People are worried that AI will replace them in their jobs.

But guys.

We are still using php.

I think we are safe for the next 200 years.

(overheard parents talking)

Mum: I'm worried about our son, I guess he was hacking today
Dad: What? [Chuckle] No. He's not that grown up enough. Prolly programming.
Mum: But, the screen was all blue and there was nothing but text on it. And then suddenly it went blank. So, I asked him what he was doing and he said it was a BSOD. That sounds scary NSA level stuff.
Dad: it isn't [came out of the room, saw me there]

(And we laughed and laughed and laughed)

Interviewer: We're worried you don't have enough backend experience for this frontend position.

Programmer was smoking...

lady nearby: "can't you see the warning smoking is injurious to your life!"

Programmer: "we are not worried about warnings only about Errors"

Any devs here that Code in C/C++...?
Or am I lost in "webRant".

I am worried about the future " code everything in javascript " generation :)

Make pointers great again!

So my cousin approaches me with his Android phone and, with a worried tone, says:

- "But... is it true that if you enable the developer mode you can get arrested?"
- "What? No. Why?"
- "Because this screen says so. I once enabled them out of curiosity but then I couldn't disable it so I had to reset the phone."

Turns out that, in Italian, "arrest" is a synonym of "halt". The message says "these settings can cause the _arrest_ or malfunctioning of the device"

Couldn't stop laughing 😂

For years I worried I was not a good programmer because of bugs, issues and not giving accurate timescales.

Then I discovered devRant and realised that there’s thousands of us that have the same issues.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

My colleague just committed some code with description "improved some bugs"

...should I be worried? 😂

Her: What do you do?
Me: I'm writing my thesis on bringing AI to smartphones.
Her: I think AI is terrible!
Me: oh, you are an engineer too?
Her: No
Me: oh, you've studied economics and or ethics and are worried about its implications on society?
Her: No, but have you?
Me: I have a degree in economics, an MBA and an now about to get my BSc in CS.
Her: well, regardless I still think it's terrible.
Me: well in that case how about you shove your unfounded opinion where the sun don't shine!

I'm still a bit worried...

Does my old computer count?
2016:
Windows XP
Visual Studio 2010
1GB RAM
An old Pentium inside
I am now worried that both Raspberry pie 3 and my phone, both costing less have better specifications

!rant

Got pulled into a meeting with my PM at 4:30 yesterday. Was a bit worried (been feeling some imposter syndrome recently), but then he starts out, "These are my favorite meetings to have." I got a pretty big raise! Totally unprompted. I love my job and my PM.

Morning after my linux administration exam my mother called 15 times to wake me up. When I finaly answered the phone she she was worried so she asked.
Mom: wtf is wrong with you, is everything okay?
Me: not sure, i think something went wrong. I'll send you the log files later. *Hangs up the phone.

Apparently I do shit like that every time she tries to call me in the morning as she writes down our "conversations" just to laugh at me later.

brain@sleep:~$ sudo rm -rf /

You all, something is wrong. No one has pissed me off at work recently (other than boss, but he does that by existing). I'm not sure if they've all learned, or if shit is about to hit the fan.

lol yes definitely be worried

I'm a bit worried at how little of my question Google actually just answered...

Getting older. I've been needlessly worried about my age as a developer since I was 23, which is hilarious.

People always need good devs. You don't have to become a manager or commit suicide at 30. Just be awesome and someone will pay you.

So I used to be a chef, then I got married and decided my weekends and holidays were better spent than making food for ungrateful shit-wagglers, or getting screamed at in Lebanese by the exec Chef during dinner service at the end of a ten-hour shift, so I went back to school for Computer Engineering. I was so worried because I swore compulsively from day one of classes.
Little did I know way back then, the first programming language I ever learned was swearing.

Today @ 4pm:

New dev: I need help with this issue, i've been stuck on it all day.

Me: ok let's look ...... ok, and did you try google this?

New dev: ... no

Me: ... why?

New dev: well this is clearly my issue, why would I google it? I only google for things I don't know

Me: ... ok ... we'll do you know what this bug is then?

New dev: haha ok, fair point, I'll give that a try. Thanks for the tip.

Seriously, should I be worried? I feel worried

Yay my stickers finally arrived! Thanks guys <3 @dfox @trogus

And it freaked out my mum. She called me all panicked like "you've got an international letter what did you do did you get scammed or something"
...
"Mum, those are stickers...I got for free"
"Ohhhh... ok then"
But shre was very worried there ^^'

Reinstalling arch. I broke it while grading homework. Sad. Also worried my phone is going to ring and I'm going to not have my laptop ready.

Dear Microsoft,

It's been almost 2 days since you have asked me to update to Windows 10, I'm beginning to get a little worried, is everything ok?

Happy to announce my middle mouse button has started working again!

I know you were all worried... :/

I just came across some code I wrote a year ago that I don't entirely hate.

I'm legitimately a bit worried.

I received my Driver's licence today. Yayy!! (I had been waiting for it for quite some time,worried if it will ever reach me)
Then I casually asked the postman. If there was any other package for me, because I am expecting a little blue package sent from US.
And he said he'll go back and check.

A few minutes later the door bell rang again 😍🤩
Here they are 😋.

I hope,even the devrant stickers reach me soon 😣.

I just got hired as a systems administrator at a company that develops web forms. NO ONE in the company has heard of git. They don't use any kind of version control.
I'm a little worried...

#¤%@ kid!!! My 5yo son has obviously been playing with his mom's mobile phone. At first, I thought it was a little cute, when I received incoherent texts about Roblox, one of his favourite games.

But then, I suddenly heard from my sister who was really upset and worried. She was wondering if my gf really wants to see her dead, after receiving a facebook pm in English, saying "oh die :-)".

No need for auntie to take it personally though; turned out she was not the only one getting the same message :-O

A little boy is facing a mobile ban for a very long time...

I'm reluctant to introduce devRant to my co-workers because I'm worried they might connect the dots and realize I've been complaining about them :/

!dev related

Wife is not pregnant......

.....we have been trying to...STAY LIKE THAT FOR A WHILE NOW and after a big scare I was really worried :v we have one kid already and that Is how we plan to stay until I start my business.

These are the best news I've had all month.

Yaaaaaaaaaaaaaaay

Online ads....

I think the problem is that in the age of "AI" and "machine learning" etc etc - the reality is that targeted or personalised advertising is absolutely shite.

All I see when I browse around are ads for things that I bought. It's like - I FUCKING BOUGHT THIS WHY ARE YOU TRYING TO SELL IT TO ME??!

I think anyone worried about the machine uprising enslaving humanity can relax and not worry about it, at least until amazon can understand when it has sold you something or you just looked at something.

To everyone in hurricane war path...

YOUR WONDERFUL STUBBORN ASSES BETTER LET ME KNOW YOU'RE OK. I'M GOING TO BE WORRIED SICK UNTIL ALL THESE FUCKING WATER TORNADOES ARE DONE.

Running a huge migration on our production db.
Takes 45+15 minutes (migration+tests) on my lappy. So. I'm going to be bored and slightly worried for the next hour.

Hopefully the production servers will be faster.

Only a few days in on using my new phone, already gathered 67 tabs in my browser and counting.. should I be worried? 😥

The public seems to be worried a lot on the Facebook "data breach" yet doesn't bat an eye on a bigger website that has already been selling private data for more than a decade.

Google

I might lose my Job. Thanks to Central Bank of Nigeria's shenanigans, a promising FinTech startup might be about to go under.

Last month I got married, last month I got a raise. This morning, got told I'm being put on compulsory leave without pay (same as everyone).

Expecting no salary this month. I guess I'll be fine with some Laravel/Flutter freelancing.

Now, how to break the news to my wife. She knows I love my job, she's gonna be even more heartbroken/worried than I am. We were supposed to move to a bigger apartment next month when yearly rent here is due.

I guess we'll be alright. It is what it is.

I just found this example in our school book. Should I be worried? (My teacher wrote the book BTW)

Okay, this is me panicking. We're switching to Microsoft Teams at work. This means that I will have to cut the Slack and switch to a fucking Microsoft solution for chat. Am I supposed to be worried?

My coffee to water ratio in a cup is starting to be 1/2. I'm worried in the future I will be eating coffee not drink it anymore 😂

Dreamt I was writing code for work last night, pretty sketchy stuff. But then at some point I woke up, and in my daze panicked thinking that I'd actually written that code. So when I fell back asleep, dream me was working on fixing all the issues that I actually had never writen. Woke up again, worried about if I had left everything well, and realized my stupidity.

I need some days off... 📴

!rant

I got a promotion at work!

Is it weird that I don't want it because I still feel like I have too much to learn to no longer be a "junior"? I'm happy that my hard work is paying off but I'm worried that this is how bad senior devs are made.

Sorry, but I’m just not worried about AI taking over… (yet)

Context: a co-worker had sent an email and was worried about possible collateral damage.

Co-worker: uhm, you know how it is when something just doesn't feel right?

Me: sure, every time I clock in here.

I bumped into my PC early this morning, and it took me 12 hours to realize that 3 out of 4 RAM sticks were chilling on top of my graphics card... together with the CPU cooler.

I'm not sure whether I should be amazed that it kept running (with a few random reboots) with just a crusty chunk of thermal paste as a cooling block, or worried about how fried my hardware is now.

O hell I am worried... :|

I just dropped my office laptop !
😨😨😨😨
There is a crack on the corner of the body but the device is Ok !
I am worried they will charge me the whole cost of the laptop ( i.e. 3 months worth salary )

Don’t know if I should be worried that I received an invite to a 1-on-1 meeting with the company CEO…

the dev team freaked our boss out by being overly nice and polite to him for a whole day .
Normally we're pretty laid back and tease one another, so he was pretty worried.
You know you have an awesome and tight-knit team when your boss threatens to fire all of you for being too nice and you can laugh about it.
#AwesomeBoss

recently people have been worried about what people were going to say I.e "no hate" , don't hold back!

In devrant we only mean light hearted banter if we are pissed we don't want to hurt you we are pissed at a thing and not directly at you. Not that I speak for dfox or trogus but I'm sure that's what they are going for, and it's what ive seen!

We are nice here... This isn't YouTube , it's a credit to devs we are nice people. Hell it isn't stack overflow!

Also I'm brutally honest at times but I love you really.

*team worried about Slack conversations being tracked in the company*
Solution: Shared text file over network. Edit and save it for private communication. Best idea ever?

I earned devie middle. Bought devie left. I came in this morning and devie right is looking at me???
This may be a Tribble situation! Worried when I open my office door Monday they may come pouring out. What will I do with thousands of devies???

Iron Man is worried about his code.

I hardly even know javascript, but I was able to identify and fix a problem in my Father's corporation website. Should I be worried, that the developer working for him wasn't able to do so?

So I was just wondering, do any of you guys know what happened to @BlueNutterfly, I mean besides her parents taking away a lot of her beloved belongings. How is she? Is she still on devrant? did she get her things back? Did she move out? The last time I saw her here is a couple of months ago. I miss her and I think a lot of you do as well. It really sucks what happened to her and nobody should go through these kinds of things, I really hope she is okay and moved out or does so soon. If anyone could shed a little light on this, I would be very grateful, I'm really worried about her.

So, I told my programmer friend to bring food for us while you are out.

He has still not came, Should I be worried ?

"Do the back up later."

Well, I wouldn't be worried about it if we did have any for last 4 years!

My printer just emailed me asking to be switched on... :| ..... should I be worried..... skynet?

To the coworkers who won't read this -- If you have a question to message me, type the QUESTION ITSELF. Don't coyly request permission to ask me a question because you're worried you'll bother me, that just turns it into TWO questions. Let us put an end to saying 'hey, can I ask you a question' and then virtually walking away.

I have some how managed to put my self in a Software Architect role with a salary of a Junior developer, My team, who are even more junior as a swath of fresh grads are looking up to me to design this project. I am doubting my abilities and am worried I am going to under deliver, how am I ever going to learn this. Stressed.

I forgot my password to [SITE]. Of course, I click "forgot password", and enter my email, which I did remember. Fairly routine "ah shit we have a problem" steps.

Now, it takes a second. This is to be expected. So I'm not worried. I then get the email and...

Now, you will notice that I redacted some information, like the company name, email, and my PLAIN TEXT PASSWORD, and my name.

I would like to note that this isn't a small, very local company that's new (even then it'd be unacceptable), but this is a multinational, multimillion dollar company.
How'd someone fuck up THIS badly?

I just had my cell phone cloned yesterday. End of the day, my phone lost signal suddenly. I thought it was a problem with my chip, so I decided to check that on a store and buy a new one next day.

Today, after I recover my chip and number, I started to see the mess. Someone used my number to send message to all my contacts on whatsapp, asking for money. Also, I had some contact info changed on the bank broker, which is really serious. I do not know what else is compromised, and I'm truly worried about it.

Someone has some good tips for improving security while using cellphones?

No, I'm not worried at all. *screams inside*

Long time lurker, first time poster. This site has been a huge source of fun and laughs for me on bad days.

So dear fellas,

I've been a software engineer for about 5 to 6 years which was intense as fuck and I've been burnt out multiple times. My highest rank was a senior software engineer so far.

I was offered a new job recently as a Technical lead for a small team which would mean I have to make architecural decisions on top of good ol grunting out the code. I took up the offer but I'm more worried than happy.

Impostor syndrome has kicked in heavily ever since I agreed to the job. What if they realise I don't know certain things that engineers are supposed to know? What if I get in an embarassing situation where somebody asks me a question and I'm not able to answer? What if people who I work with laugh behind my back cos I'm not a rockstar engineer?

I'm depressed and scared as fuck right now. Usually I had someone senior to ask my questions or get my doubts cleared with, now it looks like I'll be making those decisions and getting things done and I'm shitscared and worried as fuck.

Does anyone have any pointers, tips or anecdotal advice that might help me? It would be much appreciated.

Sorry for the incoherent rant. Have a good one y'all

Should i make my game open source? It will be free, but i'm worried about theifs..
(reuploading as their work, or selling)

I am worried of a future in which JS has taken over everything, fortunately wasm is here to help :D

Sleeping well cleans our mind and let us approach a problem in a different way and help us find the solution. For some days I was worried about how to solve a couple of bugs, but this morning after a good sleep I magically realized how easy the solution was:
WON'T FIX

So I found out few days ago that I’m pregnant. All’s well, except this guy who sits behind me in the office and keeps going out for a smoke every hour and returns smelling strongly like cigarettes. The smell fades after a while and he goes out again. Repeat.

These people are worried about non profits where as I'm worried about thepiratebay.org

One of our clients is called Skynet. Should I be worried?

Our HR guy is a tool. He requested I help him extract some data from our database. Which based on what he requested I supplied he then started trying to bully me because the data I gave him wasn’t what he wanted. Ringing me every 5 mins asking if it was ready, comparing me to another colleague who wrote the system.

When we blew up at him telling him to back off he continued. Anyway he still works here and persists in being a tool. i on the other hand ignore him.

I’m pretty sure that the HR bullying an employee is wrong, not massively worried about it just annoyed

Seems like the ad spammers are quite active recently. I‘m worried.

Also: fuck every single one of them human scum.

Our company is changing the default branch on our main repo from master to main.

We're literally on the verge of global genocide and a holocaust, and people are worried about over-sensitive people's feelings. I'm sure a branch change will end racism.

Just overheard a conversation between 2 pilots while waiting to board a flight at an airport about some airplane related software. The guy talking seemed very proud (read egotistical) about his tech knowledge. It went something like... "Well you see it's open source so they are worried someone might have put a backdoor in it somewhere".

That's the point of open source you dumbass you actually have the ability to check 🤦‍♂️

My father calls me very worried: hey, do you know your mother's email login username and password? We need it
Me: no? Why would I?
My father: well, she sent it to you on email when she created it, so you'd remember!

?? What?

Really worried about one of my devs tonight. He's going to go into surgery. Hoping everything will be okay. :(

I slept on my phone.

Like, physically ON my phone.

Now I'm worried it might be broken in ways I haven't noticed yet... 🤦🏻‍♀️

After being let go from my previous job (previous rant) roughly two and a bit weeks ago I already have multiple offers for new jobs.

There's lots of sterotyping for how difficult it is to get a new position in this field. I was worried, this is such a relief

I'm worried about my english

I once built an app because my girlfriend travels a lot and I was worried she might be kidnapped. App becomes a big deal, now I have to add more features. I really just wanted a holiday and peace of mind.

Worried about your application crashing? I have a fix. through the entire thing in a try/catch and catch Exception. 😁😁

Is a week enough time to figure out if a company is right?

I'm not sure if I like this new leadership team...

I'm starting to think that I might have been far happier with my previous gig...

Am I the only one who gets extremely nervous the night before an interview as that technical test can encompass the entire academic field of CS. I'm just worried I'll forget the difference between a clustered and non-clustered index or fail to convey the difference between TDD and BDD.

I'm ten years in to my career now, so I 'should' know my stuff. I've produced the tests my self, hired other devs, but I still feel the nerves.

As a student on platforms like these, hearing people talk about languages and concepts you've never heard of

When that demo you were so worried about goes super well :D

Started a new job and our tech lead doesn't know how to use GIT in a team environment, has only ever used it while working by himself on one person projects. Kinda worried...

Worst experience: being laid off when the startup I worked for lost a deal. I loved that project :(

Best experience: my new company sent me to USA for a few days to meet the client. I've gained a lot more of confidence on my spoken English. I've didn't use it in years, so I was worried. Perhaps you wouldn't think it's a "dev" experience, but English is actually a required skill for a developer who has it as a second language.

My new favourite quote...

"I can't be the only one worried about the deadline"

By boss speakign ot my team who is expected to deliver 6-8 months worth of work in 5 weeks time...

Too bad he does not know he IS the only one worried, when you going to miss a deadline by that much when you never agreed to it in the first place, have not seen a single API and the scope is still actively changing and lets not forget we have no DevOps yet...
why the fuck would you worry...

Our UX guys have all congregated in a conference room and are practicing their joker laughs.

I'm slightly worried.

Should I be fucking worried? After all skynet can't even identify a captcha yet. Or can it?

By the way, did anyone ever went to hospital because drinking too much coffee? I drink it, you drink it, we drink it, but I'm seriously worried sometimes about my heart and blood pressure.

When you can't sleep, because you are more worried about your code review...
That's my state right now...

Apple is really worried about their huge failure with the i9 6-cores, worried they won’t sell.

How do I know? Well, this...

Just started my first "management" role after 12 years as a developer, first thing I learnt is its just like my last role only I don't have to do any of the hard work.
Worried they'll figure out I'm doing almost nothing soon, any tips? Should I just start scheduling meetings to discuss meetings?

The human in me knows casting a datetime to a decimal(20, 12) is fairly future-proof.

The dev in me is worried someone working at the same company in 273669 years will get mad at him.

when you tell your boss 'we need to talk' and he looks genuinely worried 😀

< 1 year of professional software experience - company: there's too many of you, come back when you have 3 years experience

3 years experience - company: those entry levels have now gotten 3 years experience just like you and now there's too many of you, come back with 7 years experience

7 years - company: too many of you, come back with 20 years

20 years - you: create sentient AI and order it to destroy the company. AI: sorry, I'm looking for an owner with 100 years experience, sorry.

Fuck.

Recently got promoted to Senior Engineer position. Should I be worried for not knowing what that 'Senior' means? 😳

I want to ask for my devrant stickers but I'm worried the South African postal service will just lose the package or steal it themselves

Is it just me or with every Dev rant avatar the males seem angry/annoyed and the females look worried?

Project from scratch with a deadline of one week and includes input of SSN

((worried))

Fuck America. Fuck Google. They're just worried about the dominance of Huawei.

I DID IT! I got my first co-op job!! I’ll be starting in the fall and I’m super excited 🤩
Finally I’ll get to do real work and I’ll get to see just how far schooling has gotten me.

Gotta admit I’m a tilt bit worried I over sold myself in the interview but we will cross that bridge when we get to it 😅

I’ll also finally have some real rants soon enough 😏😅

I like writing bash, im just really worried about the time when the management eventually decides we need to support windows.

!rant

Made my research about mechanical keyboard and was worried that my first one was going to be too loud at work.

I can hear the majority of hammering cave trolls smashing their membrane keyboards louder than I can hear my MX Brown.

This shit is like heaven for fingers.

:D

My bookmark bar has a random entry for "Clam Poisoning" , between all the Amazon Web Services and Ruby entries. I'm not sure who put it there? It wasn't my wife or I. Should I be worried? Should I avoid all the shellfish for a while?

Just wrote an angry email about the unrealistic demands towards my team. Got a call an hour later from [product owner] where he had the most worried voice i ever heard because we are the only data scientists in the research. I expected an email reply in 2 weeks, seems like we are somewhat important here.

I'm worried. I would love to internship for my current boss over the summer.
But there are only 4 spots and 10 people competing.

She basically wants an assistant to help with her photography gig. But many of the skills she's asking for are graphic design related minus the website building.

Fingers crossed that what little knowledge I have there can be enough to get me free housing for 8 weeks. Would also love the chance to build a website. Here's to the interview tomorrow.

My smartphone's fingerprint reader just stopped working, after EXACTLY 36 months of usage.

I always took care of this device to make it last, as I'm worried about resources consumption and what the production chain involves (like having working children in African mines).

I'll try to keep using it as long as possible, but I can't stop thinking that this problem shouldn't be always on us, the consumers, suffering defective devices designed to last only for two years.

We should put more pressure on producers to reduce electronic waste, and to invest more on the maintenance & repairing sectors (which are almost non-existent).

That's all folks.

College is rapidly sending me into a never-ending spiral of depression. I have to take Calculus-based physics for Computer Science, and it's making me want to kill myself. I'm not going to get anything higher than a D in it, so I'm going to have to take it again no matter what. I'm worried I'm not going to get a D in it because if I don't get at least a D in it, I won't be able to take the second part of it in the spring, which will remove 5 credit hours from my schedule that I will then have to find something else to fill with.

Worried that the terrible Physics grade I'm going to get is going to drop my GPA below the requirement for my scholarship. Worried that I'm going to get kicked out of the honors program as well. Worried that I'm going to be here for three more years. (My scholarship runs out in Spring 2020.) Stressing out about my Physics final tomorrow that will determine whether I pass or fail the class.

Im starting to wonder if that Computer Science degree is worth it.

An area of my company hired a new director who directed his “DevOps” team to implement a process that would prevent the CI server from running tests on a PR unless the code was reviewed first. He was worried that there would be too many tests executing with 400 developers committing code frequently.

He’s from Yahoo.

Im slowly going from emails like "looking for developers" to "hi, when can you start" and i dont know if i should be happy or worried.

Received an email from my previous employer (I worked there two years ago)

They have positions opening up in a few months and want me back.

Here I was worried my current job is at risk and now more than likely I have a job waiting for me now.

Almost had me worried about my job!

Finally got an offer from a multinational org i could previously only dream of. Ugh i really deserve it plus i didn’t fuck myself over by not negotiating this time. Got an extra 10k on stock options which was wild. Bye bye leetcode, hello Netflix and weed for the next month until i resume in August.
Such a relief knowing my family will not starve and die (joke but i am my family’s support so i was a quite worried last month when the interviews just seemed endless).

I'm still wet behind the ears as developers go, and about a month ago I cobbled together a webservice. After many bug fixes I somehow got it working as intended, held together by tape and shoestring and creaking all the while.

This week, one of the consumers of the service wanted me to open it back up to change the name of the request .xsd. no functionality changes, just a name change.

I protested, worried my service would fall apart if I breathed on it. But he insisted so I made the change.

I just tested it and... it's working as intended.

But I still want to be mad about this!!

High paying unstable job at a startup vs. Low paying stable job at a huge company.

I'm currently at the latter and I'm expecting a job offer (hopefully!) from the other one today.

Low paying job:

Pros:
1) big name. (their stock has recently gone down tho)
2) insurance and stuff.
3) quite stable.
4) can re-skill and move to another team.
5) work from home.

Cons:
1) shit technologies.
2) lots of fake "we are a family" kinda crap.
3) shit pay for a huge company.
4) boring. I feel very unmotivated.
5) obsolete systems and management processes.
6) it would take years to save for a car even with my upcoming promotion pay raise.

High paying job:

Pros:
1) awesome salary. Like 6x my current.
2) up-to-date technologies. Something I'm passionate about.
3) team lead position.
4) I can buy a car in a couple of months.
5) might get a visa sponsorship in the future.
6) small team, my voice will be heard.

Cons:
1) it's a startup so it can go down anytime.
2) no insurance or any kinda benefits.
3) no work laptop.

I'm kinda in the beginning of my career, so my gut is telling me to risk it and go for the unstable job.
It will be my first time to be an "official" team lead and honestly idk how I'll go about it yet.

Which one would you go for?
And wish me luck! The interview went pretty well but I'm dreading for some reason.

I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...

I remember the days when 8G RAM was an overkill.

The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....

Are you worried about your development environment becoming more and more unstable?

Let me give you an example: I've been (mostly) a .NET developer for about 10 years now and yes Visual Studio crashed sometimes but not very often. Also whenever I found something that seemed like a bug in e.g. the MVC framework I always realized that the problem was in my code. However recently there is a VS update almost every week, and I more and more often bump into open GitHub issues without a fix.

Is this the same with other development environments? I also had a lot of issues with XCode/Swift but I never expected that to be stable...

I have more side projects than I'll ever be able to finish. When I do finish them (or at least get a mvp), I have no idea how to market them, and in many ways, I don't even want to. I'm worried that it will kill the fun of it for me.

Command: "Infantry unit, this is Command. The enemy is approaching, what's your status?"

Infantry Unit: "Command, this is Infantry unit. Just a quick note, my pronouns are they/them. Can we please use that in all communications going forward?"

Command: "Infantry unit, the enemy is upon you and you're worried about pronouns?"

Infantry Unit: "Command, this is Infantry unit. It's not just about me, it's about respect and inclusivity"

Command: "Infantry unit, you're about to be inclusively dead. Defend yourselves!"

Infantry Unit: "Command, this is Infantry unit. Wait, what? Oh s***."

(End of transmission)

My boss creates so many wtf moments with his total tech "un-savyness", although he is the " lead" dev, that I'm getting worried that I might be doing the biggest wtf faces every time ... I can't pretend like nothing is happening anymore .... Fuck!

After doing more and more c/c++ I've started exhibiting traits of Jeho... Cplusplus' witness..

See? And you were worried it would take our jobs away from us. It's still got a lot to learn!

I mean, you, developers, are fucked. It's us, Performance Engineers, whose asses are safe

I am a senior .net developer and I should be promoted to a software architect over Java and .net soon, and my parents independently asked my wife and me if my job was stable. They also asked me if I was worried about losing my job. They have no idea what I do and they think it is nuts that I get paid what I do for the hours I work... I doubt they will ever get it.

I'm worried for both fellows.

I would like to proclaim my utmost love and respect to a programming language and one of its framework.

This language/framework combo was so beautiful that during development I had fantasies about it coming to life as the women I want to marry. I genuinely felt love in my heart to her. I even felt butterflies in my stomach thinking about her!

But I'm worried I might jinx it. So I'm not gonna name it.

I love you.

so there is this guy on blind network who makes half a million per year... and he is worried about his job "since it might be automated away" and he is looking to switch career paths!!!!

mind boggling that a "software engineer" with that type of pay hasn't recognized that LLMs are all hype and no bite

wild

it's insane to me that people making more money in a year than i've made in my decade career know little to nothing about software

what an absolute insane time to be alive

I'm worried about me, and my future carrier path...
I don't know in what direction should I walk, to become the best as I can
And I'm going to be as best as I can...but Google Maps doesn't just show the direction, it gets lost as me...eh...
Yesterday, I've told to dev genie just 2 wishes, but as my third wish, I'd like to know in what direction should I walk, which roads should I avoid, what shall I do.

My current project involves storing parents and children of parents in to a community database.

My current parameters include "availablechildren", "selectedchildren" and "forchildren"...and I'm worried somebody in this office is going to see this and I'm going to end up on some kind of register :S

Just got a job offer in a DevOps team, the cloud company is Netherlands based. But I'm worried about the Brexit because the day is a coincidence... and I'm in London.

When updating + restarting your Windows PC fixes the random exception being thrown in your controller when you were worried your frontend code broke the site. 😲

hey guys, i was recently appointed to be devops engineer in a company. i did want to be a software developer though but they chose me for devops because my lack of java knowledge and a bit knowledge of linux and stuff.
my question for u guys is that... is devops good? for future career as well.
i m quite afraid to be honest, wouldn't want to have made a bad career decision. 😅😅
i must admit i have always enjoyed programming and hence i am worried in devops.

that's convenient...

IDK whether I should be happy it crashed or should I be worried because it knew where I was going and pretended to crash

Either my server is hacked or I fucked something up two days ago without knowing, I suddenly start receiving a dms file when I try access my domain or either by IP, file name is: valroSG0.dms

Do I need to be worried :S

I'm not a freelancer! made my account on Fiverr back in 2017 during college never really used it. Eventually logged into Fiverr last night and got a message from a girl who was worried about her college project. It was just a weather app in JS. That I created by copy-pasting from some indian guy's blog over internet in 15 minutes. I didn't know if it is ethical she was like praising me for making a good app in just $60. It doesn't feel good but here is her review😂

So Is it just me thinking that no one would pay for my work (web dev, IT stuff etc...), because it is so easy to build a website for example. I'm kinda beginner, what's your opinion on wordpress? But mybe I'm just rushing things, we want to build a webdev business with my friends and I'd like to hear some idea/experience from you guys :)

Omfg... Fixed 3 LifeRay 6.1.1 ce security bugs in less than a day. I should be proud, but I am actualy fucking worried I've been with this project for too long if I can already make liferay fixes THAT fast...

Am I becoming a legacy...? Shit

Relative phones up worried about installing Adblocker as it "can store and modify the websites you visit"...my answer.."so can GCHQ, NSA AND CIA so just give in to the fact that you have no privacy and click ok"...*long pause*.."ok one more question, what's a chrome extension?"..FML

While writing a big program i always get worried about naming variables.

My boss wants to put an Amazon Echo Dot in the conference room. So I suggested covering it with a cheese cover (those glassy dome thingies). He thought it would be an artsy statement, but I was actually worried about privacy.

Anyone have any experience with listening devices in the workplace?

Recruiter bot just emailed me with some offers, let's take a look...

"Hand-on Experience with SQL and NO-SQL Databases preferably Redux"

Whew! I was worried for a second, thank god they are using a Redux database and not one of those really crappy React databases! I'll really consider applying now.

smh

Sprint 1 of being a team leader. I wake up in the middle of the night worried about how to manage these newly arrived juniors.

I'm fairly new (less than a year) to programming and I'm just wondering what everyone's thoughts are about this.

Is taking college math courses necessary to be a good programmer?

I am learning online and I'm worried I won't be a great programmer without all the math. The last course I took was Trig :/

Also add any suggestions you have. Thanks all!

I'm worried my dubstep beets running through my desk are bad for my hard drive...

Does anyone else ever get so distracted/tired/pent up with other shit going on that they become a liability?

Last night I had about 5 hours sleep and have been worried over general UK politics lately.

Today, on a phone call to get support over getting locked out of our Apple Developer Program account, the call centre agent asked if we had the password.

I immediately replied "Sure! It's **begins saying actual password allowed over the phone**

Me and a friend starting to program a game in Unity, he's worried and I think we will ace it! How f***ed are we? (5 years of website development experience each)

I wish I had that self esteem a lot of my classmates posses.
I'm working for my prof, I've kinda made my very first step into the industry. Somewhere deep inside I know I'm talented and smart. However, every day I am worried that I'm not good enough and it will be noticed at the job soon.
Is that common thing in Dev community? Just want to know opinions

I have to go onto windows to do something that Linux can't do. Should I be worried about all the updates? (particularly worried about them overwriting my other partitions since I dual-booted)

The company where i am working at currently is kinda weird. The company is run by a gujrati guy and he has placed almost all his cousins in high positions...and on top of that the CTO (whos the bro of the owner) micromanages people and also fires them on a whim...i am kinda worried that if i am not able to do a particular task, i would be fired too...He has asked me to do unit testing of some complicated functions on mocha/chai and i have never done all this before. I am not understanding what to do and there are no senior devs in the office who knows about these things...

That guy at the office who gets really irritated and worried about newly introduced technology. He would spend 2-3 days talking trash about it, saying how much he prefers the older and less efficient approach just because he knows it.

That fucking guy.

Should I be worried...?

Something about my experience in a startup that I co-founded as a developer is that I feel like everyone always depends on me for almost everything. So when I just want to jump in and code, I have to be worried about who's gonna call me for what tedious reason. It really gets to me.

Got my first job in a web development company. I am on a trial period, which means at the end of two weeks they will evaluate my performance and give me a full time contact. As a trial I am given task to work on internal CMS system. And OMG!! the coding is horrible. I think someone can start from scratch and redo the entire thing faster the adding new features to that piece of Hell!! Am worried after 2 weeks my performance is going to look bad.

When your boss calls for a meeting with the whole IT department because he is too worried about losing face by lecturing the guy who talked back to him.

Moved from a gambling company to a government body. Got to say I'm less stressed about estimates now but more worried about standards here.

Stress and career development < No Stress and less career development.

Ask me in a few months.

Not sure if it is a rant or not but I'm getting worried about Apple... Two days passed uploaded a new update multiple times and all ended on the first try 😨
Usually it takes many tries for it to be uploaded 😨
On top of that, iTunesConnect is faster and no longer stuck at loading when token expires 😨

I hope I'm not dreaming 😅

Did anybody buy .dev domain from Google? Their website was quite slow yesterday and somehow I managed to add my first name .dev to the cart. But in the last screen I got stuck with "Registering this domain" message. I closed tab after an hour. Today it is still under pending domains. But if I search for the availability, it says exact match is available. Should I be worried?

The university's IT Department has asked to talk to me asap.

I dont if I should be worried or not!

56 repositories

14 stars

keynote speaker

once again your daily reminder that software is no exception: it's about how you appear and talk, not the actual work you get done or competance

this is why i'm not worried by technology or aRtiFiciAl InTeLLiGenCE taking over - there is so much bullshit politics and idiot "emotional" choices that in fact rule the career / industrial environment, not actual consideration of improving workflows or efficiency

So worried people will fuck things up in work when I'm not there. It's causing such tiredness and such long days. 🙇I think it's caught up with with today. No holiday leave taken for 9 months and not a day off sick. 🏳

thank god, Microsoft decided not to use lignite coal for updating their OS. I was worried to update windows, it used to cause so much smog in the neighbourhood, one uncle even died because of lead poisioning.

now, I can update Windows in peace, no more pollution.

So I can guzzle like 6-8 cups of coffee a day, should I be worried about the caffeine or the sugar? 🤔

I don't think we need to worry about judgement day anytime soon... If anything, we should be worried they miscalculate where the ICBMs are going to land...

Here's what's on my mind.

I am building portfolio website as my first project. But I am doing this going the self taught route. I do not know a single soul in the developer space. And none of my friends or family are technical.

How can I get feedback on my site?

Did some contract negotiations with the company I work for a couple of months ago, when they offered me a promotion starting next month ... today I got the contract. Only one of the terms we have agreed is in the contract, of course that benefits them. No word about any promotion etc. Wrote to the guy in charge today but no answer so far. Should I just abandon ship or am I just to worried?

This weekend, I bought a mechanical keyboard to use at work. I'm worried the clicking sound will bother my co-workers around me. Does anybody know if bringing the keyboard to work will make people hate me?

It's a Logitech G610 with Cherry MX Red switches. I ordered some rubber o-rings on Amazon to dampen the keys. They should be coming in tomorrow. Should I risk bringing the keyboard into work before I dampen the keys?

The bathroom here doesn't leave me worried I'm going to catch hepatitis.

I’m worried my manager denies me my role shift because I’m supposedly an invaluable asset to our small team, even though the request has been approved by the higher ups already. I would totally understand, tbh, but it’d suck nonetheless.

I don’t consider myself ambitious, but I’d like to move forward, not just run in place.

Dear Passionate Programmer,

Do you ever wish you chose a different career?

I’m a self taught dev & wanted to make something of what I learned. So I moved from a small town, landed my first tech job (!dev), but the closer I get to my goal the more worried I get.

I’m worried that making my hobby a career will eventually lead me to loathing the one thing I love. And I’m not really sure if I should stay the course or turn around in hopes to save the ship.

What are your thoughts about Elon Musk, is he really worried about AI or is this just a business strategy ? I mean I am a huge fan, love his work, but he wants to be the ruler and saver of the Universe.

So I am on a vacation for a month and a few days before it ends. My boss calls me and tells me "why don't you take one more week" then he told me that's when he will be back to work as well because he is traveling. When I told him why he said he wants to talk to be before getting back to work.
When he found me sounding worried, he said don't worry there is nothing you are missing we just want to align our plans and give you updates on the period you were gone for.

When I asked him what if I wanted to get back to work sooner, he said I prefer if you wait till I come back

And now I am super worried and paranoid, advice please 😥

To the Irish devs here, any experience with employers in Galway or Cork?
Most jobs are in Dublin or Midlands but every now and then something nice pops up.

I really wanna move to the west or south in the next 1-2 years but I’m worried about the job market there.

Of course the salary will be lower than in Dublin but I’d assume it’s still very well paid for local conditions?

Dublin is just too international for me, I like the quieter, more traditional counties better..

Don’t hate me for that dubs😉

Do you guys worry about your non disclosure agreements at work? I use my personal computer at work so I do my own projects on the same computer as work but it makes me a bit uneasy. We're a broke startup and I'm lucky to have the job so I'm not going to ask for a computer.

Also, are you aware of it when you make rants- trying not to be too specific? Or are you not worried?

I am in 3rd year of my college and I am a bit worried.
How you people apply for jobs? Do you just walk in a company and talk to the receptionist or.....?

Worried about college because there's only one year to go for me to graduate, but now I don't give a fuck about it nor I care about any of my subjects. All I want to do is working on my own coding projects and play video games

Orchid syntax highlighting

I gotta say, I really like the text image of my new language ^_^ This is something I was worried about, although that's part of the reason why the entire syntax is defined natively and can be modified on a whim

So after a couple years working at this company, the faculty I graduated from introduced a postgrad (masters) course in data science. I was always interested in the field, so I said fuck it and jumped the bandwagon...

I'm starting this week, I'm kinda worried my knowledge of maths and statistics got a bit rusty since graduation. Also most students there will be 4 years younger than me, and I'll keep doing my full-time job at the same time. But hey, at least I'll break the routine, and I can always quit my job if it turns out I can't do both, so whatever.

That's all folks!

My gf wants to be a nomad.
I just like to code in my chosen place of work (home) and not lose focus with moving around.

I'm worried, I get anxiety if I don't find myself in places that let me be productive. I'm very much like a cat in that regard 🐈

Developer-in-training at OSU, worried about being able to find a job. Contributing to an open-source project right now to try to hone my skills. Any advice from the more experienced?

Hello ranters, I have to send my beloved laptop to acer support to get somethings fixed and I'm worried for my stickers. I don't want to get them damaged or lost (maybe they need to change the screen back plate or maybe they send me a new laptop all together). Is there a way to peel the off and reapply them with new glue?

OK I'm getting real tired of people posting stuff about Net Neutrality on here, as we all know about it at this point.

The one thing that gets me more angry is that these people get it wrong.

People look at this Net Neutrality thing and instantly think: "Oh, well, I would have to pay more. That's bad."

What it really is is that your ISP can see what you have been searching and would be allowed to send that information to a third party, or change the speed of your internet if you search something their sponsors don't like.

This is what you should be worried about. Your privacy, not your wallet.

And people still wonder why I'm fucking worried for my future...

Watching Fast and Furious 8... When they hack all the self driving cars...

Me: Spends 4 hours configuring my new IDE
Me: Hovers Apply for the last apply
IDE: Crashes
Ne: Reopen IDE, not worried as I applied and saved multiple times during setup
IDE,: Totally zero'ed EVERY SINGLE SETTING...

Me: Googles alternatives to X

Hey guys!
I have a question
When I'm coding sometimes I get sick
I mean this is getting me when I'm worried if the deadline coming day after day, I get nausea a lot
By a lot I mean a lot
I can't even look at my computer screen or even touch the keyboard
Is it only me or it's normal ?!!
I think it's stress