hate ubuntu now for these many problems I'm not going to use it again.
If I didn't find any good linux distro I think I should switch to mac31 -
If you ever get a chance to refactor a 5/6 years old code , just do it .
Dont loose hope , you'll eventually have a great time .
Its totally worth the effort and time . I learnt so many things. (still in the proccess)5 -
Went into the office today to turn in my badge and gun (security badge/parking pass and yubikeys really) since I'm pretty much being given my last week before changing jobs to do brain dumps for knowledge transfer, and fuck all else.
Found a jar of moonshine in a closet when I went to take my things. IT said I could keep it. Not a bad parting gift. -
I just setup an apt-cache on my Macbook. Docker no longer takes 10 years to `apt-get install` when I'm at the coffee shop. This coffee shop is going to loose so much money now that my work is done faster.
-
Fuckin'A how it takes 1 t-shirt from hacktoberfest to make everyone loose their shit and start actively contributing to Open Source projects on Github.2
-
I want to rant about it but I don’t even know what to say.
It’s just sad that people share the most personal things with Facebook and other services as long as it’s not a person who asks for it.
It’s just a machine who knows me better than my parents do.
OPEN YOUR FUCKING EYES.
Who is behind the machine? Humans.
It’s 2019. Soon 2020.
They still don’t get it.
That’s what you should teach those kids. A class “how to protect your privacy”..
Not this Shit: : if I Buy 20 melons that contain 70% water, they loose 1% each mile. You carry them for 15 miles. 5 of those miles are in the sun which makes the water vaporize 5x faster. How much fruit exclusive water is left at the end?
WHO THE FUCK CARES? We have cooling boxes and cars.
Focus on something important please..1 -
Someone mentioned that client want to use wordpress instead of they current website because it is cheaper! Ok lets see how cheap it is.. each time wp release update after updating you need go through all website and check if nothing is broken.. plugins will need update as well because usually they run on specific wp version. Fixing theme and plugins requires dev time.. despite all those things.. have common sense. Maybe it is good for some type of business to host few pages without any business logic or use as blog without scare to loose everything and do not store users data.. someone mentioned that it is secure to run anything because updates are the best security to avoid security breaches. So why banks are not running on WP? Why health service is not using WP?
-
Customer service my ass. I wouldn't even call it service. All you could do is check if it's working now. Of course it's working... I've just told you it's fucking working 2 minutes then inaccessible for fucking 10.
And when I tell you that your service had began to loose quality in the past few months you just sit there in FUCKING SILENCE. MOTHERFUCKER JUST TELL ME THAT YOU CAN'T DO ANYTHING ABOUT IT... OR SORRY... OR GO FUCK YOURSELF, NOT MY JOB... I DON'T FUCKING CARE JUST DON'T SIT THERE IN SILENCE UNTIL I HAVE ENOUGH AND HANG UP... I WASN'T EVEN SHOUTED TO HIM. I was disappointed but not angry... Not until you decided to just ignore me, fucktard...
Needless to say just when I hung up it stopped working again. -.-3 -
New job is turning out to be kind of the opposite of what I was expecting, based on interviews.
I thought I had done a pretty thorough job asking the kinds of challenging and specific questions during the interviews and was pretty satisfied with the answers.
Three weeks in, I’ve more or less been turned loose onto my first project which is….installing patch updates.
Next few projects through the end of the year and into Q1 next year are similarly sysadmin-chore work, which I’m not going to act like is beneath me or unimportant but it’s not quite what we talked about in the interview when I applied to an SDET position.
Point of order to talk about once I wrap up these first few projects, it doesn’t exactly seem like they know where I’m supposed to be or where to even really put me (on the org chart I have a line reporting up to boss, but I’m also the only one not on a functional team) and reading through the wiki last guy just kind of did everything.
If that’s what this is….eh I need to know if that’s how they want to use me and find out soon.11 -
After watching YT-Videos about the Language/Framework/... , I start during a long weekends night with a fresh Spotify-Playlist. 😁
The few first days are always the most productive ones... Until you loose motivation... 😒
Do you hear music when coding? Sometimes I think, I could be way more productive when I just code without it. Do you agree?1 -
Fucking hate working with dotnet. Just spent half an hour fixing the most fucked up bug.
So I installed a nuget package on my computer, tested everything, it worked, and pushed. My classmates then pulled it to their pc, and holy hell broke loose.
Everything was red, it couldn't even import System! By a turn of luck, I looked in the .csproj file, and saw that it had made an absolute path to the nuget package on my computer. Well no fucking wonder it only worked on mine then!
And here's the weird thing: it only did it now, it hasn't done it with the other packages we've imported3 -
Just because Elon Musk is acting like a horse let loose in a hospital over at Twitter does not suddenly give all employers the right to treat us like animals. I will not give you double the work performance for the same amount you agreed to pay me. I will give you the bare minimum and until you pay me more, you will not get more, and even then, what makes you think I will give you more? I rather work less hours a week rather than continue contributing to keeping the corporate machine running just so that you can stuff you and your shareholder's pockets rather than helping your employees, who by the way are your customers too! Why be loyal to you when corporations are not loyal in return?!
#CorporateCringe -
"so what's the difference? there are groups and communities for devs, why devRant ?" It was my colleague's question and I was about to loose the debate between this and other social n/w.
I said "look man the greatest thing is you can build a DP that looks like a geek programmer, whatever you look like in real time doesn't even matter."
And he said "Let me see your profile."4 -
Whenever I have my mac crash and corrupt its OS, I just get a backup harddrive and it copies itself FLAWESSLY. I have all my programs, settings, settings in programs and files.
When Windows crashes, and I use the recovery tool, I LOOSE EVERYTHING. The only thing I get to keep are my files, and they most of the time have permission issues after a restore.
Windows is like the toddler that stares out to void of existance and can't do anything but drool on their shirt, while its parents say he's highly gifted.
Fuck me we're able to choose between only a few OS'es that my clients know and allow me to work on but things like this just make me want to go be a chicken farmer or something.25 -
ES2015 classes in JS
It is just syntactic sugar and i always feel like i need to transpile it in my head to what it actually is just not to loose perspective and make some hard to debug error.
It feels like language is trying to cheat me into forgetting how it works.2 -
Thank you google for not building firebase as a dynamic framework and making me loose 3 days of work. I hate your guts !
-
So yeah... This guy just copied and pasted the same 5 lines over and over again. 5 lines that do the collection of values for variables, setup call, and then an API call for different CRMs based on name. Repeated 7 times for each of the CRMs that we support. On top of the insane switch statement which is actually only used once to check if it's not null and matches within the switch statement. See the following loose but true example of this shit show I'm dealing with.
```pseudo-code-example
switch(crm)
case crm1
case crm2
case crm3
// (keeps going like this)
var temp = true
default
var temp = false
if (temp)
if (crm="crm1")
crm1.setup()
crm1.values(foo, bar, baz,...)
...
if (crm="crm2")
crm2.setup()
crm2.values(foo, bar, baz,...)
...
// Yup still keeps going like this
```
This absolutely insane mess was finally refractored by me to be an actual factory and not this absolute senseless murder to my mind.1 -
I've been given a huge stack of paper, some users stories and loose specs. Was tasked with engineering the specific requirements, then the models and finally the database. Then I need to build an API on top of that.
Stuff I'll use is Go and Postgresql. Small issue is, I've never done DBs, so I've no idea what to do or where to start.
Does anyone have any resources to help kick-start myself in this field? I've been reading on SQL, but that doesn't really tell me anything about data structures and how to transform those user stories into product requirements.6 -
After months of launching an intranet for a major corporation, that ONLY were supposed to be temporary until they went over to Microsoft Sharepoint solution. They're now asking for new features, like not having it locked to their VPN, and make it responsive, maybe make it an app!
It was all thrown together and a lot of spaghetti code, because the terms were that it would be temporary from when they merged with another company till they got the Sharepoint solution up an running. Oh, and it is all run on a Wordpress 3.3 solution, they don't want to upgrade it, because they would loose some irrelevant plugin that they love.2 -
Feeling the need to drop a client who always wants the "beer rate" for LOTS of work. Problem is, it's still income I wouldn't otherwise have, I'm a "people pleaser", I hate to cut people loose when I know I can be of help to them, and I hate seeming rude. Anybody got any tips for me?2
-
The problem when you spend basically all if your technical life working by yourself, is that you are not used to understand programs you didn't create. Specially when there are no documentation or a single line of useful comment.
I've tried to help in an open source software just to get frustrated and fall short because I couldn't understand where things were getting initiated/called and I don't have too much free time to keep trying/searching.
Any tip here? I don't really need to learn that, but I think it is important. We never know about the future and I don't want to get stuck/uninployed in the future if I loose my ~15 years job someday.4 -
Got another one of my boring questions for us all to hopefully discuss a little.
With all the talk about the Librem 5 starting to ramp up more and with my little delve into UBports, was curious as to what other devs would be interested in/want/need from a mobile Linux operating system.
For me it's simple but mostly creature comforts.
1. Consistency and convergence, give me the ability to run a full desktop environment along side the mobile DE but make it consistent between the two (Looking at you Microsoft with your continuum)
2. Doesn't loose the customisability of Linux, let me install any Linux application I want and customise the theme and icons (Something I have a gripe with UBports)
3. Have accompanying operating system with an echo system, so have a wearable OS, a desktop OS and mobile OS, having that tie between the 3 is amazing as a heavy android and chromeOS user.
Would love to bring some of these things to reality but don't have any knowledge of how to do it, personally would love to see elementary OS have a crack at this (Wont happen but got to deam!)2 -
Our help desk person set up our software in a virtual machine on some cloud provider and you know how they give you a drive labeled temporary with a text file in warning you how the files will get deleted? Well for some reason they put the database files on that drive.
Luckily the server was for a small internal project and restarted a few days in so the users didn't loose too much work. -
Coming from a parallel devRant universe(where %jAsE% is dead and the meme continues to live), here to share only my rare blogposts, starting with:
https://loosy.gitlab.io/2019/06/...
Also put down 🔫 my misery and let me have an avatar u_u12 -
If I have to train one more person, or answer the same question for the 100 times I'm gonna loose it. I just want...need to code
-
So, yeah...
Something like 2 years ago? I was bored in school, so I decided to make something on website that I was creating then...
I wrote few lines and sent file to the server.
BANG!
I don't know how, but I saved it as "index.php" in the root folder of website. I overwritten fucking index.php, lost this fucking file. Soo... I had two options: make index.php from the beginning, or restore backup and loose changes form 24 hours. I choosed the second option. -
Whenever i get bored at work i try to motivate myself, because i notice that as soon as i am less interested, i loose focus and make mistakes.
Therefore i try to keep motivation up. One thing that helps is actually TDD, because you are able to have several small subgoals, which each leave you with a feeling of achievement, when a test you wrote passed, kinda like achievements in games.
When the task itself is so boring that even TDD doesn‘t help, i try to have fun while painfully working through it. Like have a coffee break every now and then or rant with a coworker about the task.
One time a coworker and me had to create a demo in Unity and we hated the task, because it was exactly this brainless and cumbersome clicking in the Unity3D UI which felt awful to us (we are embedded developers and we find comfort in the terminal 😄)
The only thing that got us through the task was ranting at Unity and periodically goofing around in the engine and adding weird behavior to objects. -
rant(){
So, yesterday I was explaining one of our sales guys why I wouldn't be able to finish a task for his client, since I had passed the last days recovering from a major db breakdown, and had plenty of work on wait before I could get to what he asked.
The prick goes and tells my PM he's about to loose the business because of me, and screws all my timetable for the week...
What should I do to make sure he never messes with devs anymore?
}7 -
So this happened at a government organised 24 hour Hackathon. We had to store documents uploaded from the front end. Now we’ve been trying for a very log time but everything failed (yeah we had a crappy front end guy). Then all hell broke loose when the our team leader in hi sleep deprived state deleted our git repository while I wondered why my pushes were throwing a 404. When hell felt near we came up with the solution to encode the documents in base64 and store it in the database since we only had to show a demo😂.
Sadly enough, WE LOST. Although in retrospect it comes as no surprise.2 -
When the PM has been letting a fresh faced graduate loose on a codebase without any code reviews and you come back to some cronenburg level horror in your now crippled project. But it LOOKS like the mock ups.... * internal screaming *
-
Fuck it’s Friday I am playing poker if I loose I will not work and if I will certainly I will party...1
-
the Death Valley of PR approval
I have almost 3 years of work experience in programming professionally. Currently this is my second company. Previous company I worked for was very loose regarding clean code, code readability, tests etc. It was their way of doing things fast, making working changes quickly was the most important thing due to its business. Now I work in company where I spend a lot of time in some limbo when my code works and my code is merged. It sucks, I make all kinds of mistakes which would be tolerable in my previous workplace, but now it keeps me from releasing code. I now the way I do things now is the right way and it will result in me growing as a specialist, but it is very frustrating and damages my self esteem. I hope it will pass one day.7 -
Never ever have to sleep, eat, shit, piss anything like that. Every damn time I do that I loose the focus/idea I had when I started.
-
Is this just me every dev have this problem, while learning something new sometimes I loose track and learn something else completely without any intention of learning it.
-
I'm at a bit of a loose end here, I'll do my best to explain and I hope it all makes sense.
I'm trying to find a way to wrap a C++ Console App in a C# Class so I can use the C++ App as a library within the C# app rather than triggering the C++ exe and providing a command to it.
The reason why I wish to do it this way is for maintainability, so I can make changes to the C++ app without affecting the C# App.
I've been looking at tutorials and stack overflow to see if's its possible, but for someone with learning difficulties, I'm struggling to find the right path to take as I'm seeing conflicting info.
Any help would be greatly appreciated, Thanks in advance5 -
Couldn't be arsed with all the conditional compilation that angelscript required, so I dumped right back to good ol' lua for now.
Got lua in, vm started, loading strings and pushing/popping the stack.
Got SDL actually drawing as intended.
I don't know even half of what I'm doing.
Apparently header files that end in ".hpp" are specific to c++, while .h are for c headers.
I like the new SDL2 though, little bit different than SDL1. Not a lot of tutorials cover the difference, but I could kinda suss out from the documentation where I needed to adapt, even though I'm still pretty loose on the library, on the docs, and on c++ itself.
Still just a learning project.
Also, I'm continually surprised there isn't a portable, platform independent tool or little language just for replacing all pseudo-languages out there like .bat and .sh, and .zsh
Maybe even just a tool that standardizes it all, then takes config files that map the new standard to system dependant commands, so you can download the damn thing, configure the relevant environment variables, drop in the platform dependent configuration (or your browser or package tool detects what platform you are on and chooses the relevant package/download for your platform), write a console script and the tool automatically translates, and emits the system-relevant commands to that platform's console (so you don't even need much platform-specific code to do things like file access). -
So I thought I knew source tree, apparently I do not... Lost a week's worth of work, went to history, saw someone removed it with a commit, and now I'm getting blamed for my own work 'disappearing'. The reason I am being told I am to blame is how I control my branches... So how I do it is that I keep a local copy of the master branch, I keep it updated and monitor it for changes regularly (meaning fetch and pull cause double tap..) before I do a merge, I check for any new code on master again, then using the local copy of master, which I just updated, I pull the master changes into my branch, deal with any conflicts, build and done. Then I request my changes into master once I am happy everything is good.
My question is, clearly there is something wrong with the way I do things, so please source tree users, what is the most fool proof way to pull latest from master so that I don't loose code? 😔11 -
Windows why the fuck you slow down to a crawl when I upload something to network storage?! I only upload at 100Mbit and you loose your shit opening another file explorer??!2
-
!rant
When learning to develop mobile applications, should I learn android and iPhone separately, or just use xamarin instead?
Can xamarin replace it all, or do you loose some functionality/performance etc when using it over android studio and Xcode?7 -
I’m still waiting for Agile to just go away, it is the reason devs burn out and have miserable working lives. I started my career just before it got a hold and I remember those days being great - going to work was actually my hobby.
The worst places I’ve worked had strict Agile practices, the best has had the most loose.
Just go away already, Agile! You make so many devs lives miserable.9 -
God, if there's one thing I fucking hate about Portugal are messaging companies.
Fuckers that literally park their van in your driveway, drop a "recipient absent" note in your mailbox, and happily drive away without even ringing. (All the while being recorded by the very non -absent recipient from the very window.)
Well, it's a 4k € PC you are delivering. I better have it tomorrow first thing in the day or all hell will break loose.2 -
counting things and columns matching.
Two easy and stupid things that make you loose it if you can't get it right4 -
I hate this stupid git, said by my colleague who really don't understand how to use it properly.
They always fuck up merges, forgets to commit and loose changes and fails terribly in resolving conflicts.
Yeah! Git is not stupid my dear. It is you who is stupid.6 -
on live server
me: these root server files have loose permissions.
sudo chmod -rf 644 /*
me: well... 'cd' works, but nothing else. -
When your changes keep being reverted and you finally discover the 'experienced' contractor has been using rebase and 'take mine' in git merges.1
-
Duck! this sloppy whiny winnfsd.
Yay! Let's use state of the art Docker with a VirtualBox VM on Windows10.
Don't get me wrong.
The Docker containers in this VM doing a great job on performance.
But in the very moment a Docker container uses a mounted folder via the windows network filesystem, all hell is breaking loose.
Building a vendor folder using a composer Docker image with 84 Packages takes about 15 seconds when cache has been warmed up.
The same Docker command pointing on a folder mounted to Windows Filesystem with warmed up cache takes about 10 Minutes!@&&@""+&
And what is the duckin' reason for this delay?
Because every transfer of a teeny tiny file has to establish a connection to fat ass Windows OS and has to pass it's glorious "security" layer.
DUCK it!
For real.
I currently working on a shell script which builds the whole vendor folder on a volume on Docker VM.
After completion, the shell script will compress the folder to one file.
This one file will be transferred over this god damned network filesystem.
Finally the script will unpack the compressed vendor folder in it's destination folder.
*sigh*
What year is it?!??3 -
It was more of an inner rage.
A client's manager was trying to getting rid off of me as soon as he could(budget cutting from their client, but still), so he asked my team lead any negative or pity feedback on any issue or misunderstanding that I encountered during work and he was using that as an excuse to tell my agency that I should leave.
Fine, I thought. He's all hot raging air style guy, he can't stand someone that's fine with his character.
But after leaving (2 days earlier than said before even) and when I received the income next month I realised that something was off, and guess what?
That DEEPSHIT refused to pay 6 out of 12 last working days there. So my agency argued with them but can't do shit because they're the "paying client" and the negative sentiment was redirected at me, for making them almost loose that client because of my behaviour.
FUCK THAT PRICK, he touched where I was never touched in my career, stealing from my work and pokets!
What a clown world.1 -
I need to make a legacy Java monstrosity asynchronous and came across a class which is currently making me cry blood.
It took our whole team 5 days to figure out how this thing works, including the weekend. At one place, It is adding an empty list, to another list.
The magic here is that if I remove the statement assigning data to the sub list, the data is still somehow being populated in the root list.
This clusterfuck somehow works in single threaded processing, but as soon as I make this multi threaded, all hell breaks loose.
Please send help!!1 -
Continuation (no. 2): So because of my bad conscience I was very polite and friendly to the colleague I pestered about... but my boss was not. Instead he broke loose his second fight with Mr. git master. He's joking about that he now already had a fight with almost anybody (mostly team leads). He's leaving the company anyway, so he needn't care, but I start to love his love for conflicts. Some PM or upper boss already said something along the lines: "If something's wrong, I know you'll escalate." Of course you should not for every triviality, but nothing is worse than those lingering, dormant time bombs of projects that went so awry they're just waiting to explode... or silently be canceled.
Well, so they clashed again, and Mr git / scrum master fought for his concern that my boss, who's also product owner, must not enter the team. I looked at the git logs: Mr git master's only contribution - he's supposed to be a member of the team - since joining (like over a month) were 300 LOC, which was actually copy pasting our old copy right form, peppering it with some html tags to ensure it would not work without recompiling the 3rd party lib with a fucking webengine.
My boss now rather wants to remove "agile" as it's not fitting. Just let the three or four of us yank out the code so we actually have a chance to deliver in three months. He told the upper boss that we can take our tasks ourselves so independently we even need no team lead, but could report directly to him. It's still not clear what's gonna happen, but it's like they could let us loose, free radical elements who just do motherfucking programming. Feels awesome. -
Slack, allows me too post funny images to my team when i can't focus, and make sure they loose their focus aswell...
-
New version release Saturday morning. We have 3 hours window I plan to do it in 15 minutes and don’t loose weekend.
Wish me luck.6 -
Hell will break loose even if you deploy your shit on monday morning and noone has anything else to do.
-
When your SCRUM Master cancels the sprint retro because he knows all hell is about to break loose.2
-
In organised "standup" where people either offer nothing or try to clear up an issue with someone mid way through.. 'nuff said.
-
I’ve been ill and injured a lot over the last 8 months or so, and i also quit smoking 2 months ago so I’ve put on a bit of extra padding.
I need to loose weight as I’m getting married in August and I want my suit to fit.
Anyway I’ve started eating a little bit healthier, and I’m gradually getting back into exercise (taking it slowly as don’t want to re-injur myself, and need to get my body used to it again)
This has presented 2 problems, the first is that after a run I smell like a tramps ball bag, and the second is I’m impatient and can’t do the sort of training that I used to do.
But, onwards and upwards, and even with no exercise I can still run 2 miles non stop in less than 20 minutes, not going to win any awards but not too bad all things considered.1 -
Time sheets. I'm not a fan of our task management system, you don't check out jobs or tasks like moving cards on a kanban board, it's more of a loose, calendar-based setup. We're also in a small, open office so it can be difficult to remember to log things in the software when you could tell the person opposite you that their task is finished. On top of that a lot of the time it takes me longer than the scheduled time to get a job finished as I'm learning a lot of new stuff, so digitally documenting things like that worry me a little. I don't want to look like I can't hack it just because a job takes me longer than my much-more-experienced colleagues.
I should note that I understand it's all incredibly useful data to the company, but I hate doing it and it's very easy to forget or ignore.4 -
I learned Git in the most ridiculous way possible.
Noob me, is using VSCode and i tried clicking the git icon. Now, i didn't know what i was doing and i suddenly made a git repo and i just checked on things (add changes and commit) and little do i know that it was all absorbed. I got skeptical (spying on files, i didn't know what's happening, etc.) so i clicked the "x" button and it warned me that it will be "completely deleted" and it will be an "irreversible action". Due to my stupidity, i pressed okay.
Then that was the time i knew, i fucked up.
But hey ho it took me 12 hrs to recover all files (1600 loose objects) that has been deleted using a 3rd party app (without any master, no last commit message, no everything, just objects a.k.a the blob files that git saves). I tried looking for easier ways to get the files, but it was there in front of me the whole time, so it took me longer.4 -
I have a solution in mind and it’s really not that complex but my brain just doesn’t want to connect all the pieces..
When I think about component a and b, then c and a don’t work together. So I come up with a solution for a and a but then b is loose again..
I think I’m getting old🤕8 -
!rant
I am sorry for having been so harsh on you yesterday npm. Dont fuck off... You are my friend... I love you. You are not in an abusive and manipulative relationship...
You know how it is when i loose my temper....3 -
Any good advice for managing junior developers?
In my experience I have found that loose definitions of work to be completed yields poor results. Honestly, sometimes I wonder if I have to write the code structure and leave a bunch of TODO comments for people to fill in.
Or alternatively people get going on tangents without thinking of the concrete problem given.
Or go try building generic abstractions that are unneeded and will not be reused complicating even the simplest use case.
Maybe the problem is in me and that I am not clear in communicating what's needed. What techniques do you guys use to get more or less what you want?7 -
So who of you got a 2FA Hardware device? I am think of getting one (Yubikey or nitrokey). My only question is, what if you loose the 2FA stick? You are locked out of all your stuff?9
-
Note to self for later: whenever I git push something from any side project, next time just add a TODO list so I don't loose time to remember what the fuck I was doing
-
!dev
So, what kind of clothes do you normally wear on a workday?
I just wear a t-shirt with some dev-inspired quote, some loose jeans (and undies) and some hiking shoes.
Once I have arrived at work, I take off my shoes and put on flipflops2 -
Big party at school coming soon, I'm busy working on my startup, too shy to ask someone out. Fuck, why does it always have to be like that? When I have something important to do, there is ton of other cool stuff elsewhere. I could go, but knowing me I will constantly think about everything I could be doing and how much code I could write. And my fucking annoying shyness. Fuck, even if I like someone so much, I won't tell them because it will destroy our "friendship" and I may loose my dance partner. Flying fuck, why can't one simply change himself.1
-
Why is it so that I have 8 hours to work, but find myself to only be productive in the last 2 hours... I find it difficult to work in the mornings, to much chaos up in my head.
I'll loose the job if I continue so, any tips?3 -
when I am maintaining someone elses code, the class is 900 lines and I loose the context on line 100... then I rely on the test fixture... where all tests are ignored.
-
Hardwares guys help a dumb dev out. Got my work station finally set up at home. This cord is attached my Dell Thunderbolt docking station.
If I lightly bump the cable the laptop or the desk I loose connectivity to my displays.
What can I replace this fucker with?9 -
Common Docker for Windows! Are you serious? What in heavens name could you do wrong to loose access to your own ducking database?! And as if that's not enough there comes the internet in the form of Google telling me that I'm the only idiot with this problem. Sure sure. Gnarf.5
-
Image aspect ratios are standards. Please don't invent one if you can't commit to the number, the feature, and the app for 5 years.
I don't want to design a custom header image for my Google Doc just so Google can remove the feature in a few months. A company that plays as fast and loose with features as Google should just have a dynamic layout and make room for whatever image I have on hand.1 -
When I had +2222 of reputation on stackoverflow, when if a user vote up+5 then I do a mistake to loose -5 so my aesthetical reputation remains 22221
-
Clients started using our system after a lot of infrastructure issues, a few days later everything stopped working. Hell break loose in the company one day the developers fix the issue next day was something similar. After a week of threats, fights and gunshots, one of the colleagues found out that one DB script file is missing, git history can't show why. After going a bit deeper with other tools, they found that I did a fucked up git merge that overwritten the original script. And that was 3 months ago...needless to say that the team got very, very pissed... So my tip is, be careful with git mine and theirs because that can fuck you up...2
-
FUCK i just lost 20€
I fucking hate "real" cash. It is dirty unhygienic and you can so fucking easily loose it. I swear losing a Note is a worse pain than cutting yourself or burning your hand. It's just as bad as stomping your head really hard. I HATE THIS FEELING21 -
Listening to a colleague starting to explain generics to the intern, then disappearing away from the area as fast as humanly possible so you don't loose a day!
-
Friend of mine during workshops yesterday:
F: "Shit, my copying is broken (ctrl c shortcut)"
Me: "stack overflow down and/or broken copy/paste - worst nightmare"
F: "oh it works again... For a moment there i was afraid im gonna loose my job..."
* I guess the comedy of situation doesn't translate well to rant, but still, it was funny * -
the moment a job application makes you go through so mamy hopps you loose intrest and they send an email after the 7th stage saying.
"were so glad your still intrested but we havent heard from you in 3 days" -
i wonder if there's a frontend for vanilla arch installation
it dosent feel the same with antergos sometimes
I did install antergos as base, but i never got to partiton like you guys have - mainly because i loose patience when the partitioning dosen't go smoothly. It hasn't. not even in virtualbox.
please pray for me -
Why did compiz loose interest in the Linux desktop world ?
Compiz desktop effects were the whole reason I got into Linux.2 -
A chess game on msdos
Pacman
Prince of persia
Eveeytime we go to my uncle's house he would get a game for me. Then I learned cd .. back and forth, dir format. I try to do the same for my nephew but he knows more about new games and better than me in pubg. I didn't loose my noob spirit. -
Frontend developer mainly, getting all excited by C#, net core, apis, http, databases. A new world of trinkets and hard-edged engineering. Makes me eyes glitter.
But my day job needs me to become as proficient as possible on the frontend of the stack. As we warm up to a huge application rewrite, with me as the sole frontender, it becomes clearer and clearer that, if I am not only to survive, but leave a codebase behind me that is clean, thoughtful, well modularised and built with maintenance and performance in mind, that I must let go. I have to focus.
I feel a little sad today. Somehow, right now, the frontend world does not feel as exciting. Javascript feels loose, unpredictable...my work open as well to everyone with every flavour of opinion. Because it is observable.
But I am mortal. Time is precious, and limited. I feel I need a dose of curiosity discipline and that, if I can do so, I can devote myself not to my coming and going whims of interest, but the real hard work of learning craftsmanship once that feeling of glitter has faded.
My brothers and sisters, steady my hand. -
Guys, please be mindful of your dependencies. I just ran "npm install" and whole hell broke loose.
Imagine having to install 3.6GB of VS2017 C++ junk, just to make the damn node-sass compile.
Obviously the module needs to build on my machine, but one would expect that a nodejs module would not depend on msbuild. Funny how nature does that... -
Okay. I look at myself as a kind of intellectual person. My parents are not believers so I came out quiet normal. As engineer and fan of technology I believe in science and I have a fairly complete look at life and universe at whole, I do not need any religional explanation for anything. I do not believe in the conspiracy theories and in any highly organized global secret society who controll us. I have acquired my view and opinions by systematically rethinking every aspect of life and everything I knew and I was thought before, btw this is the reason I stopped to eat animal products too.
But after all this corona shitshow, I really don't know If the current situation is just rolled by stupidity of media and politics or its really some plan of some people. I mean you can legally buy cigarettes with proven death rate of 10%, they recommend you to drink milk while its ultra carcinogenic and like 60% of population is intolerant, you have to wear mask but not gloves while the virus transference is 90% trough hand contact, and there are many many many questions that makes me paranoid. And now this vaccination stuff with countries almost forcing it in population, ahh... Man, This complete story is too irrational and strange. I start to loose my stable belief system and slide out. I noticed that I am not sure and I am just silent when people talk about these things. I hope this nonsense will end soon.37 -
For 2 weeks or more testing our app .. everything is perfect.
Deployment date .. hell break loose 😒😣😫😫😫😫 -
today for the first time in last couple of months, i am fealing a bit happy. its not a happy-ish happy, ite that kind of happy when you are just so lost that you don't care to loose anymore. at that time, you just smile.
like, the world will keep on fucking itself, and you no longer care. you are just laughing at the world around you burning, and weirdly , you too are burning, but still you are smiling. that kind of happy.
on a seperate note, i think every company i switch , i end up landing in a worse one. i will probably keep switching until i reach a place that is so shit, that i might have to take management in order fix the shit. -
Whenever I find answers after Googling for a long time, I open those links and immediately loose my concentration. I just let those answers pages hang out in my browser while I go do something fun and distracting...
-
Am I the only one that feels like the development and software engineering will loose the high paying benefit soon? Remote work normalised hiring developers from farther away. I've been approached by quite a few recruiters that want to hire from much farther away then usual. It seems like only a question of time untill most of the things will be outsourced to third world countries where developers get paid basically nothing. Sure they were usually a worse choice in the past, but it always gets better with time. I'm sure that there are a lot of vry smart wngineers there. Why pay your developer 50-90k/year when you can pay 10k/yr for two developers in India?
We're also automating ourselves out of jobs with all these no code platforms. Thoughts?8 -
TypeScript types are fun. Problem is: the check is compile-time only.
I just wasted an hour not understanding that an integer passed from command line was actually getting transmitted as a string. The library, where that value landed as parameter, happily ignored the non-matching type and worked as if the value has not been set at all!
Dear library maintainer, please enforce your parameter types! Throw an error right into my face saying I shall not pass anything but an integer! Don't just continue to work to produce false output correctly. Thank you!
Dear TypeScript, I really want type checks on runtime.
Dear JavaScript: Why did you ever think loose types were a good idea? (And I say that as a PHP developer as well.)2 -
I need advice fellow developers, am I stubborn?
So I lost an argument in my team regarding constant vs variable directly in a method for stored procedure names.
I separated names of procedures into their own StoredProcedureConstants file because it makes it very easy to see all procedures used in a project and refactor their names if necessary. Argument against was that you loose time creating a constant. Am I silly if I am alergic to seeing quotation marks stuff without its designated purpose throughout the code?
Their way is adding var procedureName = "cc.storeProcedureName" directly in a method. I just can't find my peace with it. To me this is a magic string.
Am I being unreasonable?3 -
If you edit a column in a table in SQL Developer GUI you can loose your primary key in that table, even if you didnt touch the primary key column.
How fun is that?2 -
When people say they wish a language was more strict. I'm a fan of the loose lol.
Tried Python. Script failed due to indent not at right amount. Bye
C#/.NET... Typecasting out the a$$. Goodbye lol
PHP. Anything goes. Hello, this is my kind of world. Never had an issue with types but I write my code to handle values properly.
And I know people will have opposing views. However I will say that you can still achieve the strictness in PHP by putting in your own checks. Create a few custom functions to do your validations and you are good to go :)3 -
Well, so this time, it's not a joke....it's a moral kinda thing.....
Why do we want something?
We want something because we have the desire to know about it or we have the desire to achieve something or prove ourselves superior.
Why do we want to be superior?
People are so getting into the phrase, "Life is a race, if you don't run, you loose", that they unknowingly have the desire to be superior and fight for it.
This is totally not true. Life is not a race...it's an experience....we learn from life....we learn from everything and everytime we act. Life is not an assest that you race with. So, then why to race? Enjoy life. Gather true knowledge, not the so-called school's exercise book "knowledge".
Until we defeat our desire, till then, we are evils even though we think that we are good.
Desire kills, Defeating desire will give you a true life to live.4 -
When you discover the "branching strategy" is not far off copying the working directory as a backup -_-
-
Fucking hell! I'm trying to sit down and learn LaTeX so I can take notes with math formulas in the notes. Between work, random bullshit, crappy roommate drama, cats with the zoomies, and the kiddo going nuts wanting to play I just can't catch a fucking break to studying.
I'm torn between drinking a cup of coffee at 10pm to be able to get a chance to study or being able to sleep tonight...
However in the hell did I convince myself that going back to school at 30 would work better than when I was 19-20?!? (I'm still only 29 but shit I loose steam quickly these days 😰)
Lol I'll update the rant here if I drink that cup of 10pm joe!4 -
Do you guys know of any online course that teaches data structures, algorithms and other competitive stuff, but which is like, semi-online :
- the course would run for ,say 3 months
- the instructor would add videos/livestream on a specific day/days and give the assignment questions/tests
- assignment questions/tests are expected to be completed before the next video, where these questions , along with new concepts are discussed?
I hate those udacity/udemy courses where you have a large playlist of videos open up as you pay. It makes me loose half of my motivation since i know i can watch them later and end up watching them never. Plus there is no competition to motivate
I want this as my job does not allows me to stay sharp in competitive programming and it would be nice to remain in touch with that( without being too much stressed about it).2 -
Somehow I found Rousseau's the social contract.
I'm early into it since you know fucking chomo faggots with no balls keep screwing the world up trying to steal real peoles personalities and make them queer which eventually will lead to a generation that murders them being bred.
Anyway I found a love phrase.
Slaves loose everything in their chains even the desire of escaping them.
He continues.
Force made the first slaves, cowardice perpetuated the condition.
In short
The world being full of cocksucking perverse house niggers that love the taste of table scraps is the problem of the free man whose life is being devoured by scum like tosensei5 -
Office manager just mandated that our standing desks would have a "cable pouch" installed at the rear for cable management. My cable tray **was** the neatest of everyone in dev, now it's unscrewed on the floor and all my cables plus the laptop charger are hanging loose, because notmyjob.jpg and contractors generally DGAF.
Oh, and they didn't install it flush with the rear of the desk, presumably because they didn't want to take off my laptop stand. So it's right in the way of my feet when I'm sitting.
Nothing that I can't fix with a screwdriver in my own time, fortunately. -
Dejar A.I. who's about to rule the world:
If you steal my job I'll have to go back working as waiter and I hate it more than I hate grub updates. Please, consider to preserve my job as sysadmin and, in exchange I will rat out all my contacts with suspicious non digital activities. If I loose my job I'll be forced to do something drastic, like tell everyone you've been created by Steve Jobs. Let's be nice to each other, uh? -
Starting a job. No computer for the whole week with no prospects for when will I even get one.
Doing nothing, still getting paid, but starting slowly and surely to loose my mind...
I NEED TO SEE Code in order to live.1 -
Hi devs! I wanted to switch to a different distro but do not want to loose data, is it possible? And I don't have separate home partition, every thing is in one partition only9
-
!rant
tl;dr I should start writing sitcoms
So my mind is going crazy. Last I night I had a dream about a colleague. He was working on a kind of smart photo frame thingie, which should be published to stores like walmart and so on. Also his 30th birthday was around the corner and his soon to be wife was driving him nuts. So the stage is set for some action. I was visiting him along to said store on the publishing day since he was that paranoid as his job was tightly connected to the success of this project. Anyway now the whole thing gets this tragic comedic type of feeling. He is about to go through a mental breakdown in the very store. Destroying things, yelling like a gramps and stuff you know from sitcoms. I swear at some point he did loose his pants. Also the staff didn't give a damn about him. I was trying to clean his path of destruction so that no one takes note of this. Of course I failed gloriously. This thing goes on for a while. Finally in some kind of credits scene he was sitting in front of his laptop reading a blog post about the success of this thingie. After an insanly long pause of suspension he was starting to kiss his monitor in relief. I swear to god there was fake laughter somewhere in the background like in the good old sitcoms.... Never eat pizza right before sleeping.... -
I noted music is disaster for my work. It distracts I loose my focus and efficiency decrease also.
mood swingings when I listen too much music I have a hated feeling l. So I decided to quite listening music during work.
It may help me in the rest of thr time when I am alone and need to really distress myself3 -
My current "file/media server" is a crappy old falling apart windows box with a stupid mismash of internal and external drives with no redundancy. That sucks for a number of reasons, so planning on dropping around a grand or so (including drives) on doing it properly.
Space requirement would be around 20TB-ish of usable space, with 1 disk's worth of redundancy. That can include a newish 5TB drive I have lying around however. Would also run either Plex / Jellyfin, so some horsepower for transcoding would be nice (but no need for more than a single 1080 stream at once.) 24/7 operation, so don't want anything too power hungry.
Current (loose) thinking on the hardware side is an AM4 board and a reasonably low end CPU, 3x8TB WD golds. Software side, probably CentOS, then mergerfs + snapraid. Anyone got any insight as to other options? Hardware not my speciality in particular, so open to suggestions.14 -
So few days ago I've installed Mojave from clean setup (Hackintohsh) and works smooth as butter, and today I woke up in the morning and sat down to work, my pc was running on windows so I restarted it, there was some updates to be installed but what a heal will install them later, so the pc started booting in Mojave, usually takes few seconds but this time it got stuck on the loading screen, so rebooted again and this time added -v boot parameter to clover to see whats going on, got some errors about IGPU (had to use intel's gpu.. thanks Nvidia .!.), did few googling some suggested using -disablegfxfirmware but that didn't work, so rebooted again.. hoping I would get more info, guess what? windows 10 was in hibernation (possibly because there were updates to be installed on boot) and that somehow prevented mojave from using the ssd i guess? not sure exactly, so In the end I got very lucky cause if I didn't read the message I would have reinstalled the mojave and loose a day at work... politely f*** you windows updates!
-
is there a particular reason why I loose the Ubuntu (or gnome idk) settings app when I uninstall cheese in my Ubuntu-budgie VM?
cheese is just a webcam program right?1 -
As a person with a low grit personality, learning to program well is close to impossible. If it doesn't work in the first two or thee attempts I tend to loose interest and move on to something else. Can I do anything to help this?8
-
Well, it has been 4 months since I sent the mail for the stickers and the ball, and still haven't gotten them.
They probably got lost mid way 😔
And the only thing i can wonder is that there is a delivery guy somewhere, letting loose all of his anger on the ball which was meant for me... 🙈
Keeps me awake at nights😑🙊3 -
[ADVICE NEEDED]
I'm just going to graduate, and I got a job as S/W engineer(trainee) in a small (500 odd employees) company, which uses salesforce, SAP and sharepoint technologies! They are most probably gonna put me in salesforce or SAP. Is it good enough for `me`(read my background), I'm kind of confused, should I go for higher studies?
BACKGROUND:
very average student, but swift at learning technologies, never really got interested in competitive (otherwise I had a real good chance in top companies), I kind of have good IT skills - proficient in python and angularJS, but recently I have got into ML and done some projects!
Okay here's the part, I know it's important for a fresher to be good in data structures, I'm indeed good in parts which I have used! I haven't used AVL tree in any of my projects so I don't know, nor I have ever used bitwise ops!
I think I want to get into roots of ML (some people say I'm fickle but IDC), I think if I take the above job I may loose my interests or may not have time, Please advice.
(sorry for the tags but I need advice from people for all these fields)10 -
Another dark theme with Monokai conversion achieved today. I feel like I'm leaving this world in a better place.
-
some people apparently like really low-quality shitpost videos made-to-order. (MTO is loose here, i get a vague idea of what they want and a source, and i try a few things and bounce them off the requester to get a direction, then do that again with a vague direction to narrow the direction, etc. until requester is happy.) I've made 3 so far, 2 have been MTO and i have no idea what the appeal is at all. In-joke manifestations? Power trips? Wasting my time? I really have no idea...2
-
Here's my latest and greatest(ish) post:
How to overcome GDPR ... with data leaks.
https://loosy.gitlab.io/2019/10/...5 -
Friday afternoon.
Close to finish a Task that took quite some time and research.
Loose connection to Server.Try some stuff.. Eh, okay restart.
Can't login. Windows account is banned. WTF?
Now I have to spend the whole weekend with this close to be solved problem in my head.. -
!rant
Someone posted a link to a 30-day-security-challenge here on devRant some time ago and I just thought well, why not try to migrate away from the big companies - I've been using OneDrive as my only cloudstorage since the time when it was called SkyDrive and I've been hosting my Emails at outlook (via Live Custom Domains, a service that does not even exist anymore) for about 8 years now. Since I've always been lazy and since exchange activesync is a great feature if you have multiple calendars and want to sync them and your contacts to several devices I never tried to switch but now I am half done with migrating my data to my own nextcloud installation and my emails to my own mail server - since I don't want to loose the exchange functionality I am also setting up Z-Push and oh boy, this thing is bitching around but my webmail is already nicely integrated into nextcloud, IMAP / SMTP is up, configured and secured (still have to mess around with spamassassin as this email adress is floating around the web for about 10 years now). The only things to do is to get Z-Push work with STARTTLS and the card/caldav backend running and then the basic setup should be done.
I am just wondering if someone could hand me over a guide on how to sign / encrypt emails (GPG?) -
Fucking hell. Have a question regarding intellij idea and configuration sharing in GIT. In our project we have target application configurations which are in workspace.xml so we shared workspace.xml in GIT, which was a big mistake. Now with every commit a new workspace.xml gets commited. If we remove workspace.xml from git then we will loose target application configuration.
How to fix this?
We want to share target app configs but we don't want to spam each commit with new workspace.xml changes synced from local repo.8 -
Im starting to loose interest in development, im afraid im stuck inbetween the part where im getting confused on what i really love!1
-
So we are 8 devs in our scrum team but 2 major refactors felll on my shoulders (initially they were supposed to be fairly simple tasks, but like that malcolm in the middle video 2 tasks became 10 tasks in the past month) and I have been working from 11 am till 4 am for the past 1 or 2 weeks. Just yesterday I worked until 7am. Slept only 4 hours... Trying to play it cool, since I asked for a raise 5 weeks ago and still waiting for answer.
I havent told anyone because partially its my own stubborness of wanting to learn things and not wanting to bother others with questions, but Im starting to loose it.
And all because my pushed initial features resulted in unexpected blockers so scrum team leaders had an all hands meeting and my newly appointed teamlead started shitting bricks.
Meanwhile all other devs pick a low hanging fruit tasks and sit around for 2-3 weeks while I have to do heavy lifting alone with some guidance from other devs.
We dont even have QA resources. We have 2 new hires who will be useful maybe after 3-4 months and we have 1 QA guy who judging by his output is working part time. Also same guy managed to take 2 weeks of vacation in the past 4 weeks.
So due to lack of QA and due to code reviews taking long time it takes over a week for code to be reviewed and tested and each time if a blocker happens I have like 2 or 3 days to rush until end of the sprint in order to fix the feature for upcoming release or I have to move tasks to another sprint and feel bad about spillover.
Imagine implementing something in 2 weeks, just to wait for another 1-2 weeks for changes to be reviewed/tested and now having to fix blockers. And then teamlead comes up to you with being surprises how come shipping of this is taking longer than 4-5 weeks? Dude, I did my fucking part in 1-2 weeks, its not my fault that other devs perform code reviews late and they dont even launch the app to test. Its not my fault that we have very limited QA resources and our only QA guy is not even testing out everything properly.
Seriously Im starting to fucking loose it. We are basically 8 devs in a team where 2 people are doing all the heavylifting. -
Spend like 3 weeks in mem-checking with valgrind and ASAN, because there seemed to be some leaks. So painful and scary. You loose all confidence in your software, the checking tool, your own sanity.
Some spurious result prevailed, could only move it around. Boss could not reproduce the problem on his machine; Ubuntu 18 with GCC 7, mine was Debian 9 with GCC 6, so I tried older Ubuntu with GCC 5. Also no problem.
Fuck it, I'm switching to clang.