People are worried that AI will replace them in their jobs.

But guys.

We are still using php.

I think we are safe for the next 200 years.

(overheard parents talking)

Mum: I'm worried about our son, I guess he was hacking today
Dad: What? [Chuckle] No. He's not that grown up enough. Prolly programming.
Mum: But, the screen was all blue and there was nothing but text on it. And then suddenly it went blank. So, I asked him what he was doing and he said it was a BSOD. That sounds scary NSA level stuff.
Dad: it isn't [came out of the room, saw me there]

(And we laughed and laughed and laughed)

Interviewer: We're worried you don't have enough backend experience for this frontend position.

Meeting with asshole partner company CEO at restaurant.

Me: "I'm a bit worried about the bugs in your API. There are some ways to retrieve privacy sensitive info from public endpoints"

CEO: "Well, we're a rapidly growing startup!"

Me: "Uh... so?"

CEO: "So... Move Fast and Break Things! Priority is to improve our API further, and we'll fix bugs as they show up"

Me: "Maybe you should stop trying to emulate Zuckerberg in your management style. You know that even Facebook themselves admitted that their slogan was a retarded mistake"

Waiter shows up at table. CEO orders some overly expensive fish salad.

CEO: "Well, they have done something right... they're worth billions"

Waiter asks me: "And you sir, have you made your choice?"

Me: "Do you serve popcorn?"

CEO: "Popcorn for lunch?"

Me: "No, for your congressional hearing"

Programmer was smoking...

lady nearby: "can't you see the warning smoking is injurious to your life!"

Programmer: "we are not worried about warnings only about Errors"

Any devs here that Code in C/C++...?
Or am I lost in "webRant".

I am worried about the future " code everything in javascript " generation :)

Make pointers great again!

So my cousin approaches me with his Android phone and, with a worried tone, says:

- "But... is it true that if you enable the developer mode you can get arrested?"
- "What? No. Why?"
- "Because this screen says so. I once enabled them out of curiosity but then I couldn't disable it so I had to reset the phone."

Turns out that, in Italian, "arrest" is a synonym of "halt". The message says "these settings can cause the _arrest_ or malfunctioning of the device"

Couldn't stop laughing 😂

My colleague just committed some code with description "improved some bugs"

...should I be worried? 😂

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Her: What do you do?
Me: I'm writing my thesis on bringing AI to smartphones.
Her: I think AI is terrible!
Me: oh, you are an engineer too?
Her: No
Me: oh, you've studied economics and or ethics and are worried about its implications on society?
Her: No, but have you?
Me: I have a degree in economics, an MBA and an now about to get my BSc in CS.
Her: well, regardless I still think it's terrible.
Me: well in that case how about you shove your unfounded opinion where the sun don't shine!

I'm still a bit worried...

So a guy wants to start a company with me. He wants to be CEO 👨‍💼 I'm fine with it but now he also wants me to obey every one of his orders such as attend long unplanned meetings, go do market research, code the app and for what, a mere 5%. He gets a bigger cut of the income because he came up with the idea 💡, he also gets to sit and order me around because he's read a few books on business and economics. People don't seem to understand the difference between having an idea and implementation. I just left and said no to every offer he had the highest of which was 10%, don't be worried about the money he says this is a real opportunity for you. I mean wtf is wrong with some people.

Does my old computer count?
2016:
Windows XP
Visual Studio 2010
1GB RAM
An old Pentium inside
I am now worried that both Raspberry pie 3 and my phone, both costing less have better specifications

!rant

Got pulled into a meeting with my PM at 4:30 yesterday. Was a bit worried (been feeling some imposter syndrome recently), but then he starts out, "These are my favorite meetings to have." I got a pretty big raise! Totally unprompted. I love my job and my PM.

Not particularly worried about the increase in mobile cyber attacks.

Do you like listening to music on YouTube but are worried about your data usage?

Use this chrome add-on called "Audio Only Youtube" that blocks the video stream and just plays the audio.

If you know this already then good for you!

Morning after my linux administration exam my mother called 15 times to wake me up. When I finaly answered the phone she she was worried so she asked.
Mom: wtf is wrong with you, is everything okay?
Me: not sure, i think something went wrong. I'll send you the log files later. *Hangs up the phone.

Apparently I do shit like that every time she tries to call me in the morning as she writes down our "conversations" just to laugh at me later.

brain@sleep:~$ sudo rm -rf /

You all, something is wrong. No one has pissed me off at work recently (other than boss, but he does that by existing). I'm not sure if they've all learned, or if shit is about to hit the fan.

I'm a bit worried at how little of my question Google actually just answered...

lol yes definitely be worried

rant

The Java course at our Uni requires us to do an end semester project - A Java App with Swing for GUI and some Multithreading code in it.

They asked us to upload the code to drive. I was bored and was checking out my friends' projects.

The code below is what I saw in one of the projects. They have simply called a thread with an empty run method because the project required to use multithreading concepts, wtf.

But then, It is no surprise to me cause these are the people who memorize code and vomit code for marks.

I am worried that people are going to be awarded degrees and called software engineers.

God save the software industry!

Getting older. I've been needlessly worried about my age as a developer since I was 23, which is hilarious.

People always need good devs. You don't have to become a manager or commit suicide at 30. Just be awesome and someone will pay you.

Yay my stickers finally arrived! Thanks guys <3 @dfox @trogus

And it freaked out my mum. She called me all panicked like "you've got an international letter what did you do did you get scammed or something"
...
"Mum, those are stickers...I got for free"
"Ohhhh... ok then"
But shre was very worried there ^^'

So I used to be a chef, then I got married and decided my weekends and holidays were better spent than making food for ungrateful shit-wagglers, or getting screamed at in Lebanese by the exec Chef during dinner service at the end of a ten-hour shift, so I went back to school for Computer Engineering. I was so worried because I swore compulsively from day one of classes.
Little did I know way back then, the first programming language I ever learned was swearing.

Working really hard, finishing tasks, upgrading servers. Cancel some useless meetings to finish up features, working till 2am to get a database migration working. Half of the platform is transformed, both customers and team are very happy about their accomplishments.

Boss: "OK, I think we're on the right path with these changes, but productivity and morale is honestly disappointing. Are you guys sleeping enough? You all look very tired and unmotivated!"

Attend all meetings, call boss at 7am to discuss random purchases like a whiteboard, run around the office holding a (broken, lol) MacBook, looking very busy & slightly worried. I shout random things at people across the office like "Nice work Gary!" and "Damn, you are on a roll Angela!". I initiate smalltalk with department heads, only to immediately disrupt the conversation by checking my phone saying "Oh I really have to take this one" (empty battery, lol). No one writes a single line of code for four weeks, and nothing new has been deployed by the whole team.

Boss: "I think it's commendable how productive the team has become this month. You guys are all so active and involved. A real improvement!"

Reinstalling arch. I broke it while grading homework. Sad. Also worried my phone is going to ring and I'm going to not have my laptop ready.

Happy to announce my middle mouse button has started working again!

I know you were all worried... :/

Dear Microsoft,

It's been almost 2 days since you have asked me to update to Windows 10, I'm beginning to get a little worried, is everything ok?

I just came across some code I wrote a year ago that I don't entirely hate.

I'm legitimately a bit worried.

I received my Driver's licence today. Yayy!! (I had been waiting for it for quite some time,worried if it will ever reach me)
Then I casually asked the postman. If there was any other package for me, because I am expecting a little blue package sent from US.
And he said he'll go back and check.

A few minutes later the door bell rang again 😍🤩
Here they are 😋.

I hope,even the devrant stickers reach me soon 😣.

#¤%@ kid!!! My 5yo son has obviously been playing with his mom's mobile phone. At first, I thought it was a little cute, when I received incoherent texts about Roblox, one of his favourite games.

But then, I suddenly heard from my sister who was really upset and worried. She was wondering if my gf really wants to see her dead, after receiving a facebook pm in English, saying "oh die :-)".

No need for auntie to take it personally though; turned out she was not the only one getting the same message :-O

A little boy is facing a mobile ban for a very long time...

I am about to switch careers completely to become a iOS/Swift developer. What a journey it turned out to be...

Besides the fact that I just bought a house and am about to get my first child, I had to do it.

My current job just doesn't feel right anymore. After 7,5 years the culturefit is gone.

Besides, I really love programming for many years now and I fell in love with Swift about a year ago. Spent many hours programming a day, reading blogs, watching vids, building my first complicated App. A few months ago, I wondered why I didn't pursue this path earlier.

I spoke to three different company's... They all wanted to move further, but just one company really felt right. A small business of 5.

After we met, they asked for a second meeting, a code presentation. I ever did this before, so it was weird talking about the code I wrote. Definitely different that just coding it alone.

The last and third time, last week, I asked them what I would be doing, projects and how they lead the small company of 5. We had a great meeting and agreed that I start september 1st.

Now I'm just waiting for the contract to come through! Its been 7 days though. Starting to get a little worried. I really want this!

!dev related

Wife is not pregnant......

.....we have been trying to...STAY LIKE THAT FOR A WHILE NOW and after a big scare I was really worried :v we have one kid already and that Is how we plan to stay until I start my business.

These are the best news I've had all month.

Yaaaaaaaaaaaaaaay

I recently learned why you shouldn't delete your linux partition by just pressing the 'delete volume' button.

I currently own a SP3(i7, 256gb).
I got bored of windows and installed Linux Mate. It ran quite fast and snappily. All was good.

Then I looked on the internet. Apparently fedora runs really well on the SP3. So I deleted my Linux partition by pressing 'delete volume'.

Turns out, thats a bad idea. Grub was in that partition, so when I restarted my tablet, it booted into the 'grub rescue>' prompt.

After messing around, I finally found that pressing the Volume Down button and power button at the same time seemed to boot into my Fedora Live USB.

All the while, I was quite worried I'd lost all of my assignments(I knew I could have used the minitool of gparted live cd).

Finally I got it to install, and all was good again. Has anyone else made this mistake?

I'm reluctant to introduce devRant to my co-workers because I'm worried they might connect the dots and realize I've been complaining about them :/

To everyone in hurricane war path...

YOUR WONDERFUL STUBBORN ASSES BETTER LET ME KNOW YOU'RE OK. I'M GOING TO BE WORRIED SICK UNTIL ALL THESE FUCKING WATER TORNADOES ARE DONE.

Online ads....

I think the problem is that in the age of "AI" and "machine learning" etc etc - the reality is that targeted or personalised advertising is absolutely shite.

All I see when I browse around are ads for things that I bought. It's like - I FUCKING BOUGHT THIS WHY ARE YOU TRYING TO SELL IT TO ME??!

I think anyone worried about the machine uprising enslaving humanity can relax and not worry about it, at least until amazon can understand when it has sold you something or you just looked at something.

Running a huge migration on our production db.
Takes 45+15 minutes (migration+tests) on my lappy. So. I'm going to be bored and slightly worried for the next hour.

Hopefully the production servers will be faster.

I just got hired as a systems administrator at a company that develops web forms. NO ONE in the company has heard of git. They don't use any kind of version control.
I'm a little worried...

New project in C++. I don't know C++ but very good at C and Java so not worried.

New guy joins us. Gets stuck on how to concatenate a string. No big deal since he is new to the language too and doesn't have a C background. I offer to help and he goes on a 10 min rant about how C and C++ are different and I don't know what I'm talking about.

Wait until he's done. Tell him just to do strcat(possibly a better way but I'm literally in day 2 of my C++ skills, but I knew it would work). He mumbles how is not going to work as he types like he's going to shove it in my face when it fails.

It was like a beautiful geeky mic drop when it worked perfectly.

The public seems to be worried a lot on the Facebook "data breach" yet doesn't bat an eye on a bigger website that has already been selling private data for more than a decade.

Google

Only a few days in on using my new phone, already gathered 67 tabs in my browser and counting.. should I be worried? 😥

I think we're going two sides:

For one, more and more technology is being developed/engineered which is even more and more and more intrusive as for personal privacy, I'm genuinely worried how this'll go as privacy isn't just a about not exposing certain things like passwords/bank account details and so on, it's also about being an individual who has their own thoughts, opinions and so on. If we keep taking that away more and more often, society will change and go towards the Orwell scenario (we're on our way there right now). We can change this as software/design/server engineers but that's up to us and I sadly don't see that happening quickly, also due to the 'nothing to hide' bullshit.

Second one is that were going more and more towards open source.
This is a good thing as this:
- gives freedom to devs around the world to improve software and/or modify it to suit their needs.
- gives people the opportunity to look through the source code of softwares in order to verify it as for backdoors and find security vulnerabilities which otherwise can remain hidden for the general public while spying agencies have way more resources to go vulnerability hunting.

For the people who think this isn't a good idea (even more open source), without it we'd be completely fucked as for moving forward/security/privacy. (I can give examples if wanted).

I was asked to help with the website of this one club. Their 'IT head' is a business person. I told them no, but they sent me something anyways.

They sent me a zip file of their code
instead of giving me access to their GitHub repo. I then realized that they were using 3-year-old NodeJS and Express to power their static website and doing blog posts as JavaScript modules.

A second part of their architecture which was related to member sign up was horribly broken and also written in Node. I found out that they hard coded credentials to their Google Apps account, despite having the setup to pass it via environment variables.

And now they are worried that their sign up isn't working. Their developer resigned.

They want me to help them fix it within a very small timeframe. So they can use the code to collect membership fees.

This is what happens when you have business people develop code.

I just found this example in our school book. Should I be worried? (My teacher wrote the book BTW)

My laptop started making faint high-pitched noises - I hope I misheard and it's actually just some coil singing inside the power-supply and not one of the disks/something else - also, I seem to have dropped 4GB of RAM suddenly where there should be 8GB.

(Also, I should really wipe the messed up dual-boot still residing on disk from last semester and replace it by a fresh arch-only install. (No time and joy in debugging that right now.) Probably something for tomorrow evening.)

The device is ~8 years old by now and starting to fall apart - nothing duct tape can't fix - but I'm somewhat worried about the rest right now. D:

Meh, I really need that laptop during the next two weeks, I just hope the hardware doesn't die on me in the meantime because I can't wait for an order to arrive, let alone afford some cheap replacement.

So customers can place orders at our website, but some of the products are actually handled by a third party. We use a web service to communicate about these orders. Obviously, we need a way to uniquely identify each order, and decided with this other company that we would use a simple incrementing integer.

Last week, something strange happened: we could no longer cancel orders by their ID, because according to the web service, the orders were placed too long ago and were no longer eligible for cancellation. But I knew that could not be true: the orders were from last week. So I checked out database, turns out the ID's are not so unique: some refer to two or three orders. Somewhat worried, I contact the guy responsible at the other company and ask him how that could ever happen?

He: "Yeah, when we restart our server, the counter goes back to 1, you see. I didn't think that would be a problem...".

REALLY?! YOU DIDN'T THINK?

Okay, this is me panicking. We're switching to Microsoft Teams at work. This means that I will have to cut the Slack and switch to a fucking Microsoft solution for chat. Am I supposed to be worried?

Oh fuck the ROM compiled on first try. WTF ?
Well surely it wont boot.
//5 minutes later after coffee brake.
Oh fuck it booted up no fucking way.
Well but at least something is in place. Wifi not working BT, Camera, Audio.
OK i was worried what did i do wrong since it booted on first try.

Not me but my friend was so fucking worried when I shown him a security breach website he made for his company.

So that's how it went: We were talking about programming and stuff and we came to authentication logic. We were both still at college and both noob programmers.
He told me he didn't use sessions because they suck server memory and he found this neat thing called "cookies". He explained them to me and I was like "holy fuck"... I asked him to show me the website and login to any account.
I opened chrome devtools and took a. look at the stored cookies. There was only one: userId, stored as a plain number straight from db primary key.

You guys should see his face when I changed the cookie values and was, all of sudden, using his website as a. completely different user.
I explained some stuff to him like database stored sessions or encrypted cookies and he told me he'd fix that shit up first thing in the next day.

My coffee to water ratio in a cup is starting to be 1/2. I'm worried in the future I will be eating coffee not drink it anymore 😂

“Get the code working first, then worry about how to clean and optimize it.”

For me when I learnt about optimization and how one thing was better than something else, I tended to focus on that. I’d have a picture of that in my mind, and would try to write as clean of code with less hacks in the middle and as optimized as I could in the first go, which slowed me the way fuck down.

After he said that to me, I realized I was stupid and just wasting time if I worried about that from the start. Would waste time, and just cause more headaches from the start than it was worth.

——

Oh also another one, I knew never to trust the client from the start but the way he said it was funny. “Never ever trust the fucking client, don’t trust them with anything. I trust Satan more than I trust the client.” 😂

Dreamt I was writing code for work last night, pretty sketchy stuff. But then at some point I woke up, and in my daze panicked thinking that I'd actually written that code. So when I fell back asleep, dream me was working on fixing all the issues that I actually had never writen. Woke up again, worried about if I had left everything well, and realized my stupidity.

I need some days off... 📴

!rant

I got a promotion at work!

Is it weird that I don't want it because I still feel like I have too much to learn to no longer be a "junior"? I'm happy that my hard work is paying off but I'm worried that this is how bad senior devs are made.

*team worried about Slack conversations being tracked in the company*
Solution: Shared text file over network. Edit and save it for private communication. Best idea ever?

O hell I am worried... :|

Today I learned in a cafe why (some) users think that Facebook doesn't allow them data control. Due to drunkness I'm paraphrasing here, but it went something like this:

- I don't trust Facebook, because my posts that I make are visible to people that I didn't want to have it be seen to.

> Audience controls. Use them.

- This guy in town sent me a friend request, why would he be able to??1!1

> He and you share hometown. So probably friend suggestions based on you both explicitly sharing location, or he just visited your profile on name and wanted to get in touch with you. Socializing on the internet, it exists.

That's the kind of user that's roaming the facebooks on the internets and the googles I guess? The type of user that's surprised that their Facebook games and nametests expose information that they explicitly consent to? Give me a break. I care deeply about privacy, but this is just ridiculous.

On a different note, why the fuck is not a single one of those very same fucking Facebook users worried about 25-ish% of websites running their JavaScript (which you can check and block using NoScript and co.), which is the *actual* privacy threat? But muh nametests!!!

Fuck ignorant users!!!

I hardly even know javascript, but I was able to identify and fix a problem in my Father's corporation website. Should I be worried, that the developer working for him wasn't able to do so?

So I was just wondering, do any of you guys know what happened to @BlueNutterfly, I mean besides her parents taking away a lot of her beloved belongings. How is she? Is she still on devrant? did she get her things back? Did she move out? The last time I saw her here is a couple of months ago. I miss her and I think a lot of you do as well. It really sucks what happened to her and nobody should go through these kinds of things, I really hope she is okay and moved out or does so soon. If anyone could shed a little light on this, I would be very grateful, I'm really worried about her.

My printer just emailed me asking to be switched on... :| ..... should I be worried..... skynet?

I just dropped my office laptop !
😨😨😨😨
There is a crack on the corner of the body but the device is Ok !
I am worried they will charge me the whole cost of the laptop ( i.e. 3 months worth salary )

recently people have been worried about what people were going to say I.e "no hate" , don't hold back!

In devrant we only mean light hearted banter if we are pissed we don't want to hurt you we are pissed at a thing and not directly at you. Not that I speak for dfox or trogus but I'm sure that's what they are going for, and it's what ive seen!

We are nice here... This isn't YouTube , it's a credit to devs we are nice people. Hell it isn't stack overflow!

Also I'm brutally honest at times but I love you really.

!rant && extra('worried');

My 11 years-old brother seems to be addicted to Minecraft, not the "dis iz so kool" addiction, but the "I put my health and education in danger to keep playing this game (homeworks badly done, grades free falling, showers without soap in 30s flat, food eaten in 15s, starts to yell at parents when they want him to stop playing (parents bitch slapped him a few times for this, but he seems to persist)).

My parents are over 55 now, so they don't really know how to handle this (can't / don't want to blame them), and I'm supposed shove some reason in his dead brain next weekend (I live 150km away).
I've been addicted myself to videogames in general and WoW in particular ((almost) no regrets) a few years back.. what should I say to him else than "This shit will ruin your life even before you started it" (which is planned anyway) ?

the dev team freaked our boss out by being overly nice and polite to him for a whole day .
Normally we're pretty laid back and tease one another, so he was pretty worried.
You know you have an awesome and tight-knit team when your boss threatens to fire all of you for being too nice and you can laugh about it.
#AwesomeBoss

I earned devie middle. Bought devie left. I came in this morning and devie right is looking at me???
This may be a Tribble situation! Worried when I open my office door Monday they may come pouring out. What will I do with thousands of devies???

I just had my cell phone cloned yesterday. End of the day, my phone lost signal suddenly. I thought it was a problem with my chip, so I decided to check that on a store and buy a new one next day.

Today, after I recover my chip and number, I started to see the mess. Someone used my number to send message to all my contacts on whatsapp, asking for money. Also, I had some contact info changed on the bank broker, which is really serious. I do not know what else is compromised, and I'm truly worried about it.

Someone has some good tips for improving security while using cellphones?

Long time lurker, first time poster. This site has been a huge source of fun and laughs for me on bad days.

So dear fellas,

I've been a software engineer for about 5 to 6 years which was intense as fuck and I've been burnt out multiple times. My highest rank was a senior software engineer so far.

I was offered a new job recently as a Technical lead for a small team which would mean I have to make architecural decisions on top of good ol grunting out the code. I took up the offer but I'm more worried than happy.

Impostor syndrome has kicked in heavily ever since I agreed to the job. What if they realise I don't know certain things that engineers are supposed to know? What if I get in an embarassing situation where somebody asks me a question and I'm not able to answer? What if people who I work with laugh behind my back cos I'm not a rockstar engineer?

I'm depressed and scared as fuck right now. Usually I had someone senior to ask my questions or get my doubts cleared with, now it looks like I'll be making those decisions and getting things done and I'm shitscared and worried as fuck.

Does anyone have any pointers, tips or anecdotal advice that might help me? It would be much appreciated.

Sorry for the incoherent rant. Have a good one y'all

It was about my 30th progress meeting with the clients on a website I was working on for them. At that point, I knew what was gonna happen. Change bloody requests.

Before attending that meeting I thought, "I'll change them on the fly as they comment for more ridiculous changes" as I drank 4 cans of RedBull. At the meeting I was having my 5th and the clients was firing all sorts of changes and complaints in the air and I whack them all with my lightning fast fingers can go.

I didn't know I could go that fast, like I was flying. Clients were impressed. Boss was worried that I don't look so... Normal. In fact, I jitter every mid sentence.

Told him to tell them to email changes/complaints instead of bringing it to this meeting. A complete waste of my Red Bulls.

Iron Man is worried about his code.

So, I told my programmer friend to bring food for us while you are out.

He has still not came, Should I be worried ?

"Do the back up later."

Well, I wouldn't be worried about it if we did have any for last 4 years!

So I found out few days ago that I’m pregnant. All’s well, except this guy who sits behind me in the office and keeps going out for a smoke every hour and returns smelling strongly like cigarettes. The smell fades after a while and he goes out again. Repeat.

I slept on my phone.

Like, physically ON my phone.

Now I'm worried it might be broken in ways I haven't noticed yet... 🤦🏻‍♀️

I forgot my password to [SITE]. Of course, I click "forgot password", and enter my email, which I did remember. Fairly routine "ah shit we have a problem" steps.

Now, it takes a second. This is to be expected. So I'm not worried. I then get the email and...

Now, you will notice that I redacted some information, like the company name, email, and my PLAIN TEXT PASSWORD, and my name.

I would like to note that this isn't a small, very local company that's new (even then it'd be unacceptable), but this is a multinational, multimillion dollar company.
How'd someone fuck up THIS badly?

Should i make my game open source? It will be free, but i'm worried about theifs..
(reuploading as their work, or selling)

One of our clients is called Skynet. Should I be worried?

I am worried of a future in which JS has taken over everything, fortunately wasm is here to help :D

I'm having quite a hard time.

For my studies, I'm doing some research minor atm. And it's basically a 10 hour a week job for me atm. I have literally nothing else to do. No I do not do side projects, I do not aim to be a developer in the future.

This is causing me to sleep about 12hrs each night until it's impossible for me to fall asleep again. I just do not see any point in getting up unless I actually have something planned (meeting bf/friend). It's gotten to the point where I've actually cancelled plans because they didn't give me enough motivation to get up.

Since this is my last year in college, I am also stressing out about what to do next year because I cannot think of anything I enjoy doing.

I am worried abiut my health at this point. Any tips?

One of the companies that rejected me sent me feedback which I took gracefully coz u sexy cunts told me it wasn't the end of the world when I ranted about it here. Well now they are offering me another interview and I am hella nervous coz I don't want to fuck it. Good thing is the feedback they gave me were actually all shit I know and use daily in my work, I am just bad at explaining plsu was nervous at the last interview. Now I am worried coz it's on monday and I have not had time to practice explaining the lang well coz work has been crazy (literally on a 10 min break now since 9am..almost 10hrs working) which is weird right coz last year I actually used to teach.

So now that i have update half of GNOME on Arch to 3.31 i rebooted a system. And when it boots up im greeted with an broken TV screen with Oh no.
Well thats not good.
After 12 minutes in openbox i noticed that MESA is fucked up and glxinfo is reporting shit. Ohhhhhhhhh i know.
llvm-svn updated and now mesa cant find path to it. Ohhhh yeah.

*/Compiles latest mesa in 2 minutes/*
Reboot.
Boom GDM shows up. OK we are still good.

Weird but its actually stable tbh.

But damn was i worried that i broke some package.

These people are worried about non profits where as I'm worried about thepiratebay.org

Yesterday I had a good idea for a project I'm working on, so I decided to stay awake all the night drinking RedBull in order to implement it.

Eventually I went to bed. I dreamed I was on an island with some friends and a volcano erupted. We escaped from the lava boarding on a big boat, then a tsunami wave reached the boat. Boat didn’t sink, however electric power went down. When the electric power returned, on the boat screens appeared the following text: "Please, restart MySQL". However, under it there was the PostgreSQL elephant logo. I was someway more worried about that rather than the tsunami. After that, a hurricane was coming too. We were saved by people coming with a spaceship, however they appeared to be drunk. I woke up thinking «WTF!».

This morning my husband told me our 4 cats made fuss all the night.

My father calls me very worried: hey, do you know your mother's email login username and password? We need it
Me: no? Why would I?
My father: well, she sent it to you on email when she created it, so you'd remember!

?? What?

Our HR guy is a tool. He requested I help him extract some data from our database. Which based on what he requested I supplied he then started trying to bully me because the data I gave him wasn’t what he wanted. Ringing me every 5 mins asking if it was ready, comparing me to another colleague who wrote the system.

When we blew up at him telling him to back off he continued. Anyway he still works here and persists in being a tool. i on the other hand ignore him.

I’m pretty sure that the HR bullying an employee is wrong, not massively worried about it just annoyed

Just overheard a conversation between 2 pilots while waiting to board a flight at an airport about some airplane related software. The guy talking seemed very proud (read egotistical) about his tech knowledge. It went something like... "Well you see it's open source so they are worried someone might have put a backdoor in it somewhere".

That's the point of open source you dumbass you actually have the ability to check 🤦‍♂️

Really worried about one of my devs tonight. He's going to go into surgery. Hoping everything will be okay. :(

Inherited a simple marketplace website that matches job seekers and hospitals in healthcare. Typically, all you need for this sort of thing is a web server, a database with search

But the precious devs decided to go micro-services in a container and db per service fashion. They ended up with over 50 docker containers with 50ish databases. It was a nightmare to scale or maintain!

With 50 database for for a simple web application that clearly needs to share data, integration testing was impossible, data loss became common, very hard to pin down, debugging was a nightmare, and also dangerous to change a service’s schema as dependencies were all tangled up.

The obvious thing was to scale down the infrastructure, so we could scale up properly, in a resource driven manner, rather than following the trend.

We made plans, but the CTO seemed worried about yet another architectural changes, so he invested in more infrastructure services, kubernetes, zipkin, prometheus etc without any idea what problems those infra services would solve.

My new favourite quote...

"I can't be the only one worried about the deadline"

By boss speakign ot my team who is expected to deliver 6-8 months worth of work in 5 weeks time...

Too bad he does not know he IS the only one worried, when you going to miss a deadline by that much when you never agreed to it in the first place, have not seen a single API and the scope is still actively changing and lets not forget we have no DevOps yet...
why the fuck would you worry...

Worst experience: being laid off when the startup I worked for lost a deal. I loved that project :(

Best experience: my new company sent me to USA for a few days to meet the client. I've gained a lot more of confidence on my spoken English. I've didn't use it in years, so I was worried. Perhaps you wouldn't think it's a "dev" experience, but English is actually a required skill for a developer who has it as a second language.

Welp, its official, with Debian Buster adoption into our mainline, we are officially switching from Sys-V-Init to SystemD.

I still do not know how I feel about it.

From the professional point of view - Its a relief. SystemD has so many more neat features that make the life of a sysadmin easier. If any, I love that it tracks the uptime of a service, making it incredibly easy the last time it crashed / restarted...

On the other... I just... Am kind of afraid where the whole systemd environment will go with time... And... I guess... I am also worried about how much systemd is taking over in the system itself... It will mean learning quite a few new services, debugging routines and such...

A new era of GNU/SystemD/Linux is upon us.

After being let go from my previous job (previous rant) roughly two and a bit weeks ago I already have multiple offers for new jobs.

There's lots of sterotyping for how difficult it is to get a new position in this field. I was worried, this is such a relief

Guys, this I am very tired of companies auto generating passwords for you and sending them to you in an email using plain text. Do they not care about the security of their systems?

I found a company called SDF.org which claims to have been established in the 90s. Their website, even the server feels very old school. But I would think that if a company is really that old, WHY DO THEY SEND YOU PASSWORDS IN PLAIN TEXT FORM. You've got to be kidding me. Has noone ever tried to hack them before? Are they not worried at all that their dial-up service is going to go down?

I once built an app because my girlfriend travels a lot and I was worried she might be kidnapped. App becomes a big deal, now I have to add more features. I really just wanted a holiday and peace of mind.

Our UX guys have all congregated in a conference room and are practicing their joker laughs.

I'm slightly worried.

As a student on platforms like these, hearing people talk about languages and concepts you've never heard of

I like writing bash, im just really worried about the time when the management eventually decides we need to support windows.

Started a new job and our tech lead doesn't know how to use GIT in a team environment, has only ever used it while working by himself on one person projects. Kinda worried...

Should I be fucking worried? After all skynet can't even identify a captcha yet. Or can it?

I’m fairly new to maintaining my own webservers. For the past week the servers (two of them) kept crashing constantly.

After some investigation I figured it was due to someone running a script trying to get ssh access.

I learned about fail2ban, DOS and DDOS attacks and had quite a fight configuring it all since I had 20 seconds on average between the server shutdowns and had to use those 20 second windows to configure fail2ban bit by bit.

Finally after a few hours it was up and running on both servers and recognized 380 individual IPs spamming random e-mail / password combos.

I fet relieved seeing that it all stopped right after fail2ban installation and thought I was safe now and went to sleep.

I wake up this morning to another e-mail stating that pinging my server failed once again.

I go back to the logs, worried that the attack became more sophisticated or whatever only to see that the 06:25 cronjob is causing another fucking crash. I can’t figure out why.

Fuck this shit. I’m setting another cronjob to restart this son of a bitch at 06:30.

I’m done.

Worried about your application crashing? I have a fix. through the entire thing in a try/catch and catch Exception. 😁😁

So yesterday ended with me becoming a first responder in front of my house. Talk about a crazy day.

Guy sped up down my very short dead-end road and flipped a school van down the embankment. Thankfully there were no kids in the van and the driver was okay.

I've never had to run into the scene of an accident before, and what the brain does in a time of crisis like that is absolutely amazing.

Feeling everything but the immediate need drain away. It was like time was slowed. I took in all the information of the scene and somehow worked fast while also double-checking every action I did.

I remember hesitating for a moment, worried about what I'd see. School students on the back. Would I see injured or dead children? Body parts? I remember saying "Fuck it" and running down the embankment and that was about it.

So serious props to any of you who read this that also volunteer as EMT or fire/rescue. I've long considered doing that myself and I may very well step up now that I've had first-hand experience.

And now for the requisite joke: Usually I only have to help out when Windows crashes. :)

Been really depressed at work for the last two years. To the point where myself and colleagues would constantly petition our boss to work with us to change our internal process.

After being constantly ignored / seeing no really impact ( he literally renamed a step in our process and said he fixed it forgoing all the recommendations that we suggested and refusing to discuss anything with us );

I decided to resign before I say or do anything to completely burn the bridge.

Two days later one of my colleagues also resigned ( the only other device at the company ) now my boss is frantically looking for our replacements while also trying to maintain that he holds all the cards.. he offered my colleague less than he is on now to freelance for him. And will likely attempt the same with me in my exit interview today.

But I'm working on a web app which I find interesting. Problem is that I'm not as hopeful as the others working on it with me that it will ever make any money. (It seems like a money pit if anything)

I think I may be in for a couple of rough months. But at least I'm not working for a company that made me so depressed that all I would ever think about is how to convince the boss to improve things.

I'm worried but for the first time in 2 years I feel happy.

When that demo you were so worried about goes super well :D

Am I the only one who gets extremely nervous the night before an interview as that technical test can encompass the entire academic field of CS. I'm just worried I'll forget the difference between a clustered and non-clustered index or fail to convey the difference between TDD and BDD.

I'm ten years in to my career now, so I 'should' know my stuff. I've produced the tests my self, hired other devs, but I still feel the nerves.

Apple is really worried about their huge failure with the i9 6-cores, worried they won’t sell.

How do I know? Well, this...

< 1 year of professional software experience - company: there's too many of you, come back when you have 3 years experience

3 years experience - company: those entry levels have now gotten 3 years experience just like you and now there's too many of you, come back with 7 years experience

7 years - company: too many of you, come back with 20 years

20 years - you: create sentient AI and order it to destroy the company. AI: sorry, I'm looking for an owner with 100 years experience, sorry.

Fuck.

When you can't sleep, because you are more worried about your code review...
That's my state right now...

My smartphone's fingerprint reader just stopped working, after EXACTLY 36 months of usage.

I always took care of this device to make it last, as I'm worried about resources consumption and what the production chain involves (like having working children in African mines).

I'll try to keep using it as long as possible, but I can't stop thinking that this problem shouldn't be always on us, the consumers, suffering defective devices designed to last only for two years.

We should put more pressure on producers to reduce electronic waste, and to invest more on the maintenance & repairing sectors (which are almost non-existent).

That's all folks.

Recently got promoted to Senior Engineer position. Should I be worried for not knowing what that 'Senior' means? 😳

Just started my first "management" role after 12 years as a developer, first thing I learnt is its just like my last role only I don't have to do any of the hard work.
Worried they'll figure out I'm doing almost nothing soon, any tips? Should I just start scheduling meetings to discuss meetings?

By the way, did anyone ever went to hospital because drinking too much coffee? I drink it, you drink it, we drink it, but I'm seriously worried sometimes about my heart and blood pressure.

Hello fellow coders can you help me here plz.

I'm really confused whether to buy MACBOOK PRO 13 INCH or SURFACE PRO 4. Both of i5/8gbRam/256ssd specs. Price almost same in India.

My main use is programming ( web apps/ open source) + portability.

Factors I like in macbook pro:
1) unix based
2) best service here in India ( heard from answers on Quora )
3) DURABILITY ( heard from answers on Quora ) ( will last for many years without any glitch).

Factors I like in Surface pro 4:
1) its ultraportability
2) pen & touch
3) better typing experience ( since I code/blog for long hours)
4) native bash support
5) sexier than MBP :P

I really like SP4 over MBP but I'm worried about its durability and service(in India).

What are your thoughts on this guyz?

Received an email from my previous employer (I worked there two years ago)

They have positions opening up in a few months and want me back.

Here I was worried my current job is at risk and now more than likely I have a job waiting for me now.

I work in a dev company. One of our clients hired us to help them out as their devs are failing with their deadlines.

I had to expose app services via an api. I did it. Client company devs didn't like the way I did it as I rewrote their datamodels and declared them as api-use-only. I was demanded to return bkend services' data structures.

I didn't agree and waited until deadline to submit my code.

Now they are honestly thanking me for what I did as I've saved them from a forever-mutating-api-and-angry-integration-customers hell.

Not sure whether should I be happy or worried. I forced my solution onto them. It's not proffessional. But yhe customer is happier now than it would've been.

What do you do in such situations?

I want to ask for my devrant stickers but I'm worried the South African postal service will just lose the package or steal it themselves

when you tell your boss 'we need to talk' and he looks genuinely worried 😀

Is it just me or with every Dev rant avatar the males seem angry/annoyed and the females look worried?

!rant

I have been at my current company for seven years. I am in a senior position and I am a senior person in the department with a lot of systems that I am responsible for. Anyway I am getting really tired of my management and getting burned out working basically 24x7 on call. My last two vacations I have been called and worked 6 hours each time.

So, tomorrow I have a second interview at another company, I am worried what will happen if / when I leave. I have a feeling I will probably land a side contract with my current employer.

I think I am sure I am ready to leave, just a little anxious about the change.

I DID IT! I got my first co-op job!! I’ll be starting in the fall and I’m super excited 🤩
Finally I’ll get to do real work and I’ll get to see just how far schooling has gotten me.

Gotta admit I’m a tilt bit worried I over sold myself in the interview but we will cross that bridge when we get to it 😅

I’ll also finally have some real rants soon enough 😏😅

My bookmark bar has a random entry for "Clam Poisoning" , between all the Amazon Web Services and Ruby entries. I'm not sure who put it there? It wasn't my wife or I. Should I be worried? Should I avoid all the shellfish for a while?

I'm worried. I would love to internship for my current boss over the summer.
But there are only 4 spots and 10 people competing.

She basically wants an assistant to help with her photography gig. But many of the skills she's asking for are graphic design related minus the website building.

Fingers crossed that what little knowledge I have there can be enough to get me free housing for 8 weeks. Would also love the chance to build a website. Here's to the interview tomorrow.

!rant

Made my research about mechanical keyboard and was worried that my first one was going to be too loud at work.

I can hear the majority of hammering cave trolls smashing their membrane keyboards louder than I can hear my MX Brown.

This shit is like heaven for fingers.

:D

An area of my company hired a new director who directed his “DevOps” team to implement a process that would prevent the CI server from running tests on a PR unless the code was reviewed first. He was worried that there would be too many tests executing with 400 developers committing code frequently.

He’s from Yahoo.

High paying unstable job at a startup vs. Low paying stable job at a huge company.

I'm currently at the latter and I'm expecting a job offer (hopefully!) from the other one today.

Low paying job:

Pros:
1) big name. (their stock has recently gone down tho)
2) insurance and stuff.
3) quite stable.
4) can re-skill and move to another team.
5) work from home.

Cons:
1) shit technologies.
2) lots of fake "we are a family" kinda crap.
3) shit pay for a huge company.
4) boring. I feel very unmotivated.
5) obsolete systems and management processes.
6) it would take years to save for a car even with my upcoming promotion pay raise.

High paying job:

Pros:
1) awesome salary. Like 6x my current.
2) up-to-date technologies. Something I'm passionate about.
3) team lead position.
4) I can buy a car in a couple of months.
5) might get a visa sponsorship in the future.
6) small team, my voice will be heard.

Cons:
1) it's a startup so it can go down anytime.
2) no insurance or any kinda benefits.
3) no work laptop.

I'm kinda in the beginning of my career, so my gut is telling me to risk it and go for the unstable job.
It will be my first time to be an "official" team lead and honestly idk how I'll go about it yet.

Which one would you go for?
And wish me luck! The interview went pretty well but I'm dreading for some reason.

Never lose your sense of wonder when it comes to working with clients. Client berated us saying her data were outdated. Ok. Check the file the third party that generated the data is sending us.

Outline all stated discrepancies in the data back to the client, showing that everything lines up with what we are receiving.

Client is frustrated. Contact the third party in their behalf.

Third party support: “oh yea, client had us start sending data to your competitor like a month ago”

Bruh. Bruh. Bruh.

Fortunately the client wants to stay with us and is getting their data pointed back but how in the hell do you forget that. The reason the client when looking at competition (at least guessing looking at previous call records) is to get faster processing of the data coming from the third party. How are you gonna forget you turned off the sending when you are so worried about speed?! Most of our clients are running 7-8 figure businesses by the way.

So, I got an iFixIt toolkit with a gift card from xmas. Was excited to tear into my iPhone6 given that it had lasted me a long time, and not that long ago, I had the screen repaired given I didn't know how to at the time and was working stupid long hours. I haven't used the phone in about 6 months now.

Wtf.

I open the device, and immediately 2 screws and a bracket fall out of the device. The inside is filthy, and appears to have corrosion (despite the fact I've never gotten water on it, I was kinda anal with that phone).

Whoever the guy was who "fixed" my screen apparently did so in a way that involved spilling something on my phone, over torquing a screw, breaking a bracket, and the entire thing looks sketch.

All while charging over $100. I can see why he insisted on having an otterbox on the phone now, he fucked up and was worried the one screw pin wouldn't hold the screen on. Motherfucking asshole.

Fuck America. Fuck Google. They're just worried about the dominance of Huawei.

[SERIOUS ADVICE NEEDED, PLZ HELP]

I am going to school again for like 4 days from tomorrow (don't ask me why, blame the government) and I feel a bit depressed. I just don't know what I have done in the last 2 years.

What I learned:
- Bunch of stupid facts from devRant
- C# stuffs
- Games are expensive
- Music production

And.... that's it, tbh

I don't really have "PERSONAL PROJECTS" that everyone is bragging about, I just have bunch of empty projects with a cool name but just Program.cs in it.....

I am worried of what to do now.

I just feel I made the wrong choice going with C#.

I just feel I should have went with JS.
With JS, you can do
- React Native + Cordova + Titanium + etc and make native android/ios/wp apps
- The WWW stuffs
- Electron --> Cross platform desktop apps (win/mac/linux)
- UnityScript (deprecated, but whatever) --> Games

So, what I am seeing now is a thick fog in the way to my future + career etc.....

I am stuck rn.

Please help.

Should I continue with my pace and learn more C# and the things I do rn, or change the language and start from scratch, or as a last resort, leave the "make stuff by coding" industry and go to music industry, or just go to the airport and do planespotting and upload in youtube to earn money?

Serious advice please, and no jokes about C# and JS. These languages may suck, but YOUR language may suck more.

Project from scratch with a deadline of one week and includes input of SSN

((worried))

!dev
This boring story with stupid ending started on Monday with me going out to buy some food and cook something delicious, day like always until my mind went nuts.

I work from home and cook my meals by myself cause I love cooking.
To buy ingredients I go shopping couple times a week always making the same steps, doing this for over a year now and by this time everything was automatic so I could think about work problems and solutions.

I start usually by getting up from my desk around noon, not many people doing shopping at that time and I can proceed quick.
Algorithm is like this: go to kitchen and look at the fridge, go out, wait for traffic lights, take tram, ride two stops, wait for the traffic lights again, go to supermarket, do shopping and finally go back the same way. Boooring.

When I get out from tram that day l looked at traffic lights to go green, as always and that’s the place where everything started to go bad.

So I was waiting there doing nothing and then stupid idea got me.
I figured out I can stop looking at light to make this day different and look ahead.
Then simply start walking when people from other side start walking.

It worked smoothly on those lights and I was happy I can do things differently from now on. I proceed with this idea on the way back and motherfuckers started walking on red. Twice !!!!
Almost died.

Since then three times some car was driving on green near me in those places and people started walking on red.

It got me worried about world determinism instantly. I might increased some entropy to much and some world developer changed some line of code while I was shopping and from that time death is passing by me.

Now it got me to the point where the more I follow this way the more I am worried about my life. Started thinking about ordering ingredients online.

So if you read this you know that I know your plan and I will be changing supermarkets and paths to it randomly starting from next week.

Or not I hope nobody hacked my mind and only thing that read and write to it is my consciousness.

I feel relief now.

My boss creates so many wtf moments with his total tech "un-savyness", although he is the " lead" dev, that I'm getting worried that I might be doing the biggest wtf faces every time ... I can't pretend like nothing is happening anymore .... Fuck!

Am I the only one worried with the OS wars lately? Microsoft and Apple trying to gain even more control on everything and Linux remaining at less than 2% on the desktop. People are oblivious to the fact that their personal freedom is at risk, and don't you dare tell me otherwise. Companies knowing what we search or what files we have on our computer, having the ability to control us and force us to follow their rules. We have a choice, and I'm not talking about destroying the economical system a la Mr. Robot, but moving to the Open Source world, not because it's more secure, faster or some such shit, but because it's the only way to ensure freedom on one of the biggest part of our lifes, the digital part. My concerns may be exceeding the normal, and I'll hate it to be right, but I'm afraid that if this goes on, in a few years, we'll understand that we made a big mistake...

Either my server is hacked or I fucked something up two days ago without knowing, I suddenly start receiving a dms file when I try access my domain or either by IP, file name is: valroSG0.dms

Do I need to be worried :S

Im slowly going from emails like "looking for developers" to "hi, when can you start" and i dont know if i should be happy or worried.

Just wrote an angry email about the unrealistic demands towards my team. Got a call an hour later from [product owner] where he had the most worried voice i ever heard because we are the only data scientists in the research. I expected an email reply in 2 weeks, seems like we are somewhat important here.

Are you worried about your development environment becoming more and more unstable?

Let me give you an example: I've been (mostly) a .NET developer for about 10 years now and yes Visual Studio crashed sometimes but not very often. Also whenever I found something that seemed like a bug in e.g. the MVC framework I always realized that the problem was in my code. However recently there is a VS update almost every week, and I more and more often bump into open GitHub issues without a fix.

Is this the same with other development environments? I also had a lot of issues with XCode/Swift but I never expected that to be stable...

Just got a job offer in a DevOps team, the cloud company is Netherlands based. But I'm worried about the Brexit because the day is a coincidence... and I'm in London.

hey guys, i was recently appointed to be devops engineer in a company. i did want to be a software developer though but they chose me for devops because my lack of java knowledge and a bit knowledge of linux and stuff.
my question for u guys is that... is devops good? for future career as well.
i m quite afraid to be honest, wouldn't want to have made a bad career decision. 😅😅
i must admit i have always enjoyed programming and hence i am worried in devops.

Question about burnout here!

I've been a developer for a year and a half now and I've reached a point of burnout. Experiencing a lot of external stress as well as internal (handled well with a fantastic and supportive team)

I'm taking some time away from work and having a much needed break but I'm worried that for now, I can't code! I've got no drive at all to learn anything new, I'm just sat here waiting for a production push.

I'm by no means thinking of changing careers or leaving my current role and the lack of concentration is likely as a result of stress, I just wanted to hear some of your stories so I feel a little less alienated!

Being new to this is pretty overwhelming at times!

Omfg... Fixed 3 LifeRay 6.1.1 ce security bugs in less than a day. I should be proud, but I am actualy fucking worried I've been with this project for too long if I can already make liferay fixes THAT fast...

Am I becoming a legacy...? Shit

College is rapidly sending me into a never-ending spiral of depression. I have to take Calculus-based physics for Computer Science, and it's making me want to kill myself. I'm not going to get anything higher than a D in it, so I'm going to have to take it again no matter what. I'm worried I'm not going to get a D in it because if I don't get at least a D in it, I won't be able to take the second part of it in the spring, which will remove 5 credit hours from my schedule that I will then have to find something else to fill with.

Worried that the terrible Physics grade I'm going to get is going to drop my GPA below the requirement for my scholarship. Worried that I'm going to get kicked out of the honors program as well. Worried that I'm going to be here for three more years. (My scholarship runs out in Spring 2020.) Stressing out about my Physics final tomorrow that will determine whether I pass or fail the class.

Im starting to wonder if that Computer Science degree is worth it.

I'm worried about me, and my future carrier path...
I don't know in what direction should I walk, to become the best as I can
And I'm going to be as best as I can...but Google Maps doesn't just show the direction, it gets lost as me...eh...
Yesterday, I've told to dev genie just 2 wishes, but as my third wish, I'd like to know in what direction should I walk, which roads should I avoid, what shall I do.

I have more side projects than I'll ever be able to finish. When I do finish them (or at least get a mvp), I have no idea how to market them, and in many ways, I don't even want to. I'm worried that it will kill the fun of it for me.

Does anyone else ever get so distracted/tired/pent up with other shit going on that they become a liability?

Last night I had about 5 hours sleep and have been worried over general UK politics lately.

Today, on a phone call to get support over getting locked out of our Apple Developer Program account, the call centre agent asked if we had the password.

I immediately replied "Sure! It's **begins saying actual password allowed over the phone**

I'm still wet behind the ears as developers go, and about a month ago I cobbled together a webservice. After many bug fixes I somehow got it working as intended, held together by tape and shoestring and creaking all the while.

This week, one of the consumers of the service wanted me to open it back up to change the name of the request .xsd. no functionality changes, just a name change.

I protested, worried my service would fall apart if I breathed on it. But he insisted so I made the change.

I just tested it and... it's working as intended.

But I still want to be mad about this!!

Hey, I need ideas. Keywords: DIY, IT cabinet, cooling. I hope I'll catch your eye :)

So I'm doing my apartment renovation. Complete renovation, 100% everything is remade. Soviets did a lot wrongs but one thing they did I like - storage compartments below ceiling (like double ceiling.. does it have a name in English? I often see them in garages). So I tore down the old compartment and created a bigger new one. I've moved some of my IT devices up there: router, switch, raspberry, etc. Now... it's okay while it's autumn-winter, it's bearable up there. I'm worried temperatures might get very high during summer.

Compartment is not that big, smth 1m x 2 m x 0.5 m.

Any ideas for cooling? I could set up a vent fan to circulate air but it's hardly a cooling. Also not very effective. A/C is not an option as the compartment is too far away from outter walls. Also A/C might be somewhat overkill :) 5 minutes ago I've remembered I had an in-car portable fridge-like thing that could keep drinks decently cooled during summer. I'm wondering whether it would work? Any ideas where could I get this cooling mechanism (what to even google for? :) )?

Is there anything better in the market? DIY? I'm not willing to spend a fortune for this idea (one more reason A/C is an overkill)

So Is it just me thinking that no one would pay for my work (web dev, IT stuff etc...), because it is so easy to build a website for example. I'm kinda beginner, what's your opinion on wordpress? But mybe I'm just rushing things, we want to build a webdev business with my friends and I'd like to hear some idea/experience from you guys :)

Gotta love the IoT.

They set up a new surveillance camera in the company, that can stream live footage over the network and that little shit picked the IP adress of a coworker one day AFTER being set up.
Hurray for static routing. Hurray to the person who didn't disable DHCP on the router (Should probably configure my PC to use a static IP as well lel)

Anyways, this happened outta nowhere when I, the only guy who knows shit about IT and is usually present at yhe office, wasn't there and could not connect remotely.

The other, remote programmer, who set up the network, could guide the coworker to get a new IP but, he was worried that we got ourselves an intruder.

Since nobody told me yet that we (should) have static routing, I thought there was a mastermind at work who could get into a network without a wifi-access point and spoof the coworker in order to access the some documents.

The adrenaline rush was real 😨

Scanning the network with nmap solved the mystery rather quickly but thought me that I need to set up a secure way to get remote access on the network.

I would appreciate some input on the set up I thought of:
A raspberry Pi connected to a vpn that runs ssh with pw auth disabled and the ssh port moved.
Would set up the vpn in a similar fashion.

I really need to vent this out. I don't know if the person I chatted last night is in some danger or not.

I recently got to know her and I had plans to collaborate on some projects with her.

She messaged me asking for a solution to a bug she faced and I was trying help her figure it out.

As I suggested a solution for her to try, she decided it was time for her to take her little dog to walk and told me she will check it right and let me know right after coming from walk.

It was already late in the night and I mentioned it to her. She responded like it was usual thing for her to go for dog walk at night but I'm kind of worried now since the city she lives in is infamously known as the rape capital.

She hasn't seen the last message I sent and there is no reason for her to keep me in the dark.

I had a hard time not being able to sleep because of my mind thinking of the worst case scenarios.

I don't know I'm just being too paranoid or if I should get someone to check on her.

I really hope she is back home and simply forgot to message me or something.

While writing a big program i always get worried about naming variables.

I hate when someone knows that something is going to happen inside the company, but only say things like "something is going to change, I can't say anything" 😑😑

Please! don't share if you don't want to, but don't stop worrying people!!!

When updating + restarting your Windows PC fixes the random exception being thrown in your controller when you were worried your frontend code broke the site. 😲

I am a senior .net developer and I should be promoted to a software architect over Java and .net soon, and my parents independently asked my wife and me if my job was stable. They also asked me if I was worried about losing my job. They have no idea what I do and they think it is nuts that I get paid what I do for the hours I work... I doubt they will ever get it.

I would like to proclaim my utmost love and respect to a programming language and one of its framework.

This language/framework combo was so beautiful that during development I had fantasies about it coming to life as the women I want to marry. I genuinely felt love in my heart to her. I even felt butterflies in my stomach thinking about her!

But I'm worried I might jinx it. So I'm not gonna name it.

I love you.

Relative phones up worried about installing Adblocker as it "can store and modify the websites you visit"...my answer.."so can GCHQ, NSA AND CIA so just give in to the fact that you have no privacy and click ok"...*long pause*.."ok one more question, what's a chrome extension?"..FML

Yesterday night!

Yeah it was Saturday night but not for me. I was at bus stop and my jiofi device was in back pocket and after some time I was coming back to my room and thinking let's switch on wifi. After that my mobile was not connected to jiofi so I thought may be jiofi out of charged. Later on when I was checking in my pocket I realize that I missed it on bus stop!

Actually this jiofi device is my first salary's garbage:D

That's why I was little bit worried.

So I went back to stop and saw nothing was there. Disappointed but wait, suddenly devRant notification came and mobile vibrated so I checked and I seen that my mobile connected to jiofi and then I checked carefully, it was there!

Actually jiofi was placed in opposite face so that light was not visible but I got my jiofi back.

Thank you devRant notification:D

That guy at the office who gets really irritated and worried about newly introduced technology. He would spend 2-3 days talking trash about it, saying how much he prefers the older and less efficient approach just because he knows it.

That fucking guy.

I'm fairly new (less than a year) to programming and I'm just wondering what everyone's thoughts are about this.

Is taking college math courses necessary to be a good programmer?

I am learning online and I'm worried I won't be a great programmer without all the math. The last course I took was Trig :/

Also add any suggestions you have. Thanks all!

I landed myself an interview with a really great company for a DevOps intern position tomorrow.

Im really hopeful about this. The company truly seems like a great place to work with incredible opportunity to grow, and I desperately want to pursue a career in DevOps, but Im worried that Im underqualified. I lack true professional experience, and have really had no adequate time working with CI/CD tools, but I am very interested, excited and willing to work hard to become proficient.
Ive been prepping myself as much as I can in this last week (trying to gain familiarity with tools like jenkins, artifactory, chef etc), and so I ask to you, my fellow ranters (particularly DevOps), are there any final tips or bits of advice that I can take to really impress my interviewers and better my chances of getting this position?

Also, hello again to my old devRant pals~ I miss hanging around here and conversing with you great people

So I can guzzle like 6-8 cups of coffee a day, should I be worried about the caffeine or the sugar? 🤔

Should I be worried...?

Before getting my dev job, I taught myself some java and made a program to assist myself in the position I was working. It was borderline a keyloger, but it helped me with a lot of repetive tasks. Long story short, our security didn't dig that I installed something they didn't approve (I probably could have just not made it an exe and gotten away with it but my boss wanted it as an exe to run on other computers) they didn't know exactly what it was. I totally understood the security concerns though but they sure gave me a fucking heart attack right before my interview for my first dev job! Was seriously worried I was going to be fired and miss my big chance to make it in with out a degree.

I have to go onto windows to do something that Linux can't do. Should I be worried about all the updates? (particularly worried about them overwriting my other partitions since I dual-booted)

Got a high paying job, with great benefits, and a big name, straight out of college. I was hired as a software engineer. Comfy, relaxed, and flexible.

The problem comes where it was not the job I was expecting. It has been almost a year and the only programming I've done has been 1 small copy pasta project. I am worried because I am bored and feeling my coding skills fade away. I'm still a novice programmer and feel like this impacts future career opportunities not learning useful skills for outside of this company. I'm going to grad school to do what I really want but still have the 2 years.

Do I stay or do I make the stressful change again? Other fun thing is I just relocated a distance to an area with not a lot of opportunities so would likely involve relocating again.

My boss wants to put an Amazon Echo Dot in the conference room. So I suggested covering it with a cheese cover (those glassy dome thingies). He thought it would be an artsy statement, but I was actually worried about privacy.

Anyone have any experience with listening devices in the workplace?

So I'm a junior in University for Computer Science and software engineering and while I'm a decent coder, I've noticed that I'm not as interested in the Coding aspect of it as others. I don't really think about doing projects of my own and tend to just focus on the schoolwork. I feel like I recognize patterns rather than fully understanding what's going on. I did extremely well in the Coding bootcamp I went to, better than most. But I'm worried that I'm not as into being an engineer as I think I should be. I love working with computers and the process of making something, but I'm always second guessing being an engineer.
Am I just worrying too much? Imposter syndrome?

Not sure if it is a rant or not but I'm getting worried about Apple... Two days passed uploaded a new update multiple times and all ended on the first try 😨
Usually it takes many tries for it to be uploaded 😨
On top of that, iTunesConnect is faster and no longer stuck at loading when token expires 😨

I hope I'm not dreaming 😅

Me and a friend starting to program a game in Unity, he's worried and I think we will ace it! How f***ed are we? (5 years of website development experience each)

I wish I had that self esteem a lot of my classmates posses.
I'm working for my prof, I've kinda made my very first step into the industry. Somewhere deep inside I know I'm talented and smart. However, every day I am worried that I'm not good enough and it will be noticed at the job soon.
Is that common thing in Dev community? Just want to know opinions

So worried people will fuck things up in work when I'm not there. It's causing such tiredness and such long days. 🙇I think it's caught up with with today. No holiday leave taken for 9 months and not a day off sick. 🏳

When your boss calls for a meeting with the whole IT department because he is too worried about losing face by lecturing the guy who talked back to him.

I'm worried my dubstep beets running through my desk are bad for my hard drive...

Can people at least write a damn comment and tell me why the fuck they don't like the app???

Yesterday I released an update and noticed someone left a new review, without comments, just a one star review.

First I was worried because maybe the update has some nasty bug, but no, this stupid user rated the app without leaving a comment, GREAT!!!

Now google only shows that specific review because the others were of an old version, so great, now anybody wanting to install my app will only see this shit.

If you already took the time to open the play store specifically to rate the app, fucking say something!!! insult me, say it's a bunch of crap but say something you piece of shit!

The bathroom here doesn't leave me worried I'm going to catch hepatitis.

Is it better to buy a cheap laptop and work by remote connecting to a powerful PC, or to just buy a powerful laptop?

context:
I like playing video games, I also sometimes program using Visual Studio + Unity which is also pretty heavy. Because of this I know I need a powerful machine.

my thoughts:
Now I could buy a "gaming" laptop, It's portable (useful for LAN-parties) but it's expensive and doesn't last as long as a PC.

I could also buy a powerful PC with a cheap used laptop, I could do most work on this laptop and if I need to do something more powerful I could remote to my PC.
But this would require internet at all times and i'm worried that working over remote might not be the smoothest experience.

The university's IT Department has asked to talk to me asap.

I dont if I should be worried or not!

I am in 3rd year of my college and I am a bit worried.
How you people apply for jobs? Do you just walk in a company and talk to the receptionist or.....?