Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Get a devDuck
Rubber duck debugging has never been so cute! Get your favorite coding language devDuck
Buy Now
-
I don't understand why every non-technical person who comes to do work in my apartment messes up my fucking router.
The cleaning lady - multiple times knocked the antennas partially off. Like fucking clock work. I don't get it, why is the cleaning lady attracted to my router antennas and why does she need to be so hard on them? Whatever.
The most ridiculous episode was today. And it wasn't the cleaning lady. I had a few people here doing some work today and the woman in charge who was here informed me before that they might have to move the furniture "a little."
I come home, and like a bad omen, the plastic parts on BOTH my router antennas are missing. Completely gone. It's just the the wires. Now, the router still works fine in my tiny apartment, but it is a fancy Asus router (I learned the hard way not to buy cheap routers) and I'd like it to not have fucking wires as antennas.
I email the woman (paraphrased):
Me: hey, it seems the antennas got knocked off my router, do you have any idea where they might have went?
Her: Apologies if we didn't put everything back (no shit you didn't, that's why I've had to email you). If we knocked the antennas off the router (fucking "if"???? I literally just told you in my email that they were knocked off) , they are probably somewhere by the window on the floor (they weren't).
And I still haven't found them. Why the fuck do these people seemingly attack my router? I can't figure out what it is about it. You would think people would be more careful around electronics but naaah. Anyway, going to go keep looking for my router antennas.
42 -
Friend: Hey, can you fix my laptop? The hard drive is almost full.
Me: (Looking through his folders) Maybe it's because of this. Why do you have 3000+ files in your downloads folder? Maybe I should delete some of this.
Friend: No no, please don't touch the downloads folder, I have some very important documents there.
Me: Why don't you move them to a separate folder then? You should organize the ones you actually need and delete the rest. This folder is a complete mess.
Friend: No no, the problem is not the downloads folder, there must be something else. Can't you just uninstall some programs to free up space?
Me: I could, but I don't know which ones you actually use.
Friend: What? You should know!! You studied computer science for this!!
Me: First of all, there is not a single class in the whole 4 years of university called "How to uninstall programs and free up space on 128GB hard drives of shitty €400 computers". Second of all, I don't know why you were expecting me to find a magic button on your laptop that immediately frees up all the space in a hard drive without actually deleting anything. That's not how computers work, you know.
Friend: Hey if you didn't want to help me you could have said so in the first place.
Me: FML20 -
We were talking about harddrives at work when someone was wondering if filling them with helium would make them spin faster... Then imagination took over!
"But helium balloons float, right... So would helium filled hard drives float..? Probably not due to weight but imagine dropping a hard drive and seeing it float towards the ceiling.."
"John, the delivery guy has a box with new harddrives downstairs, could you go get them?
*shouts* John did you get them? Just don't open the box outside!! No, no, NOOO DON'T OPEN IT OUTSIDE! JOHN, THE HARDDRIVES, BE CAREFUL, DON'T OPEN THE BOX OUTSI.....
*harddrives floating by the window into the air*
NOO, JOHN, WHAT DID YOU DO?!
"*walks into the office, harddrives floating against the ceiling* goddammit John, not again"
"John, why are you putting one kilometer long cables on those harddrives?
*John let's them float into the air towards the clouds*
We offer cloud storage!"
(We have a usual office building ceiling)
"John, I need a 1tb harddrive, where are those?
Uhm... C12!
*takes a ladder and walks towards c12 to pluck one from the ceiling*"
😆9 -
The worst part about devRant is the inability to explain to non-devs why I'm laughing so hard at something.
This is also the best part.3 -
Not a specifically dev related story, but absolutely rant worthy.
Today I was working from home, and my wife called me to tell me that some awful person had thrown a young cat into the dumpster at her work.
To that person - you are a scumbag. You’re lucky no one left you alone in a hot car as a kid, let alone a dumpster. Seriously, why? Why is it so hard to take it to a shelter?
Anyway - I went and bought a whole bunch of cat stuff - I grew up with cats but I’ve never had one on my own. We’re at the vet now. I think we’ll name her Curry (after Haskell Curry, and lovely spicy dishes).
22 -
WHY THE FUCK IS IT SO FUCKING HARD FOR THESE CUM SUCKERS TO UNDERSTAND THAT CHANGING REQUIREMENTS 2 DAYS BEFORE THE DEADLINE IS JUST GONNA BREAK EVERYTHING!?!?
I DOUBLE DARE ANYONE TO TELL ME ITS NOT WORKING TOMORROW...
STUPID MOTHER FUCKER PMS CANT PLAN ANYTHING6 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
*Overhearding Convos*
A : "Dude, have you tried vim? It sucks!"
B: "I know right, why do they have to make it so hard to use..."
Me whispering : Git Gud Boi...10 -
Recruiter: I see you got a good degree, however, what were your high school results (A-levels)?
Me: why would you need them?
(they were average, but I tell the recruiter)
Recruiter: Oh, so you were pretty lucky to get a good degree.
Me: No... I worked really hard for it.
Recruiter: Anyway, my client only deals with people who got high grades in high school.
What the fuckkkkkkk?
#stopthismadness20 -
After weeks of hard work creating a website:
It looks so beautiful 😭
*opens in a different browser*
WHAT THE HECK! why is all my divs flying here and there !
*opens in mobile*
f*#k this9 -
I was so stupid back in days, that I once decided to defragment my hard drive and move data between partitions at the same time.
Guess what? I ACTUALLY DID IT.
System went slower slower....
Everything stopped working. I wondered why? 🤔
Laptop did not boot up. Struggled for hours, before realising the fact that it is dead forever.
YES, I NUKED MY HARD DRIVE. ALL DATA LOST AND MOTHERBOARD STOPPED WORKING.
Couldn't be proud of myself. 😎 Because it was a great learning experience.
Learned it hard way.15 -
All web developers should support up to IE9 without any problems.
Why? Because in Korea, it is normal.
Every person uses that damn Win7, which has either IE9 or IE10. Without IE support, no one will browse your webpage.
Now you would ask us, why don't you use other modern browsers?
We would then ask you, why would you install a new browser that is
1. Buggy
2. Heavy
3. Takes up ram
4. Has so many features
when you have an awesome minimalistic browser that is preinstalled, and works in all Windows? No thanks.
So, if you put a message saying you will soon drop support of IE, it means that you won't target Korea. Just after the support drop, there won't be traffic to your web site.
So what is the point of this rant?
1. We love IE. Lol
2. IE is lightweight, minimalistic, and the fastest browser in the world.
3. All websites should NOT drop support for IE.
4. We don't care whether web devs will have a hard time. We just think websites are built with Wix and Wordpress, and they work in IE, meaning, IE support is the number one priority.
5. If you ever start a business in Korea, and has a website, make sure to hire an senior Korean web dev who has worked with IE for a long time.
6. Here is the tl;dr
Hate us. Period.27 -
Story time. Rant time.
MY MANAGER IS A ROTTING STINKING PIECE OF SUN DRIED TURD.
My employer provides us with 27 days of paid leaves. But whenever, we ask for a leave, motherfucker gets pissed off for no reason.
And before and after the leave, makes us beg for death by giving hell lot of work and mentally harassing us. Why? Because he is angry that we ENJOYED our leave.
Worse? The donkey dick never takes a day off. And if he has to, under no circumstances, he punishes us when he is back. Why? BECAUSE HE WAS ON FUCKING LEAVE. GOD FUCKING DAMN IT.
I wish to punch him so hard in his face that he takes few months off completely.
We make sure the work is not affected and IT'S OUR FUCKING LEAVE. THE COMPANY DOESN'T HAVE ANY PROBLEM, WHY THE FUCKING HELL DOES THE DONKEY DICK HAS TO MAKE FACES FOR IT LIKE A TWISTED TURD?
SOMEBODY KICK HIM IN NUTS PLEASE. REAL HARD.
Any Hitman here? Get in touch as soon as possible.15 -
Yet another rant about crappy electronic designs.
Just now I was cleaning my desk and stumbled upon some old hard drive in a caddy that I still had laying around.. I figured, let's plug it in and see whether the drive still works. And to some extent, it does! Except that every few minutes it craps out on me. And after disassembling the caddy, I think that I know why.
Just as background information, hard drives work at 12V and generally require about 10W to spin their motor. Meanwhile USB operates at 5V. So a boost converter needs to be present in the controller to step up the voltage and power the drive.
Now what's a boost converter? It's an inductor, a capacitor, a transistor and a diode in a specific arrangement (if you're interested in the design, check out https://youtube.com/watch/...), along with feedback circuitry to stabilize output voltage. Now that transistor is important.. it switches at very high frequency, and its rise and fall times create heat. In the particular transistor used in that controller, it apparently causes the transistor to operate at 65-68°C. That's quite toasty IMO, and overheating may be why the controller is so unstable. But the Chinese manufacturers thought that it's just fine and okay to be sold without heatsink or some research into transistors with better rise and fall times.
So the hard drive craps out on me and yet again it's because of certified shitdesigns. MOTHERFUCKTURERS!!!!27 -
why is it so hard to convince people to start using slack chat and giving up sending internal emails?10
-
Friend asked me to create server on raspberry i said ok continue he gived me 1 TB usb hard drive he said "This is where you will create partition for each host and run emulated computer on it so no clients can see each other but it will emulate intel core i7" then i stoped him "are you serious emulate i7 on arm processor are you idiot its imposible started to laught and walked away" next week he asked to create app that run iOS on android well fuck why ???😭😭😭😭4
-
HoD in my college is a "22 year experienced C programmer" with a PhD in CS.
One day I went to him and told, it is very hard to work with TurboC, and it isn't needed as we can easily migrate to GCC.
He asked me why was I complaining. No other student has any problem. They have been using it ever since the college started and everyone was "comfortable" with it.
I stood silent. He then went on to say, even JVM was coded in TurboC. I nodded and left the office as i didn't have an argument.
He's the same guy who had earlier said, "printf returns an array of characters printed", so I guess everything works here.11 -
- If I buy x amount of ram | hard drive space | cpu power I will never need more.
- No need for version control | Tests. This is a small project
- git commit -m "changes" (its a small change. I will remember why I did it)
- It is too obvious that I put a lot of personal time in this so my boss will definitely notice!
- Why comment this simple method? Anyone should know what it does. Especially me!
- "this should never happen"
- This call can't be from work. Everyone knows I am on vacation.
- I will back up next week. It's not like it is going to crush today.
- It’s 11:30 already? I will work on this for only a half hour more and then I will definitely go to bed!
- This project will take x amount of time!2 -
Working on a project where the coordinator is insisting on using OneDrive. Lost the link he sent out in an email so decided to:
- Google "OneDrive": Eventually brought me to "office.live.com/...." with a view of my settings and apps ... no OneDrive.
- Spent a while using a bit of logic to click around and find it, forgot logic doesn't work well with MS products and ended up on Outlook instead.
- Spent a while searching for the original email with the link, found it, brings me to "...sharepoint.com/....".
- Inside sharepoint (OneDrive?) the banner says "Office 365".
- But the browser tab says OneDrive.
Are Microsoft just afraid of consistency at this point? I mean seriously, pick a name and use it everywhere. Why is that so hard? why is that so complicated?6 -
Really, I hate this composer / bower / npm shitholes!
Why the hell is my app 300MBs?!? Because that shitty pudding composer decided to download the ENTIRE git including README.md, examples, 5 hours of assembly-giraffe porn, my granny's pajamas and two wraps of kebabs!
How hard is it to define the folder that contains the REQUIRED library so that our project might stay at 5MBs instead of 300?18 -
I hate this fucking front-end stuff so hard..
How DA FUCK is it possible that I set up the whole backend including DB connection, base controllers, models, base validation and stuff in an hour but don't get this fucking fucking retarded JS framework piece of shit to display a test string after ONE FUCKING HOUR!!!
Why do we need this shit anyway? Why does everything have to be shiny with some fucking animations???
It's about the information, isn't it? Then WHY DOES IT HAVE TO LOOK PRETTY???
I gonna travel back in fucking time to the early 80's!
Stupid front-end shit..23 -
Why do users find it so hard to understand short and clear error messages that are in place to inform them what's going wrong? Why do they instead waste my time when the message clearly says that the password is too short and hasn't got any special characters? FFS!5
-
The keycap of the control key of my keyboard just popped of and fell under the table.
My colleague then said while I was looking for it: I think you've lost control!
And we both laughed way to hard and so loud that our boss came over to ask why we where laughing. xD
it's not even that funny but we couldn't pull ourselfs together xD5 -
The guy where I can only shake my head when I see his code, and he is really proud of if implementations, while he
- doesn't care about warnings
- breaks builds and doesn't care
- doesn't care about code styles and indents in a very column based way
- adds tons of comments to his code, mostly hard to understand, and sometimes that much you can hardly find the code
- implements a tokenizer where you have to inherit from its interface (Why would I wanna implement whole functions for a tokenizer and not just use it in place where needed? How do I use two of those in one class?)
- implement a "generic" state machine base class with fixed lengths array of 3 events and 3 strings (Why would I need events and strings hardcoded in a "generic" state machine? Why a maximum of 3?)
- once delivered a software without the needed runtime components, so the whole system (embedded device) wasn't working properly and only by chance missed the point of disabling update mechanisms
- make your ears bleed about his big inventions whenever he sees you, no matter how often he already told you about that blazing new feature5 -
Interviewer: So which university are you from?
Me: I am from "foo" university.
Interviewer: So why did you not go to "bar" university?
Inner Me: Wtf kind of a question is that. Why the fuck aren't you a unicorn with pigs flying out of your ass and a globally reknowned researcher at Stanford?
We all end up where destiny takes us. Some of us try very hard but things don't magically happen for us. We keep trying but at the end of the day you end up where you end up.
Real Me: I just finished my High School and had the entry test the next day. I was not prepared at all.4 -
Client: why do I have to use such a hard password for this website?
Me: For security reasons to protect your content and identity of your clients.
Client: Can't you just use the password that I'm used to? I use it on my banking software, and I've never been hacked so it should be good enough for you!
Me: what's the password that you want me to set up for you?
Client: you ready to take it down?
Me: go ahead.
Client: T ... U ... R ... D. You got that?
Me: ... Yes ...
*sigh*5 -
It's only day one of the year and I'm already pissed right off
Why the fuck do all clients expect you to come up with absolutely everything!?
All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.
Well what are they?
Pft.. I here is a name if our products. And other stuff
WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES
Yeah do you want them
Of course I do 😐
Great here's 2 of them we have 1100 so I'll get more to you soon.
😤 Thank you!
Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough
I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site11 -
Me while strugglin CS College shits
*1st year looking at programming jokes / memes*
Me : I don't get it, it's already hard enough and I must try to understand the jokes? 😐
*2nd year*
Me : *strugglin with group projects and wondering why I'm still here*
*3rd year*
Me : *strugglin to keepin my grades so I can graduate in time, startin to looking for internships / jobs...
and then...found out there's an app named devRant*
Me again after scrolling devRant for 2 days : "I get it, these whole 3 years studying CS just so I can understand better these programming / dev jokes 😂😂"
*But still stressed out*4 -
I see many people being irritated when it comes to StackOverflow and If I were to be honest I thought the same a while ago. But I noticed that I was misjudging the main point of Stackoverflow. It's not a forum to help people with their programming problems. It's a huge self writing document to gather every programming related questions and answers under a single platform if possible. That's why they won't down vote you even if you ask a question that was obvious in a language's official document as long as it wasn't in Stackoverflow. That's why questions should also be formatted accordingly which is clear and also informative in itself. I understand why stackoverflow is such a harsh place to ask questions and most of the time I prefer looking things for my self instead of asking a question. And I edit and review most questions on stackoverflow because I enjoy it. That also made me realize that stackoverflow needs to be elitist to preserve it's current quality. Who would want to see unclear duplicate questions that veteran stackoverflow users need to answer over and over again right ?
Asking the right question is hard because we humans most of the time don't know what we don't know. And it makes it really tiring to format your question the way that is fitting for a document. In those times I prefer to ask my questions on a more relaxed and chat focused platform before writing my main question on stackoverflow.
So that was my opinion on stackoverflow and it's harsh environment. It's definetly a hard to get into community which I can't even say I'm really a part of it. But looking at stackoverflow as a document that's being written by ut's users, it's easier to understand it's elitist approach. I hope you had some enjoyment from reading it.6 -
*spends a long time crafting a huge eBay post (we're moving)
* tries to drag and drop first picture
* page navigates to the picture without warning
* loses everything
WHYYYYYYYYYYYYYYY
WHEN DRAGGING A PICTURE INTO A WEB PAGE I NEVER WANT TO NAVIGATE TO A PAGE WITH JUST THAT IMAGE. WHY NO WARNING BEFORE LEAVING THE PAGE. WHY DON'T YOU SAVE TEXT LOCALLY. WHY DOES THE WEB SUCK SO HARD. AAAGGGHHHH.
* feels better
* starts over8 -
Apple iPhone testing without being on the app store is so annoying, I had to sign up some people to test the app I've been working on and had issues on my end, it really is this whole security bullshit, really it isn't needed.
I couldn't get the team provisional certificate thing to show up because when I clicked the account the team certificate settings would disappear, only after right clicking and hitting help then clicking the team while it was selected could I go to the right window.
I don't see why it's so damn hard to do this crap.
Yet with Android, it's so easy.
I really have issues with the testing for this iPhone app, I went through so many different ways to try and get it to work.
Anyways all done, crashlytics is an awesome testing tool if you can get around that small issue I had.4 -
Why its so hard to understand that - not always... - frontend devs will give you a sweet ui with medium back end and back end devs are gonna give you a medium ui with sweet back end?
Why can't we just do what nature made us good for and work in collaboration?
Fuck7 -
As a self taught C programmer starting comp sci in University, WTF is all this object oriented-ness. Constructors, parents, children, inheritance, polymorphism... I feel like more like an anthropologist than a programmer.
(But really, I get why it's better. Just so hard to learn)14 -
It's 2017.
Why is vertically centering a div still so stinkin hard?
Yeah yeah ik what you will tell me, "use flexbox".
Well guess what,. I HAVE BEEN TRYING TO FOR THE PAST 6 FUCKING HOURS!
I've gone as far as to copy code from 20+ different websites advertising working solutions. My tab bar looks like the fucking rockey mountains!
My main problem is that flexbox on chrome is not accepting ANY % values.
Now if you'll excuse me, I need to go kill myself. YAY! 🤗29 -
I couldn't sleep. I was staring at the blinking cursor. A slow, comforting blinking. Like everyone else, I had become a slave to the JavaScript ecosystem. If I saw something like a new build system, or a new framework, I had to have it.
My client changed the requirements again. I'm in pain.
- "You want to see pain?" my colleague said. Go read Apple support forums. That's pain.
I became addicted. Every time I died and every time I was born again. Resurrected.
During the night, I was crying in the Apple forums for an official answer that would never come. During the day, I was surfing StackOverflow to fix my problems. You get "single-serving" friends there. They help you, you help them, and then you never see them again.
- "Then you install Stack and boom, you're done. It's that easy to go functional."
That's how I met him.
- "You know why they make so many javascript frameworks?"
- "No, why?"
- "So that they can distract you while they put backdoors in them. So that you don't have time to check all of their code".
- "You are by far the most interesting "single-serving" friend I've ever met"
Then, my hard disk died. Of course, I didn't have backups: nobody has enough space for all those node_modules folders. All my addictions, lost.
Then I wrote him. If you asked me now, I couldn't tell you why I wrote him. We chatted a lot.
- "It's late, I should really go search another hdd on ebay"
- "Ebay? You called me so you could have my old hard disk."
- "No, I..."
- "Come on."
He sent me his old hard disk. It was a 256MB hard disk, but it was fine for running Arch. Then he asked me to rant about my problems in front of him.
- "I want you to rant as hard as you can"
- "Are you serious?"
We ranted all night about our bosses and clients and their fucked up requests. We kept in touch, and after a while more people were ranting with us. Every week, he gave the rules that he and I decided.
- "The first rule of devRant is -- you don't talk about devRant. The second rule of devRant is -- you don't talk about devRant."
I like to think this is how devRant started. This might also be the reason why we never see @trogus, only @dfox. A lot of shit still needs to happen.8 -
This one crazy:
We made an app for our client to scan some parcels via barcode.
They just created a ticket, for complaining that it's hard to scan in the storage room, because it's so dark. They are like sometimes we need to use a torge to scan. Can you increase the contrast of the app or something to scan better in darker place.
Did not know what to answer, but my thoughts were like: why the fuck you don't put enough light in that room?! 🤔🤷🏽♂️8 -
SICK AND TIRED OF READABILITY VS. EFFICIENCY!!!!!!!
I HAD TO SEPARATE A 4 LOC JSON STRING, WHICH HAD AN ARRAY OF A SINGLE KEY-VALUE PAIRS (TOTAL OF 10 OBJECTS IN THE ARRAY).
ITS READABLE IF YOU KNOW JSON. HOW HARD IS TO READ JSON FORMAT IF YOU GET YOUR STYLE AND INDENTATION PROPERLY?!?
SO I HAD TO
BREAK THE POOR FREAKING JSON APART TO A FUCKING DIFFERENT YAML FILE FORMAT ONLY SO I CAN CALL IT FROM THERE TO THE MAIN CONTROLLER, ITERATE AND MANIPULATE ALL THE ID AND VALUES FROM YAML BACK TO MATCH THE EXPECTED JSON RESPONSE IN THE FRONT END.
THE WHOLE PROCESS TOOK ME ABOUT 15 MINUTES BUT STILL, THE FUCKING PRINCIPLE DRIVES ME INSANE.
WHY THE FUCK SHOULD I WASTE TIME AT AN ALREADY WORKING PIECE OF CODE, TO MAKE IT LESS EFFICIENT AND A SLIGHTLY BIT MORE READABLE?!? FML.5 -
Why is it so damn hard to get publicity for an open-source project? I mean it's almost impossible to get anyone to even notice you. I've been trying to promote my project in every kind of social media imaginable and still I can't reliably get 50-100 unique visitors to my Github repo in a day. I thought writing the code was the difficult part, but clearly the no-budget marketing is what will be my demise.24
-
My previous manager: "Your code should hard to read, so our work is cant stolen by everyone".
Me: "Why?"
My previous manager: "Just do it"
Me: "Okay"
So, anyone can answer my 'Why?' question?
P.S: My previous Manager is PHP Programmer13 -
every day I get phone calls from some idiot to moan about something I fixed.
I had a job to copy a site and use it for another company, with everyone's consent. I do it and found the original was garbage. hard coded functionalities. limited control over which pages appear in the menu and so on.
problem is the site administrator doesn't understand the system and made pages visible on the menu that shouldn't be and so on. these never showed up before because it was broken.
now she phones every day because she setup her pages wrong originally and tells me stuff like, why did you change this, it worked before and crap.
I never expected she would have setup the pages incorrectly so I never thought this would happen.
lesson here is if it's broken and you're the only one that's noticed, just bloody leave it.1 -
Why is skids trying so hard when it comes to talking shit about Windows? Do they think that is it the only way to get accepted into the GNU/Linux community?
Personally, I think people who does that look stupid and dumb.9 -
Lesson number 1 on 3D printing.
Tighten your fucking nuts every 2 weeks.
Why ?
The fucking infill will shake the printer to its death if you dont. I was wondering why my X axis was rotated to the left a lot. Leveling sensor didnt read the bed and crashed into it hard making a hole in it.
So if you have a 3D printer and you didnt tighten the nuts. GO FUCKING DO IT NOW !!!!10 -
Why is it so hard for a person to admit that they're at fault and listen for a change,
For the nth time I told a certain developer to install a git gui, the answer is always the same,
"It's such a hassle to install one"
You know what is a fucking hassle?
Fixing your fucking mess is a hassle,
Resetting the wrong branch you overwrite is a hassle,
Cleaning up your merge conflicts is a hassle,
And doing all of the above just before going home is a fucking hassle,
Fuck it, it's only a couple of days before I left for good anyway,
🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻🖕🏻6 -
I had a manager who scolded me in me in public on a non-IT floor because I used child classes and overloading of methods which "is too hard to read". Instead use "lots of ifs and else's". This is the guy that had a JSP so large (be cause he had so many ifs) that it couldn't be compiled even on a server.
The best karma happened a few months later. I was looking for a new job (wonder why?) and was very deep in the interview process - like round 5- of company A. I got talking to this jackass, who had no idea I was interviewing, said "yeah I applied to company A once. Couldn't get past the first round. Great benefits, though.". Me getting the job a week later was the best thing ever. -
Why the f*** was the computer industry not able to contract to common line endings? The trouble started many years ago when I was coding scripts on my Windows machine and they were not every time able to run on a Linux machine. Well I then somehow learned on the hard tour that this is due to wrong line endings. Thought that might be the last time I've seen such problems in my career...
And 10 years later I was going to migrate from CVS and SVN to git, and BAM: the f****** line endings appears to be causing much more problems than in all the ten years before. Why? I ask why is this still necessary in 2017 that a dev has to think about the line endings anymore?? This is so 1991!!!7 -
I'm planning on writing an open source (and much improved) version of my logger, but I'm stuck on picking a name :<
So, anyone have naming suggestions for a tagged and branching/nesting logging library? (ES6)
(I don't think "deforestation" is a good choice. sounds kinda bad.)23 -
Hi yall! I've been here a while, but never actually posted anything. Love reading your rants though, always makes me giggle^^
Anyways, I'm a IT student and I got this new job as an IT-consultant.
So we had this big meeting today, together with the CEO and a lot of other new employees with different engineering profession... So everything went fine until the end. We were supposed to stand up and say our names, what we're studying and tell a fun fact about ourselves and I TOTALLY fucked it up... I kinda said my name, I completely forgot to tell what I'm studying and my fun fact was something about ppl having a hard time with my name. Like, wtf are you even saying dude?! All I wanted was to was write code, why can't I just do that?4 -
I'm doing my own sci-fi D&D story and need some new weapons! So why not use programming names? 🤔
So far:
voidpointer
nullifier
destructor
finalizer
One player is also a dev and I want to trigger him as hard as I can 😈6 -
Me trying to take a screenshot with iOS 12:
*holds home and presses lock* (the only way I had found to reliably take a screenshot in previous versions): Siri
Fuck off Siri I want a screenshot!
*tries again same way*: Siri
Fuck OFF Siri!
*holds lock + home*: phone locks
Christ almighty.
*unlocks phone, presses home and lock at the exact same time*
Nothing happens.
*continues holding* I just want my fucking screenshot.
Phone powers off. Hard reset.
Fuck this shit.
How hard is it to monitor two buttons being pressed at the same time? And if it is so damn hard why make it the ONLY WAY TO TAKE A SCREENSHOT??!
Now whenever I want a screenshot it’s basically a crapshoot whether I will get a screenshot, Siri barging in, or my phone locking on me.
Couldn’t they have just used the volume buttons instead? 😡13 -
I don't get people..
He is a good person and and realy tries..
Tries what?! To annoy coworkers that have to fix every single thing he does?!
Some people will justify anything with 'he is a nice person and tries hard'. WTF?!
So if someone is a nice person, likes to talk a lot, has 'good' social skills but writes crappy code he doesn't test at all.. or tests and see that it's glitchy and still doesn't fix it.. so he is a good worker for that?! Dafaq?!
So if he is a 'lovable' person, he deserves to be here, doing more damage than helps.. he deserves to have a job, with same pay (or even more) than me?! WTF?! How?!
Why is this ok?! If we were heart surgeons and he killed a person or two due to lack of skills or negligence, what would happen?!
He'd get fired on spot!! Why can't it be the same with devs?!
Why on fucking earth do we need to put up with people who try their best and fail?! Especially if their best is lowest of all, lower than the 'I don't give a fuck, just doing sth so the boss stops nagging'?!
Fuuuuuuuu!!!!
But ok, some people are not cut out for some work, I get it.. but why the fuck do other people justify that with 'he tries'?! Dafaq?!
Maybe next time 'I'll try' to perfom brain surgery on you..and you'll end up a fuckin plant.. is that ok with you?! I'll be trying (not really) and do my best (well I will try not to use a chainsaw when cutting open your head).. will that be ok with you?!
Fuck!!6 -
It's the 21st century. We have this amazing thing called the Internet. It's literally at our finger tips. Any information you want can be found with the tap of a phone screen, and the information will be presented to you in less than a second.
Why is this concept so fucking hard for people to comprehend? Instead of asking me "How do I write a resignation letter?", search the damn internet for resignation letter guides. Like Jesus Christ, it's not that hard of a concept to comprehend. Especially when you've basically grown up with the internet in our lives.1 -
What I don't understand is why it is so hard for some seniors to just let me jot my notes down, I get it you're busy but if you just let me write down certain key words, I will never ask you this question again, I am nervous cause I had to bug you for help so my mind is not taking anything in, its freaking out cause you're making it so clear I am a bother! So I'm gonna go back to my desk without notes and no idea of what you just tried to tell me.... It was never a problem for my first senior, and he even became my mentor! In a question of 6 months he could go on holiday cause I could handle all his responsibilities until he came back with my trusty note book in hand... So why are you telling me to stop making notes!! It works for me so leave me be!! - sits at desk, pondering why I exist - 😖16
-
Fuck Xcode!
Why does every single and small update need to be at least 5GB? And why am I required to update you so fucking often? You are not fixing anything, so don’t even pretend to! Most of the time it is just to support the latest .x update in iOS. Can’t be too hard to update the SDK without updating the entire shit IDE! 😡
And guess what: I JUST UPDATED YOU, SO WHERE IS YOUR FUCKING NEW VERSION??? HOW CAN I WAIT 45 MINUTES AND AFTER THAT YOU DID NOTHING!?! HOW CAN I HAVE THE SAME VERSION AS BEFORE??? NOW I HAVE TO DOWNLOAD YOU AGAIN YOU FUCKING PEASE OF SHIT 😡😡😡1 -
Why is it so hard to just build machines that work without all this ideological bullshit? Code doesn't care if politics==true. The world is scary enough without you assholes making modern life a data minefield for even the most educated experts, and taking advantage of the ignorance of everyone else. Fuck you.
I just wanna <look at web pages> without having to consider, counteract, or silently assist some fucking regime. Why is EVERYTHING this way? Everything is a back door or a data mine or a political statement? This isn't a fucking art piece! It's not your espionage tool, fucking codes in invisible ink and tiny cameras and shit everywhere! It's a <web browser>, and if it does ANYTHING besides <browse the web> that I didn't explicitly tell it to do, you better better not be the one who made it. Because if you did, you are what's wrong with the world.7 -
Metaprogramming maybe easy to write but is so fucking hard to read and harder to maintain. Why do people even like these dynamic languages anyway :-/
*a very loud and miserable groan which may be cry for help*
I hate my life right now.5 -
Helping a friend who's a brilliant at mechanics and has his own patents, and got this question when downloading on his 10Mbit line:
"This was supposed to be a fast computer, so why is it taking so long to download?"
To explain the reason was surprisingly hard, considering that this is a guy who's been invited to give a lecture about innovation at a top tech university.1 -
This happened when I finished highschool.
I was looking for a programming related career at university, and I had two options: Computer systems engineering or Software engineering. I commented this to my mom.
Me: Mom, this university offers Software engineering. The thing is that the campus is 1 hour from the city and it’s a new career, so I don’t know if it’s a good idea or not.
Mom: Why Software engineering? Don’t you want to be a developer?
Me: Yes, that’s why I was thinking of taking Software engineering
...
Mom: Is not “Software” what is inside the computer? (Inside the chasis on desktop computers)
I started laughing so hard 😂 and, of course, I ran away
4 -
First story (not rant) :3
So I was asked to set problems for an online programming contest for my college (I'm a sophomore)
The participants were students from my college.
Teacher told me "make as hard as you can"
I gave it my all.
:|
1 person solved the first question. Nobody solved the other four. :|
Not sure if I should be proud or sad.
And if you're wondering - here was my first question -
Sam wants to invest in real estate. He's got X dollars to spend. He knows the expected value per square meter of a given property. He knows the coordinates of the vertices of the polygon shaped properties he's interested in.
(both the values and coordinates for each property are given in input)
Find the maximum return on investment he can get.
(answer is, basically you calculate the area of each polygonal house using half the vector cross product, multiply it with their expected value per square meter, and then apply a dynamic programming - knapsack approach)
;-; I really thought it was a nice question man. ;-; I put so much thought into others too. ;-;
Got ignored. ;-;6 -
So I need to let off some steam, let me know if you think I need to calm down. Personally I'm just having a hard time understanding my team lead.
So I've been trying to update our codebase for the past two months so we run tests against the latest versions of each respective major browser. I've also been trying to cleanup our code and split it into logical modules.
Need I add, according to Bitbucket, I've written over 80% of our code on our 4 projects with 4 team members including myself.
He's out for a week, so I decide it's fine time to get some work done -- which is ridiculous in itself. I finish, add unit tests for crap I missed because he kept shutting down my PRs for shit he couldn't understand.
He tells me on Friday, when he got back, that he'll be declining my pull requests because my code is too complex -- my team lead -- thinks list comprehension and OOP in Python is too complex. Doesn't understand why we need to have pep8 lint tests, or why we can't just export one giant monolithic client package with over 3k lines of code.
Is it worth arguing or should I just let my department head know I can't work on this team anymore? He won't get talked to or fired, he's been at my company for 6 years and he's in the inner circle.6 -
Reset 65 passwords today already, a new personal best for one day! No idea why the reset password button is so hard for clients to use, aghh!3
-
To any and all family members, before requesting my help with the printer/computer/electronic device follow these steps to make sure I don't get irritated.
1. Make sure it's plugged in.
2. Turn it off then back on
3. Turn it off, unplug it for around 30s, turn it back on.
4. Request help
Why is this so hard to grasp? I don't want to stop my workflow with an issue that could be resolved in less than a minute!1 -
ŁEŊ@#fmęgwjnfčuÆ®ŊÆŁEŊ3ŋ4ħ€3łæŋ€4æł4ħæ4€ħ9æŋ98ł3ħŋ98↓łħ€9“→↓ŋħł93ŋ@38ŁŊ89ÆŁ4ĦŊ08ÆŁĦ093Đ3@09ŋæłęb„guwahęgawęgÆŁ$ĦÆEı$Ŋ(ÆŁ#Ŋ↑(łæ49↓ŋw
AAAAAAAAAAARRGGHHHHH!!!!!!!!!!!!!!!!!!!!!!!
I'm gonna break this laptop in half if I will not get a break from Windows!
I'm running it in a VM and STILL this fucker gets on my nerves SO FUCKING HARD!!!
1. CPU% 100%. Laptop fans are spinning so hard it's ready to take off
2. My hands are on the laptop. THey are HOT from the heat from inside. Hell that's uncomfortable!
3. ctrl+shift+esc to see why is cpu% 100%. It's something called WMI Host something. Kill that mthrfckr!
4. Process respawns immediately and goes up to 100% again. I have already increased handles limitation for that service a few weeks ago. Like 20x more than it was before!
5. website in IE
6. does not seem to be responding
7. hit f5. Nothing happens
8. Hit refrech buttong on the toolbar. Nothing happens
9. Place cursor at the address bar and hit ENTER. Nothing happens.
Meanwhile my hands are burning.
WHAT THE FUCK!!!
What kind of idiotic system is that!! My asshole is a better OS than this piece of SHIT!
AAAARGHHHHHHHHHHHHHHH#@ŦŊæ¶đ@#ĸogęq j
I'm super pissed. Better keep a 30-40 meters distance from me so the things I throw at you would not hit your ballz!
Now that I come to think of it, the only times I am THAT pissed is the times I am using windows. Srsly.8 -
I was not having much respect for out front-end developer, as the UI is not so good., yea. I know it UI depends on the designer.
Now the new design changed and our UI looks awesome.,
and I must say that my respect increased a lot when my pm asked him to fix the layout in UC Browser.
Fucking shit., in UC it is showing two lanes as one lane. I don't know why., he was working hard to fix that.
Massive Respect to him. I really happy by being backend dev.8 -
An online community I've been part of for years has seen a lot of popularity/hate overnight due to a new policy. The influx of new people who want nothing to do with us but just drop by to troll and be cunts is impressive. Also, a significant amount of bots. I want my online home back :( I'm for the new policy and very much against these new clowns who don't really have any reason to be on our page. Before anyone yells gatekeeping, it's a site about knitting and crochet. Why would you go there if you don't know either craft and have no desire to learn or talk about those? So disappointed. I hope it brought new crafters in and that the trolls will go away soon. It's been such a nice place for so long with barely any idiots because it was reasonably small.. And now look at this mess. I logged in to 20 friend requests from people I don't know and am almost certain aren't real people.
Why is it so hard for humans to accept that some people may disagree with them and that's okay?17 -
Sort of !dev
I can't do school anymore. I get so many panic attacks. I was shaking the entire time I was writing my essay today. It's hard to focus when your brain is fucking freaking out. I'm missing deadlines, failing tests left and right.
Real talk, I'm not dumb. This was never a problem. My University fucked me up and now I can't even look at an assignment without an electric feeling and I don't know what to do.
I had a panic attack during the opening crawl of Star Wars. I had to leave the theater. My anxiety is going to give me a heart attack one of these times. I'm 18, why am I experiencing health issues like this?
School isn't done right. How could this be the intended effect?8 -
Why you should always backup.
Nearly a year ago I developed a whole project (iOS, tvOS, watchOS), but I never backed it up because I had a recent machine and thought the chance that something happens to the disk is so small I didn’t backup. But then my mac didn’t start correctly. So I needed to reset it. Lose the project, some other files but not much else. Then I recoded the project and backed it up on multiple places. But a little later, I was writing another app, again didn’t copy again... This time I deleted the wrong folder and deleted the trash, was gone too. So from then I learned to copy everything I coded. All projects I work on, I keep a copy of on an external disk, GitHub and Bitbucket. Assuming they wont crash all at the same time 😉.
So I recommend everyone to backup all your code. Even if it’s only 500 lines. Losing it is hard...3 -
WHY???
WHY THE FUCK ARE YOU SO FUCKING SURPRISED SHIT HITS THE FAN EVERY GOD DAMN TIME A CHANGE IS MADE IN YOUR LIMPING SYSTEM?
YOU GAVE NO FUCKING SPECIFICATIONS NOR ANY CARE TO DECIDE ABOUT WHAT THE FUCK YOU WANT IN IT.
EVERY TIME I SEE THE CODE I GET EYE CANCER, DEBUGGING THIS SHIT IS AS HARD AS FINDING THE FATHER IN A HOBO STREET ORGY
AND YOU FUCKING THINK ADDING FEATURES INTO THE SYSTEM UNDER THESE CIRCUMSTANCES IS SO GOD DAMN EASY.
I hope life's god damn dandy for you, get fucked with a pipe bomb.
Oh, hello DevRant, sorry for sitting on the fence for the past months.4 -
Why is pointers... bit shifting.. malloc.. anything that is regarding embedded development is so hard to grasp...18
-
My best code review experience?
Company hired a new department manager and one of his duties was to get familiar with the code base, so he started rounds of code reviews.
We had our own coding standards (naming, indentation, etc..etc) and for the most part, all of our code would pass those standards 100%.
One review of my code was particularly brutal. I though it was perfect. In-line documentation, indentation, followed naming standards..everything. 'Tom' kept wanting to know the 'Why?'
Tom: 'This method where it validates the amount must be under 30. Why 30? Why is it hard-coded and not a parameter?'
<skip what it seemed like 50 more 'Why...?' questions>
Me: "I don't remember. I wrote that 2 years ago."
Tom: "I don't care if you wrote it yesterday. I have pages of code I want you to verify the values and answer 'Why?' to all of them. Look at this one..."
'Tom' was a bit of a hard-ass, but wow, did I learn A LOT. Coding standards are nice, but he explained understanding the 'What' is what we are paid for. Coders can do the "What" in their sleep. Good developers can read and understand code regardless of a coding standard and the mediocre developers use standards as a crutch (or worse, used as a weapon against others). Great developers understand the 'Why?'.
Now I ask 'Why?' a lot. Gotten my fair share of "I'm gonna punch you in the face" looks during a code review, but being able to answer the 'Why?' solidifies the team with the goals of the project.4 -
Why the fucking hell is it so fucking hard to find an Android phone without a shitty ass UI slapped over it?
Holy fucking shit this is fucking ridiculous.18 -
I now know why I'm a developer and not a designer, it's so fucking hard like it's goddamn bootstrap that shit is basically built for me but it still looks like an egg took a shit on a toaster
-
Thanks guys for the help in the last weeks.
This is what I was so hard trying to print.
Btw... reminder to self, plastic expands. That's why the stepper has duck tape instead of screws lol
33 -
Why is it so hard to build reputation on stackoverflow?? Can't upvote, can't comment til I get 50 reputation, can't ask for question clarification so I can answer a question except in a comment...6
-
Why is Drupal so hard to learn?!!!!!!
It feels like you are learning an entirely new language. Yes it makes hard things simple, at the same time making simple things hard to accomplish.
And also modules are buggy, you would fix bugs instead of doing your tasks.
I want to learn Drupal but I guess it is not friendly for beginners like me.11 -
Fact, that I am making websites does NOT mean, that I will make a website for you for free. Why it is so hard for people to understand?2
-
Create a new project in Xcode Version 10.1 (10B61) - Single View iOS app.
Drag a button on to the screen. It shows in InterfaceBuilder
Launch app in simulator. Button shows, then disappears. Noob says WTF?!
Poor noob has to ask me why this is happening and I explain that Apple's Single View project is a single splash screen project. The button they placed on what they thought was the single "window" is really a splash screen named "LaunchScreen".
Apple Xcode team (aka fucktards) provide yet another shitty out of the box experience...
It is so hard to be positive when teaching others how to use Xcode. Thanks for DevRant for letting me vent.1 -
To all frontend webdevs here:
Explain to me how do you cope with all this insane clusterfuckness of frameworks, tools and js libraries.
Why is it so hard for a beginner like me to learn webdev? Android and backend are much more logical and sane. Even Node.js is pretty dope.12 -
The Instagram API sucks a Lot.
Why the fuck I've to login with my account using OAuth2 to get posts of a PUBLIC account, it's so hard to make an authentication endpoint that doesn't require the user to enter his credentials in order to access PUBLIC content?
Fucking piece of shit5 -
BielyApp, yeah, GOOOOOOOOD IDEA! I still can‘t understand how this works or why did a reasonable human being though that this would be a great idea! 🤔
Ok. There‘s a community that lives 4 or 5 hours from my my city. I don‘t want to offend anybody, so let‘s call them “Bielys” (just a random name, I don’t know if there’s actually a group or etnia with that name).
Bielys live isolated from modernity, they speak their own language and they don’t use technology.
A dev friend of mine was having a hard time (he got divorced and was almost in bankrupt). One day, a man asked him and another dev to work on a mobile app:
...
“BielyApp”.
...
It was supposed to be a movile app for commerce. Bielys could sell and buy biely stuff from another bielys. Well, at this point you can figure out why this was a bad idea. Anyway, they developed it. Even it’s on GooglePlay and AppStore 😱 I installed it to see if it was truth or not. Incredibly it was true. BielyApp exists and the worst thing is that you can log in with your facebook account. WTF?!
I asked to him “But why?! WHY?! They don’t even use smartphones!!!!”
And he answered “I know, but I needed the money”1 -
I am working on an open source game project, and the most common way to draw things is using a class named ManagedSurface. The class is otherwise awesome, but it has a method called getBasePtr(x, y), which gives you a pointer to the requested coordinates. Fair enough (this is C++ without STL by the way).
But WHY THE HELL CAN I REQUEST ANY POINTER THAT I WANT, EVEN IF IT'S OUTSIDE THE SURFACE? Other cointainers have sanity checks, asserts and such, and the surface KEEPS TRACK OF IT'S WIDTH AND HEIGHT.
WAS IT SO FUCKING HARD TO ADD assert(x <= w); assert(y <= h);???
I spent 3 days on valgrind trying to find a heap corruption that manifested at random points in the code.
FUUUUCK!
On the bright side, I learned how to use valgrind (which is awesomely awesome).4 -
So it's summer holiday now, and I'm working about 3 days a week doing some c++ qt stuff. Why does everyone I talk to tell me I should "take it easy" or "enjoy my freedom" instead of "working so hard". I'd be bored out of my mind if I didn't (no I do not have a social life, nor do I enjoy basking on a beach burning cancer into my skin in some foreign country). In short, I dislike the dutch mentality of throwing away your money each summer holiday to be bored in another country for a week and telling everyone who doesn't off.6
-
A little background of me. I’m a firm believer of knowledge is power, skill is practice and hard work. Especially for this field, it’s easier to self learn the skills or language these days without having to take loans or burn a huge hole in ur wallet and stuff. But i personally feel, it’s hard to follow an effective path of learning when the info is everywhere. So have to be careful with that. (that’s why I’m here to learn from experts, lurking around)
Sure, degree is just a paper or validation that this person has completed this and that. But doesn’t reflect their actual skill. Especially for this field where u can just show ur skills by making projects. If ur potential boss is impressed by ur skills, u are hired. BUT if ure in Singapore, they require u to have degree by law. No matter how skilled u are, u only get specific amount of salary within a preset range. The range goes by Diploma, Degree, Master, PhD. Etc. U will still get hired by a company if they like u, but won’t get more than a preset range.
I was contented with just my Diploma. But decided to get degree cuz I wanted to earn more. And now considering to go for ms, just cuz my current company gives sponsorship.
Aside from salary, I do think getting a degree in University is one of the important phases of the life, where ure working hard, trying to juggle different things. Also, u do get other perks being a uni students, like discount for books, get access to latest devices if the uni has.
But all in all, whatever floats ur boat, right.4 -
So, for the past...what, week or so? I've been working on a side project with @gianlu. It's the PretendYoureXyzzy fork - our attempt to rejuvenate an old shitty piece of software.
I had started working on a fork alone, and then he asked to team up so I was like "Sure, I got nothing better to do." So, he's working on the backend (and hooking JS up to the backend) and I'm developing the frontend.
I don't know why I thought tech would stand still. Google says they're putting MDL on life support and replacing it with a much more complex successor, MDC. It's not hard to use, but what really bugs me is the lack of notice on getmdl.io. If you are switching to another project as your main focus, why the fuck wouldn't you advertise in the most places possible?
Granted, I don't do web design and/or development on the daily. Yes, I can do it, but I'm not always as up-to-date with web technologies as I'd like to be.
However, the screencap captured is the third time I've taken the knife to the UI. MDC is great tooling, at least to me. That dialog? Not something MDL would've had out the box on the first day. You'd have to work for that.
I don't have an issue with MDC, I have an issue with the lack of PR around it.
6 -
Me: Ok time to save money, have a trip to melbourne coming up, save for a house, car and wedding... Brilliant...
Internet: Oh hey you know how you wanted a smartwatch that was not sporty looking and has NFC, heres the Ticwatch C2!
Me: I hate my life...
Internet: also heres some of the programming theory books you wanted on sale!
Me: starts tying noose
Why must saving money be so bloody hard when everything you've wanted just pops up .-.3 -
Why not release the devrant (mobile+web) client on github (and maybe gitlab for people that would actually contribute but are special about the usage of github) so people could contribute to it, leading to faster progress? I thought about it now for a bit and couldn't see any problems with that, since the current apk can be anyway unpacked via freely available tools (appcelerator doesn't make it too hard either anyway 😕) and the website/api isn't any secret either (see the 4000 clients getting patched together out of zombie like api calls)21
-
Well what an adventure with this SSD...😑
my sis' laptop is from 2013-ish(?) and has/had a slow HDD in it. I wanted to speed it up, before her study, so I bought a new internal SSD (no new laptop wanted).
Created a bootable USB, exchanged the hard drives and install the OS on it. Seems easy enough...
The laptop restarts to finish its process ... laptop shuts down immediately, no warning whatsoever. 😳🤨
Start it up, loading screen, fan gets louder and louder ... instant shut down.😳🤨🤨.
Redo process, this time landing on blue-screen, error code critical process died? ... instant shut down again.🤔
Restart from old HDD, normal.😐
Retry with boot USB and reinstall SSD. Setup process copying files, meanwhile instant shut down.😳 Please don't tell me!😩 Since every part of the laptop was working, except the new inserted SSD, I thought "FUCK not a broken SSD!😣"
I had my own PC with internal SSD slot, so tried to find out, whether it would be broken...
All starting up fine??🤨🤨
Ok then? Finish the setup for the third time now ... everything up and running.😐🤷
Normal shut down, unplug, plug back onto laptop, it works. HOW?? WHY?? 😕
Why the fuck are you suddenly working? 😐🤷🤷🤷
That's some magic...5 -
So, unlike normal people who just click on an mp3 file in windows explorer, I'm listening to music saved on my windows hard drive, accessed via an sshfs mount, using VLC running inside a HyperV linux VM and Xming/pulseaudio to make it show up inside windows like a normal window and play sound.
Why? Because this is my replacement for WSL which broke (Good Job on the updates as always, M$) and I'm celebrating that I got everything* to work.
* Nevermind the hours I wasted because I forgot to add a rule to the windows firewall allowing pulseaudio to connect and the fact that Xming can't handle vlc playing video
7 -
I don't get it.
I tried Kotlin on Android just for fun, and it doesn't support binary data handling, not even unsigned types until the newest version. Java suffers from the same disease.
How does one parse and process binary data streams on such a high end system? Not everything is highlevel XML or JSON today.
And it's not only an Android issue.
Python has some support for binary data, and it's powerful, but not comfortable.
I tried Ruby, Groovy, TCL, Perl and Lua, and only Lua let's you access data directly without unnecessary overhead.
C# is also akward when it comes to data types less than the processer register width.
How hard can it be to access and manipulate data in its natural and purest form?
Why do the so called modern programming language ignore this simple aspect that is needed on an everyday basis?11 -
The frustration that comes to each developer when he tries to write the code structured by thinking through each situations, and your team lead comes and tells you why r you doing so much validations just hard code them we need to release it today client is waiting. After 3-4 months the same team lead goes through the code and shouts at you telling why the he'll you hard coded all these, can't you write the code correctly by thinking through.
3 -
We often rant about people who think that because we can program we can do everything with computers.
But I have to admit that when I get asked what I do I often only say that I program or do something with computers. I usually don't get more specific because it's so hard to explain to someone who doesn't know anything about the subject that I would have to explain the basics each time. And I'm just to lazy for that.
It's nice when people ask me how it is going at work but I probably won't say anything more than ok or fine because my day was fucked up by a memory alignment bug in the chainloader and I now don't have the patience to explain what these both things are and why they fuck up my day.1 -
I just uninstalled vscode and im installing atom. Why does it have to be so hard to uninstall stuff!?
9 -
So yeah XML is still not solved in year 2018. Or so did I realize the last days.
I use jackson to serialize generic data to JSON.
Now I also want to provide serialization to XML. Easy right? Jackson also provides XML serialization facitlity similar to JAXB.
Works out of the box (more or less). Wait what? *rubbing eyes*
<User>
<pk>234235</pk>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</User>
Why is my groups property (java.util.Set) rendered as two separate elements? Who the fuck every though this is the way to go?
So OK *reading the docs* there is a way to create a collection wrapper. That must be it, I thought ...
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</groups>
</User>
What the fuck is this now? This is still not right!!!
I know XML offers a lot of flexibility on how to represent your data. But this is just wrong ...
The only logical way to display that data is:
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groupsEntry typeCode="usergroup">
<pk>6356679041773291286</pk>
</groupsEntry>
<groupsEntry typeCode="usergroup">
<pk>1095682275514732543</pk>
</groupsEntry>
</groups>
</User>
It would be better if the individual entries would be just called "group" but I guess implementing such a logic would be pretty hard (finding a singular of an arbitrary word?).
So yeah theres a way for that * implementing a custom collection serializer* ... wait is that really the way to go? I mean common, am I the only one who just whants this fucking shit just work as expected, with the least amount of suprise?
Why do I have to customize that ...
So ok it renders fine now ... *writes test for it+
FUCK FUCK FUCK. why can't jackson not deserialize it properly anymore? The two groups are just not being picked up anymore ...
SO WHY, WHY WHY are you guys over at jackson, JAXB and the like not able to implement that in the right manner. AND NOT THERE IS ONLY ONE RIGHT WAY TO DO IT!
*looks at an apple PLIST file* *scratches head* OK, gues I'll stick to the jackson defaults, at least it's not as broken as the fucking apple XML:
<plist version="1.0">
<dict>
<key>PayloadOrganization</key>
<string>Example Inc.</string>
<key>PayloadDisplayName</key>
<string>Profile Service</string>
<key>PayloadVersion</key>
<integer>1</integer>
</dict>
</plist
I really wonder who at apple has this briliant idea ...2 -
The first project I used Source Control with.
At my university, we were told that it would be a lot easier, and that we were required to use SVN, and not Git. Me not knowing much about either, decided to learn from two people who used Git.
Confused as I was how it all worked at first, we spent a couple hours trying to work out a work flow, and how we wanted to use it.
Eventually, I was like "Guys, I got it!" And explained how we should do it. Then then said
"That's how Git works"
We decided to use Git, and at the last minute shoved everything onto the school's SVN server they had for the team.
Been using Git ever since. Looking back, not sure why it was so hard, but I am glad to have found Git instead.2 -
!rant
so the other day i was programming and suddenly i wanted to learn haskell. (i don't know why it hit me so suddenly, maybe because it's a 'pure' functional programming language and these 2 terms i knew nothing about)
and to be honest it's really hard coming from an imperative programming language (C/C++, yes, i know they are different in their ways). it's like learning to program again! you really have to get a different mindset and for me honestly it's hard to grasp the idea that 'variables' are immutable! like, that's soooo weird it still stucks to me. for example how did they define the max or min function without using a while loop? what are monads?
I am just 2 days in but it'll be a fun ride!6 -
I'll just leave the PC like it is and come back to it later..
FX [ Time Passes . . . ]
Damn it doesn't work !
Suddenly I can't mouse click..
Reboot.
Mouse click still doesn't work.
Unplug mouse, replug mouse.
Still doesn't work.
FX [ Goes to box with 15 spare mice in it.. ]
New backup mouse, works fine.
But I liked the shape of the old mouse !
And so hard to find second hand these days too..
Well, at least it works.
First time a mouse has died like that, and unlike most mice I have, this one I had from new less than 3 years old !
When I get a moment, I'll try the other 14 mice to see if any of them feel better..
See, I new there was a good reason why I got 16 second hand mice off Ebay as a job lot for peanuts. :-)16 -
Don't reuse your fixtures!
Each test case should be isolated. Don't ever think just because some function requires a similar input, it's safe to reuse it ALL OVER THE PLACE.
Why? Because someday, you want to change one functionality of one unit.
And you adapt your tests, fix your code, and suddenly, by changing one fixture, you break dozens if not hundreds of unrelated tests and now you have to clean up that mess.
It's even worse for functional tests with all those interwoven parts so that it becomes hard to reason about the scope of your tests when lacking proper documentation.
How I know? BECAUSE I AM CLEANING UP YOUR MESS RIGHT NOW!3 -
!Dev
Sitting in a bus on 19 hour ride with my class to England a few things to rant about came to my mind:
Why the fuck do you have to blast shitty german rap music out of your fucking JBL boxes and why do you have to turn up the volume so much that I can still hear it although I am wearing headphones, listening to music and sitting 5 fucking rows in front of you.
Also why the fuck do clocks in buses never display the right time? How hard can it be to make the clock display the right fucking time?
Another thing: why does this bus which is especially made for long rides not have a fucking trash can?! Seriously wtf?
Rants aside I am really looking forward to staying in England for a week although I won't have a computer for the next week :(
Another thing: why the fuck is the coffee you get at pull-ins so fucking disgusting ?
Like srsly, it is made by a machine and still tastes like thrown-up.
And why the fuck does everyone look weirdly at you when you buy a can of red bull but everything is fine when someone my age drinks 3+ liters of beer and then throws up? What the fuck? People look at me weirdly when I tell them that I don't drink any alcohol, heck I am actually not even allowed to do so because I am 15 and not 16 (beer is allowed in Germany if you are 16+ but nobody really cares about that). Heck where I am from they even encourage you to drink beer? What the fuck??!!
Anyway looking forward to England and also sorry about the long non-dev related rant. Just had to rant about some people and society.
P.S. do you know any (preferably free) Android apps / games where you have to code or just solve problems with logic?14 -
I remember the first time I was experimenting with Linux and decided to install Kali Linux (was still version 1 at the time) and in the process cleaned my hard drive. I was in first year and I hadn't been introduced to git, so you can imagine what happened to my code.
Or when I dumped all my databases into one SQL file (the feature looked tasty in phpmyadmin) and then after reinstalling everything, I couldn't import back the files.
Or last year, where I was on industrial attachment. So we were to delete some data from DHIS2 manually. So as a developer I grouped all organisation units to be deleted under one parent and wrote a python script to recursively delete anything in that group. Just when I was about to show my supervisor how efficiently my script was deleting stuff, he said, "Don't delete anything yet". I hope he doesn't read this *wink*
Fast forward, last week on Friday I dropped my external hard drive. It just works on one USB port now, no idea how and why. -
Fuck you SailfishOS.
I wanted to port you.
But nooooo you have to make it complicated AF.
I mean who has chroot in a chroot to build an image ?
You are fucking dumb piece of shit.
I wanted to avoid it but the only OS thats actually usable is Ubuntu Touch.
But yeah IDK if Halium boot will work with kernel 3.0. Why 3.0 you ask ?
Because kernel upgrading on Android Device is crazy hard.
I mean crazy hard.
Get clean source of 3.4 for android. OK thats not hard.
Get version of your kernel which is not bloated with commits to make android boot. Not so easy but doable.
Now just compare it with clean 3.0. Easy
Apply the changes to 3.4. FUCKING HARD AF SHIT.
And even when you apply all of them it wont most likely build. If it does then its unlikely it will boot. If it does it will probably turn of after second or 2. If not and it boots android which it wont due to missing commits needed to boot it.
So yeah pain AF.
I tried multiple times to get 3.4 working but nope.
Sad part ? Even devices older then the one i mantained had 3.4. FFS i was doing a bad job.
So yeah i guess legacy port it is but IDK since its not recommended at all. Fuck this shit.
I fucking ported android 8.1 while the last working version was 6.0. I can do this shit (I most likely cant and will give up on the 3.4 port.)15 -
Heh promotion? I only get fake promotion..
For two years, I was doing so many *free* overtime, manager is a big liar, he said that it will he considered on the yearly evaluation.. cool, the thing is there is no evaluation at all, just lying and lying.
Few months ago I took a vacation of 1 month (I am expatriate so I get one vacation per year, my home town is too far..) I talked to tye manager about salary taise and he said absolutely we will talk after I get back..
He called me during my vacation to do some urgent (as always) work, I worked about 5 days, and for free.
After I get back to work, he was angry about my *attitude* that I wasn't available more time.. oh and there was no fucking raise. always lying..
In this country, if you're an expatriate so you can travel outside the country without the validation of the employer (yeah like that) and the notes period is about 3 months, what makes very hard to find another job, no one will wait for 3 months, unless you vanish during a vacation.
So, why didn't I gave my resignation? well, life is hard when you have unemployed wife and a little baby, and the pay is, let's say OK comparing to costs here.
I am charged to learn and work with another language and framework, and when I asked for a raise they said no, so I will stop working in this language and let's see..
The problem is that other employees in thus company are literally bitches, they don't say no to anything, so I am the special guy here who does not a blowjob..
So, what do I do? I am hunting for a new job since a while but no luck.6 -
Annoying Indian professors are everywhere. It's a computer vision class are you really teaching us Regression?
What about transfer learning? object detection! Give us papers to read, let's do projects.. what the hell is this I am going take attendance bullshit and teaching crappy concepts.
I did not sign up for this shit! I came here for my Masters to get away from pompous mother fuckers like you ...
My class is also filled with those idiots,who think bias in a neural network is somehow related to class imbalance ? Now the same idiot proceeds to ask questions like...
Why would the weights change in a neural network?
Motherfucker why you in this class ? Why don't you stick to your shit and ask these questions later..
I am so pissed off right now guys ...
I was sitting in my lab understanding the deeper insights of BN, activation fucntions.. various optimizers ..etc Stuff that this idiot motherfucking teacher must be covering... UGGH.
I shouldn't cuss so much.. or at least add variety to my cuss words..
I am pissed off cuz instead of learning the shit I should be learning I am forced to come and attend this class and waste 2 hrs of my life ...
It's the summer i find it hard to focus anyway (want to go out hiking or swimming or something.) BUT. the moment I find some resolve to focus
I get this fucking bullshit.. !
My mind is so fucked right now... I can't think of anything but standing up in class and screaming " Mother fucker, mother fucker...(point to the idiots in class you) motherfuckers shut the fuck up..
Can someone suggest some colorful swear words ?
My brains not working -_-
It is just about now that I start feeling like "Anger" from inside out12 -
Error mesage on my 4GB ram "smart" phone, running a "smart" application.
'Oh no ! Something went wrong. Re-try'
Whatttttttt!!!
WHY DOES A "SMART" APPLICATION GIVE SUCH A STUPID ERROR MESSAGE.
IT IS MY PHONE, PLEASE PROVIDE A HELPFUL ERROR MESSAGE, WHY IS IT SO HARD.
I JUST HATE SOFTWARE THAT TREATS THE END USERS AS STUPID ANIMALS.8 -
Just saw someone trying to sell an internal 4TB hard drive because they thought they ordered an external drive...
The internal drive is a server grade fucking drive?!?!
Surely you would be confused as to why the price for what you thought was an external hard drive was so damn high?!3 -
When your screen is facing the window, so you’d rather have the door behind you closed otherwise you’ll get the glare from the window.
Why the fuck is it so hard for the people that go through the door to close it behind their fucking asses when they come into the room.
For fucks sake it’s not that hard you uncultured swines. -
That feeling when you were so happy about react-native, and was pretty sure at the beggining about the achitecture of your app and js libs you are about to use.
Im here sitting with redux, reselect and still dont know why I cant just do a REST call and format data in the container component.
Why react is so hard, or am I dumb?6 -
anyone having the same problem of mine? I was asked to give an estimation but I suck at giving estimations!
I once gave my boss an estimation of three weeks, and completed in 1.5 weeks + including unit tests for my work O_O4 -
So I told my partner in not buying a Mac and that in buying a base model pixelbook instead, showed her the pricing and she nearly strangled me...
Why is it so hard to be a Google fan and have to import litteraly everything with an extra 400 AUD tacked on -,-12 -
Why is it so hard to remember, that devs need an error message if they should help you. just saying "it does not work" is not helping.
I even wrote you a checklist. so f*ing use it! I'm not there to be called every time just to tell you to do something that's already on this list.
Every. F**ing. Time.2 -
So.. name one fucken case where your database is not a computer backed thing.
Just asking because.. why the fuck? I don't think your database server supports input of fucking math symbols? JUST USE HUMAN LANGUAGE, AS YOU HAVE TO DO ANYWAY!
It's stupid how everything needs to be expressed mathematically ffs. Not that it's hard to understand - it's just more complex than of a very simple wording.
6 -
Why is it so hard for people (especially managers) to learn to work smarter not harder....
FIX THE GODDAMN PROBLEM CORRECTLY... THE FIRST TIME SO WE DON'T HAVE TO KEEP FIXING ITS BLOWUPS ON WEEKENDS....
AND STOP HIRING MONKEYS THAT JUST KNOW TO PRESS BUTTONS RATHER THAN DESIGNING FULLY FUNCTIONAL SOLUTIONS THAT DON'T BLOW UP OR LEAVE A TRAIL OF SHIT BEHIND THAT I NEED TO DECIPHER N CLEANUP....2 -
Why the f*ck is it so hard to setup an online live radio on NodeJS but making a freaking Google hangouts clone is not.3
-
I just read Jeff Bezos' article on Medium about how the ones at American Media are threatening him of leaking his private pictures.
As I was reading it, I felt, "Man, how low has journalism come to these days. Here is a guy who's worked so hard to build one of the world's biggest companies, and here are the ones at the National Enquirer trying to bring this man down."
To be honest, who gave them the right to indulge in a person's private life? Why do they have to say, "A nude selfie with his wedding ring on?" Maybe, he sent that image to his wife. This makes me wonder, "Is this the way we treat humans?"
Why are we concerned about what a man does in his personal life? What impact does taking down a man in public bring?
Thoughts, please!13 -
Boss: “Our ecommerce conversions in Google Analytics are less than the actual pace of orders.”
Me: “Nothing has changed in the tracking code or setup. It must be our goals setup which you have to have a Ph.D. to understand, plus whatever mood Google’s algorithms are in today.”
He’s not mad at me. We’re both just confused why Google AdWords, Analytics, and Tag Manager have to be so damn hard to get right. I’ve never been able to do it right. And most data is thrown out because people browse websites while logged into their Google Account, which makes their clickstream disappear and become unattributable because of understandable privacy policies. I don’t want my data tracked when I’m logged in either!
So now we have had to hire specialists at several thousand dollars per month to figure this out. -
Why is it so hard to find internships in india? !!
Aaaaaaaarg
If you're not from india, is it hard to find some there too?5 -
Its so disheartening to see how easily replacable you are if you work for someone else, no matter how hard you worked. The moment you say " I am resigning", the behaviour of your manager changes so dramatically. Its like you don't exist anymore. No more new interesting work, no nothing. Why!!!!7
-
Oh lord it's finnaly happened, I'm almost tempted to leave my retail job after 4 years, fucking head office and lazy ass managers im driving me fucking insane, they give you a 2 person job and complain when you don't have it all done by lunch.
Why must finding an enjoyable job be so fucking hard! -
Why are cookies such a disaster in JavaScript?
I would assume given the modern Internet landscape that storing data for your website is downright essential. So how did these people fuck up cookies so bad in JavaScript?
You may say "Yeah it sucks but cmon it's just one topic and it can't be that hard". No. It's a fucking mess that deserves no mercy, and your passive attitude is the reason making cookies is the way it is now.
It's so bad, that you need to do a .split command to print out the value of the cookie. It's like storing data was a passive afterthought, like "Hey bob how should we deal with storing literally any website data in JavaScript?", "I dunno Joe who cares just make a .cookie property or some shit idk"
The problem stems from the fact that there's only document.cookie. That's it. It's not like document.getElementById where you can use functions like .classList or .style or whatever. Why can't it be like this:
// Add cookie. Take notice at how easily you can add multiple cookies
document.cookie.add("key=value; key=value", "expires=UTC", "path=/")
// Store the value of a cookie in a variable
let x = document.cookie.call("key");
// Delete cookie
document.cookie.delete("key")
See how much nicer that looks? And I literally made up that syntax in like 2 minutes, so I can't even imagine how quick the official cookies property was thrown together. I know there are libraries that do this and localstorage sort of has a syntax like this, but this shouldn't be an issue at all. There is no technical or ethical excuse why it's such a goddamn mess. It's 2019. Fix your shit JavaScript.
12 -
I need to get this out there because you guys and gals are honestly the only people I can vent this to.
I’m working on a program for fun that’ll transfer files over sockets. Nothing too special. But this project is just boring me. I’m not getting any motivation even when I’m getting started. Which didn’t happen last project.
I have a general idea how I’m going to do it but I just can’t sit down and do it because I start overthinking about everything. Like how am I going to do this or that. How am I going to handle feature a, feature b, etc. And I’m just getting a headache and I’m not writing code and I’m JUST FUCKING STARING LIKE AN IDIOT. I don’t even know why it’s not inspiring me because I’ve always wanted to program a file transferring application of some kind and I still do.
I keep doing a bunch of small patches when I work on it and they work and improve it but I am hard on myself because it’s not one big feature or I didn’t work on it for hours. I’m always so fucking hard on myself fuck.
I want to do so much other stuff but I just wanna tough it on through and finish but it’s so uninspired because I don’t even feel like what the final product will feel like others. Like any service that involves transferring files I feel like they don’t function like how I’m thinking they do like I’m trying to make this function.
I feel like everything I’m making is just subpar and not good and I’m trying and I’m trying to improve but I feel like I’m not getting anywhere. And I want to learn a lot of stuff I have shit planned but I can’t get to it because I have to go through uninspired bullshit hell.
Idk14 -
I've been looking into the world of mechanical keyboards, and damm I'm overwhelmed by the possibillities of configurations and products. Why is chosing a keyboard for the MacBook 12" which has only 1 usb-c so hard? Any advice on keyboards and keyswitches?5
-
So I work in a web development company in my town and have been doing a while or heap of parallax sites for our clients. Now obviously when we do the designs we get them in and get them to play around with the site before we go ahead and push their new site out and make it live right.
Wellll who would of thought that a simple parallax site would be so hard to use for the general user??? Recently we have been getting the occasional call where the client is getting complaints about the site only being a big ole image or just one block of text. After investigating why their site was broken or why the users weren't able to see the whole site I came across no problems at all.
Today I got a call from the client who instructed me that after explaining to one of his own clients that he had to scroll down the page that everything was just fine!
I mean, what? How do you miss the big ole scroll bar on ya screen or even think to even attempt to scroll? Some people aye lmao2 -
Oh boy the schools in the Netherlands have began again, the amount of people in the train is insane... (Also one of my biggest annoyances is) the way how people pile on top of the check-in checkout poles... They try to do it as fast as possible, but because it is an unstructured pile of garbage... It takes way too long...
Is it so hard to stand in a line and just keep your card STIL AND CORRECTLY INFRONT OF THE NFC READER!?
apparently it is because I see people slamming their wallets against it, moving it around wildly and keeping up the line being Angry why the reader can't detect their card... In their wallet, probably between multiple other NFC cards within a second (BECAUSE YOU KEEP MOVING IT FROM THE READER TO THE FUCKING SCREEN!!! WTF)2 -
Why is it so hard to convice coworkers (other programmers) to use source control? Yes it's an extra step every day or so but it can be so helpful and save so much more time tracking down versions and when the bug first appeared. Also, piece of mind if your computer every gets hosed.
7 -
Can we all just agree to stop actively imagining progressively harder to parse CSV formatting options? For fucks sake I’ve had to build in tolerance for quoted and unquoted data, combined data and split data, ways to split the data and recombine it, compare every data point, filter some data, only add data, only remove data, base data updates on non Boolean fields in the file, set end point matching based on arbitrary fields, column number matching, header matching, manipulate malformed urls and reassemble the file with proper ones, it goes the fuck on. CSV’s should just be simple and not hard to format. Why does everyone want to try so fucking hard to do bizarro shit?!
-
Seriously how hard is it to observe proper indentation! Don't mix spaces and tabs! That's why I added the .editorrc .jshintrc .jscsrc in the project repo so you'd use it. I asked you to configure your editor and the only thing you configured was your freaking Sublime theme and color scheme. aaaaargh!!!!!1
-
Working on modifying a legacy web project and just about every single element is `position: absolute` with crazy z-index juggling and hard-coded pixel sizes and positions everywhere 😭
To make it even worse, a bunch of the javascript will also change elements sizes and positions so it takes forever to track down why an element is where it is1 -
Whenever I see job postings with salaries this low I always wonder exactly what's going through the minds of the people running the company.
Who in their right mind would want to spend 4+ years working hard on a CS degree only to be offered less than what the average retail manager earns? I barely afford a 1 bed flat share on this salary in my part of the country...
I'm starting to run into more and more job adverts like this. Why are companies working so hard to rip of graduates?
13 -
I've been writing Java the last few days. Really makes me remember why I enjoy writing objective c / swift so much. It's not necessarily the crazy syntax of objective c. It's the conventions behind the languages. It's very easy to make your code read like prose. Which when you become used to this it's very hard to jump back into spaghetti code with abbreviated variable names and such.3
-
I didn't know "bandwidth" can be so hard to understand even after 2 hrs explaining..client still wants widgets with autoplay videos..God why?4
-
So I have been working on a project for a while now and because the deadline was getting closer the project leader decided to involve a 3rd programmer. All development was due to be finished today. Yesterday the person informed me that he wont be able to finish with his part on time. This came unexpectedly and way too late. I have myself been working really hard to finish my part in the project but now I have to take over his part and finish it. The worst part is that there is liket 40 hours left to finish his part. I don’t know why I’m writing this but I just have to get my emotion out of my chest. My weekend is ruined.8
-
So, a new web project came for some small layout changes, nothing to fancy.
It was on the hands of another company and the client didn't want to work with them anymore. Basic Magento with a custom theme.
As I was wondering through files, I found out that the old devs echoed, in ".phtml" files, contents from ".txt" files located in base directory. I was shocked and went forward with it. The core of Magento had tons of this "echo"s. Several minutes later I found out that they "coded" another administration panel besides Magento, that had "authentication" with hard-coded user/pass inside index.php and a session start. That admin panel just rewrote the contents of .txt files using textareas. Why/what/when the fuck..they've forgotten the admin password?!?!!!!
This was like 3-4 years ago.
Worst project i've seen, ever... -
So it's been a week since I left this company, but I still have access to all resources and stuff. I worked there on a project for 2 years, and in a week they managed to fuck up the codebase, because why follow guidelines I set up.
Ugh, hard to let go sometimes. But I know Im better of at this new job.1 -
i always assume that my code is right so when the compiler gives an error, its hard for me to find out why it gives an error and why it doesnt work. my mind is too convinced that it is correct.
i guess i have to sleep it off 😴 maybe tomorrow it will be easier to fix6 -
Dear lord! Why is it so hard to get this to work! Anyone know if its even possible to run lambda expression on JSP? I made sure everything is running on Java JDK 8. BUT IT DOESN'T WORKKKKK. I keep getting "Lambda expressions are allowed only at source level 1.8 or above"2
-
I just finished ny first feature at my first dev job - a gallery page connected to an api.
It took 2 weeks. About 2 days of programming, but 12 days of fucking css.
Why is css so bloody hard?7 -
Whenever anyone asks me why I dislike C++ I'm just going to point to this current app I'm working. Had a unit test with an extern method declaration that had 7 or 8 different parameters. No big. Problem is that the ACTUAL definition of the method had 1 less parameter than the extern declaration. It worked perfectly fine in x86. Ported to x64, compiled fine, hard crash at runtime. Debugger not a super lot of help. Took me a couple days to figure that one out. Also I am broke so I can't even drink the pain away. Neat.
-
Why in the fuck is it so hard to see buttons when kb selecting with tab in a browser? It's like:
"Tab....Tab.....Tab Tab Tab... oops, went too far,
Shift + Tab, Shift + Tab.... fuck!, too far left.. wait, is that button actually highlighted, oh it is too, wtf."
It's 2019, why is this still a thing?10 -
So my MacBook's trackpad was behaving weird since this morning. Touch was working fine but for clicks I had to press down hard. Annoyed me all day. Then suddenly now it's fixed itself. So now I'm happy about it but im like, why, how. :/4
-
Why does everything installed via npm sux so hard?
Why the fuck does any minor update in their bullshit packages either forces you to change config files:
E.g. now should be "@babel/core" instead of "babel-core" - WHAT A FUCKING SIGNIFICANT CHANGE!!! Rewrite all you configs motherfucker, that goddamn "@" in front of our shit is SO IMPORTANT that we will break everything to add it
Or breaks the code internally:
Consider the recent fail of fucking Terser [https://github.com/gatsbyjs/gatsby/...] that breaks fucking webpack and FORCE YOU TO ROLLBACK TO ANY VERSION THAT WORKS, why you nerd retards, can not run a simple dummy project BEFORE YOU RELEASE YOUR SHIT???!?!!?
Why any fucking update from *.*.1 to *.*.2 turns into hours of googling of what the fuck got broken this time??
The way that webpack, babel and other npm packages are released nowadays is absolutely retarded. I really have a strong feeling that it is better to keep old error-proof working config and NEVER UPDATE, than constantly suffer from butthurt
p.s.
Of course I am sorry for all the hate and caps in my post, and have respect for guys that develop amazing stuff for us for free, but I need to share this5 -
So I wanted to try MS translator API for one of my projects:
1) Registered MS account
2) Registered azure account (why the fuck you just can’t use data from my MS acc...)
3) Finally opened azure platform
4) what the fuck
5) ok, lets search translator api
6) no results
7) after 20mins, finally found it
8) click ‘create’
9) nothing is happening
10) *trying to selfcontrol myself from punching the screen*
11) google: how to delete azure account
I mean, who the fuck designed this fucking piece of horse shit, how hard you must get your fucking head hit to create such a horrible UX... -
WTF if you want to program stuff learn how to use your programming language. Why is it so hard for that many people to learn how stuff works and stop copying blindly from the internet?
I have two colleagues who are doing nothing else that to just google their problems going to the first answer and cooping it then trying to run the program and if it doesn’t work ether give up completely or starting a loop of inserting the error message to google and copy the first result?3 -
Why the fuck is it so hard to find a proper guide on porting a custom rom(LineageOS) to a device?!2
-
Why is it so hard to find a designer/front-end dev partner and/or freelancer that can make mobile specific designs!?2
-
I work in a big corporate world where I felt really out of place at first. I didn’t enjoy working there, I could not understand why people would work so hard to keep all the systems happy. No one thanked them, no one gave the smart people maintaining the important systems any credits. I did not understand. Why did they care so much for these systems?
My team split. We were too many with too many systems to care for. After this my team was a lot smaller and therefore I ended up in a more important role. I was forced to do these tasks the more senior engineers had done before me, in the previous team. This was the greatest thing that could happen to me, and I started to like coming into work. Now our team is big again but I’m one of the senior people in it. Not senior as in years active in the industry but senior as in knows the most about our systems and our work environment. I work hard to constantly share my knowledge and try to put the newer members in situations where they also have to take responsibility.
Don’t be afraid to put important tasks on junior or new people. They might fuck up but they will learn, as will you. Don’t hog your knowledge and your team will thank you.1 -
Question:
I once read that 95% of people on diets, never succeed and just put the weight back on.
So, what is special about the 5% ?
How do you know in advance if you are a 5% or a 95% person ?
There seems little information on this issue..
I did once study alcoholics, but I couldn't spot any statistical pattern on why some recovered and others didn't.
Not did anyone really offer any clues.
But, now we are in the internet age, so I can ask the world !
If its genetics, then does that mean they will always succeed at a diet, and not fail repeatedly ?
I've failed several times to diet..
Yet, as a kid, I was underweight for decades !
But maybe that was because food was expensive, or my mums cooking. :-)
So, what might help determine success or failure ?
More hard work ?
Or something else ?39 -
Why doesn't Skype of business have an application for Linux? Every company meeting where a developer isn't involved is run on sfb. Being on Ubuntu it is hard to attend any such meeting. Any meeting between developers is on zoom so we're good.
We can't really convince every one (other than developers) to start using zoom.
Do we have any other alternatives? Is this a lost cause?20 -
It's so fucking hard to explain my job to people who don't have slightly idea about it
Person : what you do?
Me : Web development
P : what's that?
M : you know websites on internet for users or clients for products/information bla bla bla
P : like amazon, facebook, xyz ?
M : Yeah you get it
P : so you develop facebook?
M : huhh.... No not that I'm not working for FB that's a different company we create websites according to clients.
(Inner me: why don't you fuck off already)
P : huh... Okay ( no fucks given )1 -
FUCKING PIECE OF SHIT USB STICK. What the actual fuck how hard can it be to format a usb-stick? Excuse me?
Basically, flashed arch .iso on my usb stick. After stuff was done I want to format my usb stick again so I can put files on it. Normally thats a super easy process. I tried a shitload of things.
1) On windows: Quick format -> Windows was unable to format.
2) Went to Linux. Opened GParted. Gparted didn't detect the usb drive? Wtf. Rebooted then it showed up. Tried to delete all partitions, tried to clear the entire drive. Gparted just freezes. Ok... wtf is going on?
3) Tried to go the bruteforce way and zero out the entire drive with dd. After a few seconds dd freezes and is not doing anything anymore.
Wth is going on lol? Why can I not wipe my usb drive? Any ideas?
10 -
Why is so hard to find engineers that actually care? It feels like the majority of people always want to do the bear minimum, no one wants to fix their shitty code even when it clearly violates the project or company standards. Everyone constantly comes up with shit about why they can't do things properly or how they'll fix it later and then get their mates to push their shit through review. The majority of lower management usually care equally as little so there's no point explaining the situation to them and the lack of care probably goes much higher. It seems like so many people go from job to job getting bump after bump in salary, which granted is absolutely fine and probably advised, but have nothing to show for it. Usually very little skills but alleged mountains of experience and a lazy piece of shit attitude. I hear all the time people saying you'll never change anything so why try and it feels like that most of the time but more because everyone keeps saying it. If everyone pulled their fingers out their arse, maybe we would stand a chance. I'm sure a lot of people on here have a real passion for computer science, whichever division you're in and love to learn and improve and reflect. What I really want to know is how you deal with people who are just taking their paycheck and enjoying the ride but don't actually care and how you discover these people as early on as possible to get shot of them.14
-
Wordpress.....
God, why..
Okay, so my company has deep roots with wordpress websites, which is, well fine, and at some point they needed portal that would do something but I was bussy doing other project for our child company, so our frontend slapped together "portal" in wordpress. So I dont even know if I understand that properly whats going on, but today buddy came with help request to wordpress.
I had to look through wordpress database and was like.... FML hard.
Okay, fuck it, let's try to make it work. So, I needed to get random category (using get_terms), check it's ->count and if its greater than X show it on page. I came to done halfway, the random part wasn't working.
Okay, made it work after initial struggle with "WHAT THE FUCK IS THAT?! AND THAT?? AND THAT?!?!??! ;-;" and now comes the kicker. It has ACF installed and it has additional category in ACF. And it should check count of posts within the category that have certain ACF value.
After awhile I just said "this shouldn't be done on wordpress, no idea how to make it work".
What I seen is like... it hurts me on so many levels... My head wants to explode...
Can I get back to writing normal code now? ;-; Im fed up patching logic in frontend (I dont even know if that's `the wordpress way` but that's what they did) -
I saw a lot of rants about StackOverflow and its community.
I really couldn't understand, I always found friendly comments and answers, so it was hard for me to imagine why the community was tagged as "sadist assholes".
Then I found this gem and all was suddenly clear.
1 -
I've been using Git since 2014. So why do I STILL cringe whenever I have to revert commits or do a hard reset back to HEAD? What's going to disappear? What will remain? Will my entire Git history be vaporized? It's a total game of Russian Roulette to me. So, without the certainty level I want, I just do what feels safer...I grab the versions of the files I think are what I need and stick them back into my repo, then git status and commit the correct changes back in.2
-
So I get an email from college career development for a web developer & designer position.
Read into the requirements & function, I find this....
Who the fuck does put HARD CODING before CODING.. why would you even put that on the requirements. People are going to read that and find out how you run your company.
We all do some hard coding here & there but recruiters think it's a skill that comes before coding.. hard coding isn't coding hard...
They don't say company's name in email so I got suspicious.. or perhaps I thought I can be a detective lol. I was able to find out the company and looked at their Glassdoor.
Of course they have 1.6 stars.. two 1 star reviews by their employees. I can just imagine the horror working at this place lol.
Oh & the manager makes something like 110k.
3 -
Why does noone implement autoupdater, especialy on linux side? Is there a reason i dont get? Sure, most system stuff is better in apt, but if i install servers, i do not want to wait for these stupid linux release timings! If it were hard, id understand. But most of this is possible with something like GitHub API and 20 Minutes of time. I mean, yeah backwards compatibility and what not, but then handle that internaly.
Example: I use dnsmasq on a raspberry pi. RPI is running raspbian. Raspian is debian 8. Debian 8 has a version of dnsmasq with a pretty annoying bug, which prevents me from using dnssec, as i cant open any cloudflare pages. Why, o why isnt this updated at MY will? Then, if it isnt, why is it so impossible hard to compile this myself, no docs for that, no binaries, NOTHING? Dear server devs, please add atleast basic autoupdate functionality without having to rely on the base os.
Or, give me easily deployable binaries, if you cant write something integrated.12 -
Not really coding, but debugging complex problems. I love it when I have to dive in head-first and dig (very) deep to find answers to super-complex problems. I once went into the internals of a programming language to understand why a library was acting up in a particular scenario. Another time I had to optimize and re-compile from source (after modifying it) so that the application would not leak its memory. (Of course, I contributed it back to the language).
The inner satisfaction that you get after all that hard-work when it finally works, pays off! Bliss!1 -
Doing a freelance job for an advertising agency, going from an old install of OpenCMS to WordPress...
- Ok, website's online and fully functional...
- Client asked why his old articles aren't on the website
- I told you before in an e-mail: I've got no access to the server or the admin area of the CMS, will have to import everything by hand, one by one...
- But we promised we'd do a quick import of everything...
- Fuck...then request the access to their current admin, please
- Ok...
*3 hours later*
- Sent you an e-mail with them...
- Ok, so I opened their admin, but I need an administrator login, this information only allows us to edit and post...also this thing is fully hosted on the previous agency's host, I believe it'll be a bit hard to get server access...
- I'll see if they have another login...
*1 hour later*
- No, they only have this...
- Oh, fuck me sideways, we're going manual :/ -
Recently my grades haven't been so great and looking at what I do all day it's not hard to see why. I haven't had much inspiration do make anything or learn anything, everytime I open vscode it feels so boring. I've decided I'm going to take a break from coding and like tech in General for a bit, maybe a week or so to get all my school stuff figured out and all.i want to get back into reading, I haven't read a book and enjoyed since 6th grade almost 4 years ago. I hope I come back with some motivation though. might actually keep dev rant though.
-
Why does it always follow the same format?
Me: we should do do and so because xyz. Alternatives are this and that because uvw.
Manager: no, I'll hire another manager.
[Q]uit, [T]ry again? T... fml
Manager 2: let's have a meeting.
Meeting almost ends up being about an entirely irrelevant topic. Barely get the requirements before the end of the day.
Me: write summary following conventions.
Manager 2: let's hire another manager. Manager 1: great idea, manager 2!
Manager 3: let's build a spaceship!
[D]evsplain, [R]agequit, [T]ry again?
class Manager:
"""This shouldn't be too hard..."""
... -
WHY IS IT SO FUCKING HARD TO DOWNLOAD SOFTWARE FROM MEGACORPS??
Yes, am looking at you EMC, Oracle and IBM. Either they have tons of portals-e-delivery-shittorama or their softwares suddenly disappear for n amount of time without notice. Mix this up with broken links or CONSTANTLY REBRANDING YOUR SHITTY PRODUCTS SO YOU NEED TO HIRE A PERSONAL ASSISTANT THAT ONLY WORKS WITH TRACKING THESE PORTALS TO HELL
Also, your websites are slow as shit.
Thank you.1 -
God why is it so hard to let go with people around, especially potential friends or partners... It could be so easy to just have fun and do the things you always think about, but then you mess it up and that somehow.. purposely.3
-
Them: We should totally use JIRA
Me: Why? it's sucks so hard
Them: I like it because of the reports
Me: How often do you look at those reports?
Them: Once a week
Me: F**k that then, there's no way I am rummaging around in that crock of shit hundreds of times a day just so you can look at a report once a week
🙄7 -
"let's put an advert right next to the login/registration area so everyone can see the ads"
Thanks for reminding why I love adblock, how retarded you are and why you should never be allowed to touch ux/ui.
f your theory about users != customers.
Hope better ads standards slaps in your face, HARD1 -
For fuck sake why can't people implement instant payment charges when you order something and not when it gets shipped!
Ordered a board game for about $150 AUD about 3 months ago and my batch was just finished so I just got charged... It's not like a have a fucking trip to Melbourne with some mates this weekend .-.
It can't be that hard guys, charge people when they order and not when it's ready -.-11 -
Okay soooo.... I have this laptop that I use a little less often but is bugging me about. So WINDOWS just decides to RAMP UP THE HARD DRIVE TO ALL HELL WHENEVER I NEED TO USE IT.
I have a few options:
- Replace the 1TB 5400RPM with a 120GB SSD and do Linux
- Replace the 1TB with the 120GB and do a fresh install of Windows
- Replace Windows with Linux, keeping the 1TB
- or reinstall Windows
Which do you suggest and why?4 -
Not more accurately tracking my hours worked with estimates, then wondering why I feel like I've worked so hard for seemingly so little monetary gain.2
-
Avast stoping my benchmark and reporting it to me is like a dog that proudly brings a bone to you while you walk with him on a cemetery.
I know about it before I started the benchmark so i deactivated it for 30min, but then for some reason (i may have accidently clicked on the symbol) the ui opened and everytime it does that it for some reason resets the option so it was active again. Now it deleted parts of the Software and I have a hard time making it run again. Fml and fuck monday. Why isn't there an option to make a fucking exception or remove something from their fucking virus container if it was a false alarm?6 -
Why is it so hard to explain to people that
The speed of time = 60 minutes / hour
I mean, I didn't come up with this shit!!! Come on
Also, in other annoyances of today:
VS code updated and ended with a crash, even tho it now says it's actually updated... Should I trust this bitch or not?!?! -
I was just getting frustrated how hard it can be to search on google for very specific subjects when it comes to development. So I thought, why hasn't anyone made a search engine just for developers so you don't get any bullshit in between.
I found apis.io but they only have 1076 documented apis in their db... lets collectively make this better!4 -
Why is it so fucking HARD TO CLONE THE FUCKING C: DRIVE! WHY THE FUCK!? I JUST WANT TO CLONE THE DATA TO A BACKUP SSD AND THIS SHIT ISNT FUCKING WORKING! I DONT WANNA PAY FUCKING MONEY FOR SOME extremly safe high quality backup FUCK THIS!8
-
Doing pair programming while I was navigating on somebody else's computer, we hit a weird behavior that our code changes weren't reflected.
Trying everything it turned out: I forgot to save.
Yet: Why though would you make me save? And why did the IDE not warn me about compiling unsaved changes? I think it was eclipse for Java, oh well. What can I expect ...
Anyways, I have gotten so used to my editors autosaving content for me as I write it, that I completely forget about doing Ctrl + S myself.
I never understood the need to hit that key combination manually as if I break something: `get reset --hard` will help to get me to a working state. (And even if I mess it up differently, my IDE's local history also let me restore recent changes.) And if it is a workign state, then I like to commit early and often. and
I am really dumbfounded why people insist on hitting save themselves.8 -
I now understand why people say python is such a damn hard language to keep big projects. I'm so hell lost in all those code indentations and lack of conventions!!!!
GET ME BACK TO RUBY PLEASE I BEG AAAAAAA4 -
Why the fuck are there so many utterly useless programming blogs? I have to implement DES in C++ for our college project. After coding most of it step by step, I decided to swallow my pride and check for an implementation online to save time because I was confused in the XOR part. Now most programming blogs had the same code copy pasted. To top that, NAME YOUR FUCKING VARIABLES PROPERLY YOU MORONS! I decided I'm better off resolving my confusions the hard way.3
-
When your PC is slow af cause of the hard disk so you make a dumb decision and change your hard disk with a new one and you gotta install Windows on it but you only have very old images of it so it requires a special USB driver to install the system and THEN you realise the setup image has NO DRIVERS for ethernet, wlan OR usb so you can do absolutely NOTHING with your fresh system so you decide to install linux instead but you realise YOU'VE REMOVED ALL X64 IMAGES BECAUSE YOU'RE FUCKING DUMB SO you prepare a bootable Kali USB to copy basic drivers and DriverBooster into the hard disk to install them on Windows.
AND THEN YOUR FRIENDS CALL YOU AND TELL YOU THAT YOU HAVE 2 EXAMS TOMORROW BUT YOU CAN'T JUST LEAVE THE COMPUTER SO YOU JUST GO FUCKING KILL YOURSELF
This is why I HATE MY LIFE SO MUCH IT GOES SO WRONG !!!!4 -
Dear Microsoft, I see what you were going for, and I love you for it; but for the love of god, please fucking fix the clusterfuck that is Nuget.
I use a private feed for client work, and I have the public source registered too, so why would installing a new .core template from Nuget fail just because it tried the private feed first and shit itself?
It really shouldn’t be this hard.
Sincerely,
Brolls -
As a web developer who focuses on accessibility, why is it so goddamn hard to get buy-in for accessible design?!
If you design to be the most accessible possible regular users benefit from an experience that works, for as many people as possible, in more situations than most test for normally!5 -
On the one hand, as an avid programmer having a non-programmer partner, we (I) once wanted to mod some Gameboy Pokémon games (Crystal), but the games were written in Assembly and I was definitely not getting myself into that. My partner was rather sad, as this was quite a big project for the both of us, but it was never finished, and it was still complicated to explain to him why Assembly is such a bitch. Nevertheless, we found other projects to have fun with (simplest of them: random movie picker that chooses a movie based on title/genre/etc. from our own movie list file).
On the other hand, explaining and making programming exciting for people who are not into it, so you still seem like an interesting person for new dates (poly relationship), is really hard. But I would also blame my introverted self and not only programming for unsuccessful dating :D -
As someone who does a lot of frontend (I'm basically a junior fullstack) I find it so hard to keep up with all the changes and additions to all of the tools available.
I keep coming across so many amazing tools that I just didn't know about. Recently, it's been flex, grid and SASS. Now it's the idea of css variables... when the fuck did this happen? Why is none of this taught anywhere?!2 -
Can I just say, fuck app wrappers.
Why? Well let me tell you the story of cordova.
My plan was to make a leaderboard kind of thing for the tablesoccer we do at the place I'm interning at.
How it would work:
app -> create game -> API -> live feed
Buttons (flic) -> API
API -> RTU -> live feed
They use Symfony internally and externally, so that was my first go to.
I couldn't find any way to do Symfony that can do RTU without running another service.
As they really want an app but it's not their core domain I looked around for options for wrappers and decided to put RTU on the backburner.
Setting up cordova was slightly annoying but was okay. I got to building the base app.
Then I thought, maybe let's get RTU working with cordova. Looked at the options that were available. Decided to check out socketio since it had an tutorial for cordova. Tried it and it didn't work. Went over the whole internet but nobody seems to have a solution that works (the most recent post being 2017)
So I thought, let's get websockets to work instead, but again. Seems like O just can't get it to work.
So, guess what I'm going to do?
AJAX ever 1 second to the API.
Why the hell does RTU have to be so hard cordova. You are the only open source wrapper that's both multiplatform and easy to set up. Why can't you just work...
I might just call it quits on the app and just make a mobile friendly website instead.. Where socketio and websockets just work. As does SSE..
I'm tired, so sorry for the rambling I hope somebody can make sense of this mess. -
tl;dr: why is it so hard to build a pc?😒
why is it so damn hard to find the right pc components for developing/image editing/gaming/...?😟
i've been googling around and watched many youtube videos on what components to buy/what to watch out for/tips/problems/etc...
i want to build a decent pc for web, mail, office, developing, running linux as VM (for experiments), edit images, doing most in multitasking (and maybe also play some games) ... basically everything, but i can't wrap my head around what to choose😟
every time when i think (for example) "ok, ryzen 5 2400G, that must be it!' there's always smth negative about it, come on!!🙄😤
i wanted to make an AMD setup for 1000€ max
i feel like as a developer/"kinda it guy" i know what i need, then again i feel dumb as fuck, not knowing what to choose and i'm almost certain i will pick smth wrong😪
do u guys have any suggestions for me/any help?22 -
Budding Developer here...
I've tried to teach myself Web Dev over the past 10 yrs on/off... Sad. But now I'm actually in a developer role moved up from IT helpdesk a year ago.
In the past year I've learned SQL, SSRS, SSIS, database concepts, and.... VB6. I am a master at none due to having to cram so much in a year while taking on various projects, issues, and learning the organizations software infrastructure and processes. I also taught myself current HTML, CSS, and basic Javascript. Learning the different basic concepts with each.
Over the past couple months I've been given a new project and now learning ASP.NET and C#. Actually trying really hard to get adept at these as I'm finally doing Web Developing in my role...
I am also dealing with multiple major family issues and a near 2 yr old that we cosleep with that still doesn't sleep through the night.
Why the crap is it so easy to convert an enum to a string but takes 50 functions to convert a string to an enum???
Cast, convert, parse... Why so much logic???
When the online teacher says type why do I have to rifle through 7 different meanings in my head before I know what kind of type he's referring to??4 -
Why is it so damn hard to integrate an external api into Android in a non messy non tedious way... I mean yes I'm new to this but it's unnecessarily tough..
-
Computer society in High school
So while I was in high school, I got excited over the computer society because I thought I could learn a lot of programming stuff from them. I joined and quickly realized that that was a big mistake. They were teaching stuff that you learn from the computer classes in grammar school, eg MS Office, email clients.
I started to learn programming myself through learning online, eventually being the best student in the society. The teacher in charge chose me to teach the class next year, but it cannot be too advance as people would get bored and confused.
Why does classes have to be like this, cannot be too hard. Has to be something that clearly everyone knows. This kind of bullshit has to stop. -
Is there anyone who has ever used frappe/erpnext?
It drives me nuts, as much as I like the framework doing any thing that needs some basic scripting is a pain!
I MEAN, COME ON MAN, WHY ARE DOCS SO HARD TO COME BY? WHY DOES YOUR "CUSTOM SCRIPT" EDITOR LACK BAISIC LINE NUMBERS? WHY ARE YOUR ERROR MESSAGES TELLING ME EVERYTHING BUT THE LINE THE ERROR'S ON, SO I'LL BE HOPEFULL THE ERROR IS IN THE DEV CONSOLE? WHY NOT USE MONACO, SOMETHING, ANYTHING THAT WILL SHOW SYNTAX ERRORS? I'VE WAISTED HOURS ON LITTLE AUTOMATION SCRIPTS!!!! WHY WHY WHY WHY????1 -
It seems now that every weekend all I want to do is just not be around people.
During the week I grin and bear it, the fact that I'm going to have to see, be around and interact with people but the one time I don't have to is the weekend, but that's the time that other people always want to do things.
Why? Why is it so hard to explain to people that a lot of the time, I just need to not? I just need to not be around people, to interact with them in any way. I just want to be on my own, away from it all. Why is it such a difficult concept to grasp?3 -
I want to talk about media queries.
THERE ARE SO MANY FUCKING VIEWPORTS TO SUPPORT.
Seriously, why hasn't this shit been standardised; why does every new device *have* to be different dimensions from the rest?
Couldn't we have a S, M and LG scale for mobile, tablet and desktop????
Then we've got the fucking pleasure of DPR, as if it wasn't hard enough to be comprehensive for your shitty iPhone 5s.
Fuck you.4 -
Why is it so hard to find backend Java developers?
So much work to do... so few people to do it with... -_-11 -
I know the world doesn't owe me anything but why is it so fucking hard to get a job in this industry?? Unless you have a few years experience in a job behind you. Well if I can't get a fucking coding job in the first place how the fuck am I supposed to get work experience. The world is deluded fucked up place. Rant over!9
-
Me : .. but sir without sass/js compiled, how can we address the issue?
Boss : that is not an issue, issue is with on approach we have taken?
You sick fuck, you take other developers un-finished work, expect me to finish it (which it did) and when the other developer is not smart enough to copy paste the solution, you give an "update" to me, I mean how the fuck, what ever..
I really really put efforts to make this shit happen, I know very little about your commerce cloud shit, but when you question my logic on basis of someone who will pay you to finish her work, it is very unethical and hard to swallow it down.
Maybe this is my first real job, that is why this is so hard, but I gotta do what I gotta do -
Story time!
I was with some friends, one a CS student and the other one's a mechanical engineer student with coding like a hobby.
I was listening to a song from which the band released the stems (individual tracks) of a song, and this dude made an anime version of it.
Me: Oh God, this is awesome
Mech: how did he do that?
Me: What? The song?
Mech: Yeah, how did he split the voice and everything, is the music like an Ajax request and he queried for the voice
Me and my other friend lock eyes and began to laugh so fucking hard.
Me: that's not how it works, why did you though that?
Mech: I don't know -
!dev
People that call you, get to voicemail and, instead of leaving you a message (especially if it's something important), just hang up.
Why is it so hard for people to just leave a message saying “Hi, I'm ${PERSON} and I'm calling you because of ${REASON}, to let you know that ${WHATEVER}. Please call back”?
I don't know if it's like that in your respective countries, but here in Spain people seem to have a phobia of leaving voicemails and it's fucking annoying.3 -
Why is it so hard for some programmers to gain the maximum performance and not to waste any resources?7
-
Going to sound sarcastic but for once I'm not...
It's hard to really appreciate how set and forget Linux distro's actually are, I have no internet at the moment and have to use a USB wi-fi dongle, windows rerquires I install a driver yet and so does a USB-C cable (Don't ask why a fucking cable needs a driver to transmit power but hey), I connect both up to my Linux install (Elementary OS) and boom, straight out the box they both work perfectly .-.6 -
Dealing with clients is probably the biggest personal challenge. I'm not much of a people person, and I find it hard to converse with friends and people I've known for years, let alone clients who are looking for answers for why things aren't working, and wanting you to explain exactly (but in simple terms) why a thing that seems simple is so complicated.
Another challenge, which is somewhat related is expressing myself. This again, stems from not being super great or comfortable in conversations, but as a dev, even among other devs, your opinion on things gets asked a lot. For someone who was used to sticking with the status quo and mostly agreeing with things, stuff like peer code reviews, or giving pointers on how to implement something is a big challenge (but I'm improving)2 -
Anyone seeing this rant from Sydney? If yes, why is it so hard to get any IT/Dev jobs for an international student? Sucks.
-
Can someone tell me why the fuck is it so hard to choose where to install electron apps? Selecting installation directory is a default feature in pretty much anything installable. Is electron somehow above that? Is clicking the two a extra buttons to choose a second drive too mainstream nowdays? What? Why? I use Atom, VS code, postman, cycligent, boostnote among others . The idea is good, the apps look beautiful and responsive. But bloated as fuck. Atom alone takes 1.4Gb! And I am ok with it! Really I am! But why the fuck not let me install it in a drive where I have 70% of space free and instead make me use my crammed SSD? Why? WHY?1
-
!dev
https://epicgames.com/fortnite/...
This url brings to error page with invalid email address that will actually autoreply "We're writing to let you know that the group you tried to contact (do-bug) may not exist, or you may not have permission to post messages to the group. A few more details on why you weren't able to post"
Okay, sure. This may happen to indie stuff etc.
But we are talking about bigass company thats fucking trying to assasinate steam (and so far kindda fails). You dont want to show customers error messages, sure, but at least, if you do it, and you tell your customer to send email to admin, make fucking sure that you provide an actually fucking working email. Is it so hard?
No wonder they cant conquer steam. And thats positive side3 -
I honestly think the hardest thing as a developer is to find people who will contribute to a proj nothing against people preoccupied just saying if anyone wants to help they can but back to the main point I also think that motivation is hard thats why I am so grateful for the devrant community
-
Using Ubuntu atm. Use Mac a bit. Why Mac so hard to use and so expensive for that hardware capability.10
-
I spent the last 3 *fucking* hours trying to get bloody BibLatex working on my machine. fuck me upside down with a rusty chainsaw >:( How hard can it possibly be to get 1 fucking reference working for god's sake!!? Referencing its basically the whole fucking reason people use latex alongside typesetting math, why is it so fucking hard!! And to add insult to injury it was working fine in Overleaf, but i have to go through fucking hours of pointless googling and swearing if i wanna do the exact same thing in TexStudio. Fuck! LateX can go to hell, i could have written so much in this time if only the piece of shit bibtex would cooperate a bit...1
-
!rant
Just wanted to get back to my last rant on here: https://devrant.com/rants/1617720/...
So, even though the team still is slimming down we actually did manage to get the two applications live by the deadline. It took my saturday and a lot of hard work, but we managed to pull it off somehow. I'm so happy :)1 -
I spent the entire day trying to force WordPress to enqueue jQuery and fonts.googleapis.com in the footer. Why is this so hard to do? Why is this still a problem? Does Automattic just not know that PageSpeed Insights flagging render blocking is even a thing?
-
what is that annoying little bug in my brain that triggers those annoying Chemicals which makes sleeping at night even after being awake for 27 hours, so goddamn hard?
protocol nature's spec describe the natural and optimal daily rhytm as sleeping 8 hours each night, so why is obeying the defaults so goddamn troubling?!7 -
Why is React.js so hard to learn for someone from a JAVA back end background? I'm constantly asking myself "so should I set param as string? or int? Array? so many methods that's returning html tags! what collects all and makes it appear at WHERE??"9
-
I am doing an Ionic App for the Client. The client was responsible to provide me with API, so basically, I will just be pulling and showing things in the App.
Last week Friday, Client tried hard to put the blame on me for their API, idk why? Per them, I should have checked the API before doing the development. The way their API works it very confusing and it just making hell a lot of request. Well I tried explaining to them but fuck it anyways...2 -
Entry/Junior dev rant:
Project I was given, with no hard deadline has been dragging on for weeks. Requirements keep changing because reviewers come up with new corner cases every time I push my latest round of code changes (based on last round of feedback) ..
This proj was supposed to only take a month, i'm on 2 months now, now I also have to mock the 3rd party service API so we dont make live calls to the real servers for testing..
I was encouraged early on to get a prototype working ASAP of my project, so I hacked it together in 2 weeks..
Kicking myself in the ass for not spending those first 2 weeks creating a spec and getting input on all corner cases so when dev time came, everything would go smoothly.
"Build a prototype" approach to feature proposal seems like a tease b/c there is waayyy more planning involved in making a real feature.
Note that I'm doing this from the product team, and my mgr is pressing me for results and "why isn't this shipped yet?"
BECAUSE WE HAVE TO THINK THIS WHOLE THING THROUGH BEFOREHAND!!!
I really do want to make a lateral move to engineering. Shit is hard, yeah I get it.. Wish this proj would stop generating scope creep. Trying not to take it personally that code feedback takes days to get, either.1 -
Why does it have to be so hard to watch blu-ray movies on Linux? Either the decryption libraries crash or they freeze the whole system.
I give up, I'm booting Windows now.7 -
Wasted 8 hours today trying to convince Windows to boot.
Yesterday I deleted two unused partitions. Today no OS booted up. Guess what, diskpart (think parted for Windows) reindexes GPT partitions on any modification. So when I deleted partition #1, my EFI System Partition, previously #2, became #1. But UEFI was still trying to boot from partition #2.
Linux booted after recreating UEFI boot entry. 1 minute job, no tools required. Windows, though... Bootrec /rebuildbcd failed, bcdedit failed, recreating ESP from scratch failed spectacularly. Finally I made a clean install just to get proper ESP and restored OS from backup.
Dammit, Windows. Why do you have to make things that hard.5 -
That feeling when you inherit a script to automate something that takes 10 seconds. Why would they even write this? It's not like the task is hard....
...
And why would they write it this way? I'm sure if I just move this part and ....
That feeling when you spend several hours improving and redesigning a perfectly functional script to automate a 10 second task for zero gain aside from cleaner code. "But the code for this quick-and-dirty script I'm never going to look at again looks so much better now!"
... If only it did a bunch of complicated parsing, regex matching, and error checking just so I can answer one less prompt.... Unless that parsing fails. Then it should still ask me for that prompt... And also validate that the answers I give are valid and correct....
That feeling when you spend a whole nother day starting from scratch to implement error checking and complex parsing logic knowing full well the original task takes 10 seconds to do manually and is needed at most twice a day (for a grand total of 20s a day)
WHY AM I LIKE THIS?!?!?!4 -
Migrating an existing report from old system to new.
Business: We reviewed the differences you raised and why they're acceptable and this seems fine. But before we provide approval for your productionization, we would like these changes...
*1 month later, changes are made*
Business: you reported new differences. We can't give you approval until you tell us explain them all
Me: `••π÷¶×¶π|``•√÷÷÷π√^°°¥®^¥€€!!!!!!!
Can someone give me a new job so I can just walk in, say fuck it, I quit!!!"
Sometimes I just want to do that now but getting a new job is hard.... for reasons unrelated to how well I can code... -
Started reading Learn C the hard way by zed a Shaw and I can't figure out why my make file won't work, it's so darn annoying and I've like gone over each character and still no success1
-
Ugh, making a game engine (It's more like a framework than an engine but idgaf) and it's all based around easy to make content and everything is built using 'mods' hence its name, The Mod Engine but I've been trying to come up with a logo for the engine... Why is it so fucking hard trying to make a logo!
Anyone have any suggestions? :-/1 -
So I got the new macbook pro 15 with touchbar .... this is my first macbook that I have ‚issues‘ with.
* the new butterfly keaboard doesnt feel as good as the old one
* ... abd its friggin loud!
* the keyboard backlight just randomly drops out and forces me to cold reboot WTF??
* they bigger left/right cursor buttons make it so hard to feel where you are, that I constantly confuse up and down
* the touchbar is basically unusable for a keyboard centric person like me. It forces me too look down to the keys!
* I constantly hit the esc bc im used to have one finger there to hit it if needed, but now im forced to hover it bc otherwise it is pressed
* and why of fucking why did apple remove magsafe??? Now i dont even see anymore if is is being charged without turning the screen on
* i hate the usb ports too, why not even add a free usbc to usba port? (Well, i guess bc it would make the macbook even more expensive... free wouldnt be free anyway i guess)
It is way more powerful though, but the time i would buy a personal one is over and will probably never come back.
Im a happy hackintosh user btw 😅4 -
Update:
I've been trying to leave DoD for a couple of months now. Translating my 10 year's experience with complex Intelligence enterprise level systems to something relatable to the civilian IT world. Grabbed a few certs to help out A+, network+ and security+ with Linux+ as my next target. Photos of me working on unclassified systems, radios, cell towers and servers. I'm a teacher for military UAS so this shouldn't be to hard to get even a basic job in IT right.
No one will hire...
Linux admin: Nope
Network admin: Nope
Assistant Network admin: Nope
IT call service: Nope
Pool cleaner fucking nope
Many interviews and nothing
I'm broke and sold all of my personal valuables. I can't hold out much longer and really looking at becoming homeless. But I'm kinda ok with it, one last payment on my apartment and car is all I can do now. My parents think I'm in Afghanistan working a six figure job lol
DoD: we see you're trying to leave we'll pay you alot to teach A+, Network+ and Security+ traveling all across the country and staying at hotels with all expenses paid.
FU FU FU I want out please tell me someone has a job, I'll be a janitor of a server room Idc I just want out. Fuck the pay
I start Tuesday...4 -
Just need to vent out a bit. There's already been a few times at work where the senior developer asks me why I take so long to do something, and I'm unable to fully explain why.
Now, I could think of several reasons. Maybe it's my lack of experience; I just start researching on Google for solutions, start putting things together, and then I guess things start to get too complicated for me to be able to explain clearly. Maybe I end up "over-engineering" to solve problems that could be solved in a simpler way.
And this leads to my second reason, and that is there's no code review going on. I've wanted to just tell him, "If you'd just take a long look at my code, you'd understand why it's taking me so long! So you can tell me if I'm doing it right or wrong, or if I'm making it too complicated!" But, of course, being the junior developer, I also think that when he's explaining how to do something, I'm just not understanding it right.
I could ask for clarifications, and believe I've done that on some things, but my third reason is that he's just not good at explaining things, or that there's some miscommunication happening. English isn't his first language. His English is ok, but I know there's a lot of room for improvement. I also notice that our other co-workers are also having a bit of a hard time but it seems they already developed some sort of adaptation to communicate with him.
So yeah, there's my rant, and I'd love to know everyone's input on this. -
I fucking hate it how the io shield provided with motherboards always are hard to install. Why the fuck isn't there a standard or something that motherboard manufactures have to follow, so that the io shield can be pre-installed in the case.1
-
I don't know maybe it's me. I'm sure that at booking.com they have hundred of GUI/UX/UI experts, product owners, A/B testing and whatever.
So, please, can you explain to me in a professional and scientific why, why the fuck, when I search for an hotel in a place for a date, by default, they show me UNAVAILABLE properties?
Like, "hey sorry, there was this great hotel, right in the center and very cheap, but you missed it!! hahahaha, you poor moron"
And every time I have to ACTIVATE the fucking filter myself "only show available properties".
Excuse me? Who want to see in first position the hotels that are NOT available?
Are there some users out there who wants that? If I were hired at booking.com as Product Owner or UX/UI expert, I think the first thing I'll propose is to quit the fucking filter whatsoever or at least to enable it by design.
So why is that? you want to show off? slap me in the face, with your hard cock-list of hotels you have anyway, but not for me?4 -
WHAT THE FUCK! why is it so fucking hard to add a startup script in Fedora 15. ARE YOU FUCKING NUTS?7
-
I'm currently using team viewer to access a computer of a colleague because only they have access to a vpn I need. So once I'm on the VPN I can then ssh into a ec2 instance. There are several ec2s I need to access but I've only been given direct access to one. Once inside that ec2 I can use it to ssh into the other ec2s....
Dawg..... why
Life isn't supposed to be this hard2 -
OMF you motherfucking Eclipse developers. All I want is to build an application with SWT. WHY THE FUCKING FUCK is that near impossible.
1) why are there no SWT maven artifacts= only 3 year old ones on a custom github repo?
2) why is is fucking rocket science to even find a guide on how to build this fucking piece of shit yourself
3) WHY THE FRIGGIN FUCKING FUCK OF FUCKS is it so hard to build it your self - outdated docs .... nice, dead links and repos, nicer .... referenced maven artifacts from a non-existing, none-documented repo, ... wow you're really kickin it here.
All I want is to fix this nullpointer in this fucking piece of shit you call framework ...
Have you actually tried to read your docs (can we really call that shit docs?) from a none-100years-swt dev's point of view?
Noone understands shit!
Why is there no standard build system, like maven, grade or for fuck's sake even ant?
It almost feels if you devs don't want anyone use your abomination, so it can die in peace.
Arg, I could puke ...5 -
Why is it so hard to find a good work from home position? I love my home office and I honestly don't get distracted so it would be perfect for me.8
-
Why it's so damn hard to find a GF as a Dev?
when I talk to one no title about life but dev titles come to my mouth and she has no idea what the heck am i talking about!6 -
Was about 13-14 years old, on my first laptop, a HP Pavilion G6. I had Ubuntu on it, and tried to write an iso to a USB with dd. Didn't work, so I forgot about it for up to maybe a week, and was playing Minecraft one day when my laptop froze and nothing was responding, so I did a hard reboot.
No operating systems found.
Many tears were shed that day.
Took me maybe 6 months to realize that the "botched" dd probably caused the wipe.
Still don't know why my computer was still running... If anyone thinks that the dd didn't cause it I'm curious what your theory is.4 -
Why the fuck is it so hard to write a simple bash script. Syntax so strange and so many symbols you need to know. If you need to do calculations with floating point numbers, the mess is perfect.11
-
When writing regexes why the fuck would you not use \w instead of writing [a-zA-Z0-9] or \d instead of [0-9] or the dozen other metacharacters? Makes it so fucking hard to decrypt long regexes.2
-
Background: I am working on task x. On successful completion of task x, task y may be given to me. Task x is haaaaaard. My group is not the only player and any fuck up will break my group and at least two others. Now here is my story:
Me: Yeah I am doing this hard thing and that hard thing and getting ready for these hard meetings.
FormerCoWorker fcw (): wow that sounds hard.
CurrentCoWorker ccw (): yeah he's working on task x and task you.
Me me (): what? No I'm not. I am working on task x. Don't go randomly assigning me tasks like that.
ccw: well if you finish task x you will be an expert in section z of code. So it is only natural you take on task you.
me: yeah but task x sucks and task y is why several engineers have quit the company. You never know. You could be assigned task y and quit. Why do I have to take on task y and quit?
NGL, I will do it of they promote me. I may be a whore, but I am gonna get paid. -
Why is it so hard to find a way to make nice frontend on Visual Prolog. I trully hate interfaces that looks like Windows vista.1
-
So, working on real multi language support today I was searching for countries and country-codes. Yes this one is easy peasy. Also easy if you want every countryname in your supported languages.
But why is there no source for the states or provinces translated in every language. It's so hard to find...
Anyone knows a source for it? Is it worth to create a project for such translations?1 -
Why must pixel perfect scaling be so fucking hard... It all works perfectly but I'm limited to a max of 540p for the games camera view but as soon as you drop your resolution bellow 1080p you get stuck with 300p or lower... Ughhhhhhhh
Why did I choose to do pixel art... Wonder if converting everything to vectors would help, wonder is smashing my head into a fucking wall would help... -
Why does it have to be so incredibly hard to get an nvidia card to work under Linux? The driver is in available, we have the technology but every time I try to get this damned thing to work I end up in front of a fucked XServer and this stupid "Something went wrong" gdm screen only to apt-purge nvidia from my drive and start from the beginning once more.6
-
Remind me again why we have to use/support a weird entity creating framework across all microservices? So that every entity is consistent? (Who cares? Microservices shouldn't) Because hibernate is hard? (It isn't, and it's better documented than this, which needs hibernate anyway).
I'm just building a fragile distributed monolith. -
Just bought a Chromebook Pixel. Love the hardware - Chromebooks in general are a great way to get a Linux laptop with guaranteed driver support.
But why is it still so hard to get decent HiDPI support in Linux (or for that matter Windows) desktop environments?
I realise Apple had an advantage in using vector-based Display Postscript, but massively divergent screen sizes and resolutions have been around for YEARS now, so why is it still such a faff?2 -
I just had a math test. It was incredibly hard! I donno why teachers do this! They learn us easy things and ask us hard questions.
I think I'll fail and I'm sooooo angry cause for the first time in collage i really have studied and its so unfair:/2 -
So I'm building this environmental monitoring system for one of the Labs to monitor Temperature and Humidity. the "software" that comes as part of the package with these sensors is really just a website you host yourself if you don't choose the cloud option. No big deal really, (see my previous rant about getting windows server through SSC) I setup IIS and get the "software" registered get a couple sensors running looks good. However I don't like the error messages that popup because it's unsecured. do some reading and I find out that most browsers will give you a warning if your not using HTTPS even if it's for internal use only. OK we'll how hard can it be in implement encryption, turns out it's not that hard and you can do it for free how with letsencrypt and other places. I like free, now i have to use SSH to get into the server and run an ACME client. Hey open SSH is part of windows now cool, download an ACME client SSH into the server and nope doesn't work. Oh right I'm behind a corporate firewall and a bunch of other shit I can't control. Why is so damn arduous to setup this god dam internal website and the problems aren't even the site. Now I'm playing with AWS spinning up an instance to be able to try and get an SSL certificate just so i don't have to tell people it's OK to trust this site ignore the big angry warning.
Best part is other similar internal sites don;t use SSL and all have big messages about someone stealing your soul if you go there and these are commercial systems that run all the HVAC for all the campuses across Canada.
I need more Tylenol. -
Fuck's sake, why is setting up ipv6 for an LXC container so hard?
For whatever reason the assigned ipv6 address to the lxcbr0 interface (on the host) doesn't stick, and any v6 outgoing traffic from the container is blocked.
Can't find any decent documentation either :(1 -
Why the fuck are compilers hard? I know why they're hard but are they supposed to be this hard?!
And why the fuck is our group so unlucky that we get the implementation of struct in a C-like language instead of some simple 2-dim array???
The semantics part is insane to code 😵 -
Read complete Linux revealed book but didn't get to know why it was named so?
How hard was it to write a single line author?
PS: "Kali" is an Hindu Goddess.3 -
Just started trying to learn Chef. Took me about 3 hours just to setup my environment so I can even create a recipe. And now all I want to do is to create a recipe to install ntp but apparently that's too much to ask of chef and I can't figure out for the life of me how to do it.
-
Bloody fucking Android! Updates, updates and more updates! My development Nexus 5X won't allow me to sideload apps since it updated... Hello, printf debugging! Goodbye, profiler and debugger!
My hate for Android grows with each version after 4.0.$something... 2 was shit, I missed 3, 4 was OK, and since then it's going steeply down.
And don't get me started on Material Design...! Good luck figuring out what's a button and what's a label...
And what's up with the "let's keep all apps running all the time to save a few ms on start" philosophy!? Who thought that is a good idea!? Yeah, System.exit(0) works, but... Is it so hard to determine when it's not needed anymore (has no services running etc.)? Why should a web browser (for example) stay in memory after I quit? Minimize is a thing (Home button), why make it so confusing?
Another thing - feedback-less async tasks - why? I like to know when it is working in the background... How the hell am I supposed to find out if it is supposed to do this or if it is frozen?
And Android deciding to kill your process whenever it pleases without any callback... Happened to me once with an Activity in the foreground (no exceptions anywhere in my app, it just quit). How do you do IO properly? It seems you can't guarantee some file or socket or something that must be closed doesn't stay open (requiring to restart Bluetooth 'cause the socket wasn't closed, for example)...5 -
Why it's hard to look for an Android developer position abroad is so hard ?
Basically am lebanese with 2 years of experience
But hey rant reader if you can help please comment below3 -
So I have this habit of copying all my family pics and kids videos onto portable hard disks. Have a 500GB Western Digital since 2012 and another WD 1TB since 2016.
Had one portable HDD failure before that back in 2010, but that contained only old projects code {when I didn't know git} .
So any advice you guys have for me on managing backups of these life memories? I mean I don't trust cloud storage - Google Drive, DropBox etc. And don't want any 3rd party poking into my stuff. That's why these items go straight from Camera to HDD.
What should I do to prepare for another failure? And is there any kind of RAID available in the form of portable solution?
Is it a good idea to change HDD every 5 years or so?10 -
Why oh why it's so fucking hard to update perl on gentoo!?
It just shows how broken portage as become.
And everyone seems to have it's own magic incantation of emerge/qlist
Fucking fuck piece of shit gentoo is becoming5 -
So I have a xaml object that is designed for pagination on web pages, and the current page must be at least 1.
But the web service used for the data that go with that object starts its pagination at least at 0.
So everytime I must assure that the xaml object has 1 and the web service has 0 for the first page.
That's not hard, but that's the kind of thing that's annoying, why doing it that way -
I hate AWS ec2 instanced with it shitty handling of environment variables...Why in hell it is so hard to set an environment variable which will be re-set in case the instance will be restarted? For hours I'm fighting through manuals and non of the described procedures work2
-
<rant> Why is Apiary's editor so weak? It has no support for navigating from request to its code, it hides inheritance (so in the end you end up navigating source code via ctrl+f which is very cumbersome) and is buggy as hell. It randomly scrolls around, after awhile is laggy, syntax highlighting often breaks on a blank line with few spaces and so on... I wish so hard it would have had a plugin for IntelliJ IDEA with proper navigation and request preview. The web "editor" is just so clunky and generally bad :(.</rant>
-
Why is Drupal counter intuitive and unwelcoming! Why make it hard for new comers!
If you are looking for a feature, you have to code it anyway. So much code under the hood but you always end up using contributed modules or create your own. fck fck fck. So many buggy modules.
fck fck fck1 -
So I've sent emails to a couple of people (some of which I found on devRant) that were offering work. Typed a small story about myself and why I'd love to take the work.
No reply whatsoever.
Like, I get it if you don't want me, completely understand that, but how hard is it to let me know that.
Like c'mon guys, don't be a dick.
Disclaimers: I got the email address right, they did not land in my spam or whatever since I did receive an email from them in an earlier part of the correspondence. I did give them (what is in my opinion) a reasonable time to respond. They also didn't die or something since they are still active here...2 -
I really wish i can jump and be focussed like alot of the developers i have met. I tend to take long to get focused and long to get out of it. The reason why it was so hard to work with companies and easy to work remotely
-
Saw my colleague debugging. He's got a try-catch, then I asked, "Why aren't you logging the stack trace?". He answered, "I don't cause it will be a security risk". So there he was having a hard time debugging.🤯
Can you guys confirm if what he said is true?4 -
Hello, folk! I have strange question! =/. Why I should use Linux??? I have w10 and it's amazing. Specially all office 365. But I wan't to use linux, just don't know why, because it's hard to use them:D. So I'm looking for strong answers why to use it! Can somebody help me?? =)6
-
I've spent weeks trying to figure out how to set up Visual Shit 2017 with wxWidgets and still haven't figured it out. None of those settings I modified (project properties) worked at all. Months, probably, but just gave up at the end everytime. Nothing I tried worked, but the first time I tried setting it up for CodeLite on Ubuntu, it worked like a charm. All I wanted was to be able to develop cross-platform applications with wxWidgets, was it really that hard? I haven't even thought about cross-compilation from Ubuntu for Windows yet, the very though fills me with dread.
Why the fuck is it so hard to develop something so simple using Windows?2 -
Why can we deprecate a regular language like Python 2 (26 months can't come by fast enough) but yet it seems web development is impervious to the idea? If you want to make a website, you must use HTML, CSS, AND JS (or a transpiled language).
I get we use it for backwards compatibility but this combo makes web development so messy and weird, it's hard to understand from a newcomers perspective.
Maybe I'm just too stubborn to understand 🤔3 -
When not even google can develop a HTML page so it displays correctly in Edge.... Seems Google needs to hire new web developers... Why should it be so hard to develop a HTML page with proper CSS?
9 -
Okay, can anyone explain to me why this is the third time in a row that I have to re-disable "fast startup" after a windows-update?
I know, some of you might think that windows sucks, and I agree, to some extent, but I still want to be able to play my games there.
So, is there any rational explanation for the fact that windows seems to suffer from some kind of amnesia when it comes to settings? I don't believe it was either bad intent or complete incompetence from the developers...
Is it a certain design decision? Or is is that hard to implement "persistent" settings storage?3 -
Please Google fix my Chromebook's new tab screen as well as stop screwing up every single screenshot extension. I can't directly upload screenshots slowing down skype meetings. Why are you doing this to me? Your product forums (https://productforums.google.com/fo...) are treating me like I am an old lady who doesn't know what they are talking about. I do not understand what's so hard to comprehend. 1 Google Support Chat, 2 Feedbacks, 1 Debug Log Sent, Screenshots and everything yet you still fail. I have provided significant proof that there is an issue caused by you. Now please fix it because I can't since the Chromebook disables all code not signed by Google (unless you are in dev mode aka annoying screen + lose all security). You guys like hate me or something :(
-
Has anyone around here installed the Developer Preview of Android P on their Pixel (any model)?
I'm trying to figure out which models would have access to the android.net.wifi.rtt APIs.
If one of you Pixel with Android P owners could send me the result of `context.packageManager.hasSystemFeature(PackageManager.FEATURE_WIFI_RTT)`, that would be a ton of help to me :)
PS: to run this, you'd probably need to install the Android P Preview SDK platform, there's a tutorial to do just there: https://developer.android.com/previ...1 -
Why is it that nobody can seem to figure out you need a god forsaken "cause" field of type Error in your Error class
How is this so fucking hard to understand for language makers3 -
I like Navicat, but why does it need to be so hard to edit the name of an entity? I'm clicking, double-clicking, triple-clicking. Most of the times nothing happens, but occassianally it suddenly works. I fail to see a pattern for when it works? Anyone have an idea how I'm supposed to talk Navicat into letting me edit entity names?5
-
Being in the "zone" and having to do some stupid shit immediately. Getting back into the "zone" is hard as fuck and then somebody questions me why it takes so long. Smh 😑
-
Fuck today is just one of those fucking days. I'm THE junior and I'm just hitting a fucking wall with my task.
It's like I have Legos, I know how to build basic shapes and cars and planes, but I can't make the connection in my head to build more advanced things like a space shuttle.
Seriously anyone have any recent feedback on working g with QuickBooks online???1 -
Why in the world wide web is it so hard to use JavaScript to dynamically create a custom web component element after the page has loaded!? I swear I must be missing something obvious. I know it isn't working because document.currentScript.ownerDocument is null and I use that to get the template and it works great if the elements are on the page already but it fails as soon as I try to use JS to create a new element of that component and I can't figure it out!
I could easily change the pages to be pre-rendered with data and it'd work fine but I plan on building in a service worker to cache the page skeleton and store the elements in IDB.
(This has been just a fun side project for me this week, until now it's turned into a frustrating project I spent most of my night on)1 -
Fuck xrdb and it's shitty documentation. Why is it so hard to setup pywal ? Why can't you put simple docs? Configuring anything sucks!1
Top Tags
Weekly Rant
View