Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "no push"
-
HR: We have received complain that you have been sexually harassing an intern.
Me: No, I wasn’t. Me and the new intern all we talk about is Coding, Apps, and TV-Series
HR: You are lying. I have the words that you said to the intern. Do you want me to read it out.
Me: I have no clue what I said to the intern so please read it out.
HR: You said, “Always pull before you push”. Do you remember saying this?
Me: Yes, I was teaching the intern how to use GIT.
HR: Okay, let me call the intern and let see if he says the same.
** Intern **
HR: Was he sexually harassing you today at any time.
Intern: No
HR: Did he said, “Pull before you push” to you?
Intern: Yes
HR: What does that mean, sounds like a slang for something sexual.
Intern: haha, no it means that I should pull the changes made to the files before I can push the changes I did to the code from my computer.
HR: But he said something else like he was teaching you how to use GIT
Intern: Yes, that’s what GIT is.
HR: Okay both of you can go and don’t use this type of terms in the future it doesn’t make good working culture.52 -
Management : "How long you think it would take?"
Me : "now this is a rough estimate, but I think building the back-end and database alone could take 6-months minimum"
Management : "WHAT ARE YOU TALKING ABOUT? YOU ARE NOT SERIOUS"
me : "its a big proj..."
Management : "I thought it will be something like 10 days, already told the client it can be done"
me : "but we are not ready"
Management : "how are we not ready? we already have the virtual 3D shop, and we can use this ready-to-deploy eCommerce service as our data base "
... "you need to figure this out, this is not acceptable" he continued
* 2 Days Later -talking to my direct boss *
Boss : "since you don't know how to do it..."
me : "what ? I didn't say I can't do it, all I said it will take six months"
Boss : "yeah yeah, anyway there is this studio, a professional polish studio, we called them and they can do it, we will sign a contract with them, this will let you focus on the front-end. good?"
me : "well alright then"
Boss : "please write a doc, explaining everything needed from the backend"
-to me that was the end of it, took a long time to tell me they made the deal-
* 5 Months later *
- "Abdu, can you come here for a minute..."
- "yes boss?"
- "the document we asked you to do for the Polish studio, did you specify that we needed an integration with the API we are using for eCommerce?"
scared to death I answered : "why of course I did!"
I ran to my PC to check it out because I didn't know, I forgot because no one even comment on my doc. I check it out, and it was clearly explained... I got relaxed...
turns out they didn't even do what we asked them for. took them 5 months, and with no communication whatsoever. all their work was useless to us. complete dump waste.
----------------
never mentioned this until a year later... in a heat of moment when they were asking me to make an impossible task with no men and no time... I reminded them of this story... management didn't like it. but it was the truth. they didnt push this crazily this time13 -
• Manager : WTF did you push, now it keeps crashing all the servers.
• Me : (silent, I'm trying to speak but nothing is coming out. Felt like someone in coma).
• Someone else shouts at boss : Now we now have 47 major crisis bridges.
[I went running for the door to get away from everything.]
Only to find myself rolling on the floor tangled in my bedsheets after falling from my bed. Realized it was all but a nightmare.
Went to get some water. While taking the first sip...
Me: Shit, I'm late for work AGAIN.
Running for the door again. Then stopped to think if this is all some fuckin premonition. Hurriedly went for my phone to find out it's nothing but Sunday.
I'm thinking about a career switch now. No more devops once this is over.8 -
If Operating Systems Ran The Airlines
UNIX Airways
Everyone brings one piece of the plane along when they come to the airport. They all go out on the runway and put the plane together piece by piece, arguing non-stop about what kind of plane they are supposed to be building.
Air DOS
Everybody pushes the airplane until it glides, then they jump on and let the plane coast until it hits the ground again. Then they push again, jump on again, and so on ...
Mac Airlines
All the stewards, captains, baggage handlers, and ticket agents look and act exactly the same. Every time you ask questions about details, you are gently but firmly told that you don't need to know, don't want to know, and everything will be done for you without your ever having to know, so just shut up.
Windows Air
The terminal is pretty and colorful, with friendly stewards, easy baggage check and boarding, and a smooth take-off. After about 10 minutes in the air, the plane explodes with no warning whatsoever.
Windows NT Air
Just like Windows Air, but costs more, uses much bigger planes, and takes out all the other aircraft within a 40-mile radius when it explodes.
Linux Air
Disgruntled employees of all the other OS airlines decide to start their own airline. They build the planes, ticket counters, and pave the runways themselves. They charge a small fee to cover the cost of printing the ticket, but you can also download and print the ticket yourself. When you board the plane, you are given a seat, four bolts, a wrench and a copy of the Seat-HOWTO.html. Once settled, the fully adjustable seat is very comfortable, the plane leaves and arrives on time without a single problem, the in-flight meal is wonderful. You try to tell customers of the other airlines about the great trip, but all they can say is, "You had to do what with the seat?"11 -
"Sir, I fixed the recent bug"
"Great, what did you do?"
"I commented out the code that was causing it :)"
"Brilliant! You didn't forget to push the code to production, did you?"
"No Sir, I pushed it immediately"
"Marvelous! I'll arrange a promotion for you next month"5 -
*came in this morning to see this conversation in slack from the remote teams*
Dev: Hey guys, I'm trying to push to the develop branch, telling me its locked. Is there a new process?
Lead dev: Yes I locked it because the repo is now dead, the last release that went out is the last for this year and ever for this app. Were merging this app with another, starting from the last release's code. We'll all have to swap over to the new repo soon.
Dev: ... eh ok I didn't put anything in the last release branch as it wasn't urgent. Normally our process is anything in /develop goes out in the new year. I've been merging to /develop for the last few weeks ... is that code now gone?
*14 question mark emoji reactions*
Lead dev: Yes
*27 angry emoji reactions*
Engineering manager: WHAT? when was this decided? When was it communicated?
Lead dev: oh I assumed my product counterpart had been spreading the messages around, have they not?
Several teams: no, nope, first i'm hearing of it.
Lead dev: Ok, i'll ask them what happened. Be aware then that most of the stuff thats going into develop now, most likely won't be allowed in until March. They want to prioritise releasing this new merged app and don't want anything to impact it.
Dev: So wait, i'm working on stuff now. What do I do? Where do I base the branch? Where do I merge?
<no response>
*My team comes into the office*
Dev: eeehhh ... what does this mean for our past 4 weeks of work? and all the stuff needed to go out in January?
Me: not.a.fucking.clue16 -
Git makes it easy to search through historical changes they said. Git is amazing when working in teams they said.
It sure is.
If your coworkers do not commit every time they burp or fart, do not use "🚀" or "✨" or "fix" as a commit message, and do not push all their shitty experimental broken branches without cleaning up.
I'm surprised there are no piles of fecal matter behind their desk chairs.16 -
Alone at home ✔️
Night time ✔️
Battery about to die ✔️
No electricity ✔️
Painfully hot weather ✔️
If I die here tonight, please commit and push my code..
Thanks14 -
I was hired as a senior software engineer. During handover I found out I'm actually replacing the CTO.
I queried why he was leaving and got a simple "just want a break from working" which I found odd.
Fast forward and now I also just want a break from work, permanently. This place has followed every bad practise and big no-no out there. Every bit of software is a built in house knockoff janky piece of crap that doesn't work and makes people's jobs 5000 times harder.
The UI looks worse than Windows 3.1, absolutely horrendous code formatting, worst database structure I've ever seen.
The mere mention of using a team communication tool results in being yelled at from the CEO whom communicates purely via email, who then gets annoyed when you don't reply because they sent the email to a client instead of you.
We get handed printed out "tickets" to work instead of the so called "amazing in house ticket system" built using PHP 5 and is literally crammed into an 800x600 IFrame. Yes a F$*#ing IFRAME!
It's not like we have an outdated TFS server that has work items we can use...
Why not push for changes you say. I have, many times, tried to suggest better tools. The only approval I've gotten is using PhpStorm. Everything else is shutdown immediately and you get the silent treatment.
The CEO hired me to do a job, then micromanages like crazy. I can't make UI changes, I can't make database changes, why? They insists they know best, but has admitted multiple times to not knowing SQL and literally uses a drag and drop database table builder.
Every page in the webapps we make are crammed into 800x600 iframes with more iframes inside iframes. And every time it's pointed out we need to do something, be it from internal staff or client suggestions, the CEO goes off about how the UI is industry leading and follows standards.. what in the actual f....
Literally holding on by a thread here. Why hire a CTO under the guise of being a senior developer but then reduce the work that can be done down to the level of a junior?
Sure the paycheck is really nice but no job is worth the stress, harassment and incompetent leadership from the CEO.
They've verbally abused people to the point they resign, best part is that was simply because the CEO made serious legal mistakes, was told about it by the employee then blamed it on others.21 -
Hey everyone - I just wanted to update our Android users on the push notification crash that has been occurring.
The good news is the issue should be fixed in the update I just pushed out (should be available in the Google Play Store within a few hours). We apologize for the crashes and thank everyone for their patience.
I'm still looking in to what actually happened here. Our GCM library hasn't been updated in a while and all of a sudden a specific case started failing. I'll continue to look in to how that seemingly happened with no changes in the app. Some other users of the library started experiencing the same issue.26 -
There is no pain like having to talk a parent through how to commit and push your work because you forgot to when you left home....11
-
Dear websites,
Please stop fucking asking me to install your shitty mobile apps. They do the same thing your site does. I have a browser, and it's a lot better. I don't even visit you every day. But even if I did, and I wanted your crappy app, I'd open the app store and download it by myself. No need to push me.
No need to waste the little screen estate I have with crappy call-to-action sections to download that shit.
Fuck your desire for more information about me. Fuck your narcissistic enjoyment when I have your icon on my fucking home screen.
The truth is, there is a very small number of apps that really need to integrate with a phone to offer better experience.
I feel most of you feel you need to have an app just because everyone else does. And so you could show these little Android and Apple logos on your website or ads. Well, how about you just make sure your site works well on a mobile screen and don't waste your money on a half-baked mobile shit app unless it really offers something worthwhile?
And if you do have a good app and it really does something, ask me just once and fucking respect my choice. Don't just ask me again and again, on every page, with every new session, or I'll just stop visiting.
You're all not that unique, so fuck you!16 -
Tested on local work perfectly,
Push to production
Restart service
CPU went up to 100%, process alive but all services down.
Panic.
Try to think of what would be the cause.
With no hope, i restarted the service again.
Everything works as expected.
I still dont know what happened. :/7 -
After months and months of unrealistic deadlines, pulling late night shifts coupled with an insane commute and two very small children at home I had a total burnout. Turned up to work one morning, and stared at the Java code I had been writing for the past couple of days and it might as well have been written in Martian. The more I stared, and the more I tried to keep things together internally the less I was able to make sense of anything - just a random jumble of characters on screen that were as intelligible as the green scrolling lines from The Matrix.
My office manager saw that I was obviously in some distress and took me into a meeting room to have a quick chat - and there I was, a grown man of 35 bawling my eyes out like a two year old. Not the most edifying moment of my life.
However, the company couldn't have been more supportive afterwards; one of my colleagues drove the 100 miles to get me home in my car and took a train back up to the office; my GP signed me off work for six months and treated me for severe depression; the office instituted stricter working policies - not on the developers, but the sales/PM teams that were handing down ridiculous timescales simply so they could get a sale.
For my part, I've learnt to push back and say "NO!" - work is not your life, it's an important part of your life, but my no means everything. Don't feel beholden to a company to meet unrealistic targets that you haven't agreed to. Talk.3 -
Doot doot.
My day: Eight lines of refactoring around a 10-character fix for a minor production issue. Some tests. Lots of bloody phone calls and conference calls filled with me laughing and getting talked over. Why? Read on.
My boss's day: Trying very very hard to pin random shit on me (and failing because I'm awesome and fuck him). Six hours of drama and freaking out and chewing and yelling that the whole system is broken because of that minor issue. No reading, lots of misunderstanding, lots of panic. Three-way called me specifically to bitch out another coworker in front of me. (Coworker wasn't really in the wrong.) Called a contractor to his house for testing. Finally learned that everything works perfectly in QA (duh, I fixed it hours ago). Desperately waited for me to push to prod. Didn't care enough to do production tests afterwards.
My day afterwards: hey, this Cloudinary transform feature sounds fun! Oh look, I'm done already. Boo. Ask boss for update. Tests still aren't finished. Okay, whatever. Time for bed.
what a joke.
Oh, I talked to the accountant after all of this bullshit happened. Apparently everyone that has quit in the last six years has done so specifically because of the boss. Every. single. person.
I told him it was going to happen again.
I also told him the boss is a druggie with a taste for psychedelics. (It came up in conversation. Absolutely true, too.) It's hilarious because the company lawyer is the accountant's brother.
So stupid.18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Seven months ago:
===============
Project Manager: - "Guys, we need to make this brand new ProjectX, here are the specs. What do you think?"
Bored Old Lead: - "I was going to resign this week but you've convinced me, this is a challenge, I never worked with this stack, I'm staying! I'll gladly play with this framework I never used before, it seems to work with this libA I can use here and this libB that I can use here! Such fun!"
Project Manager: - "Awesome! I'm counting on you!"
Six months ago:
====================
Cprn: - "So this part you asked me to implement is tons of work due to the way you're using libA. I really don't think we need it here. We could use a more common approach."
Bored Old Lead: - "No, I already rewrote parts of libB to work with libA, we're keeping it. Just do what's needed."
Cprn: - "Really? Oh, I see. It solves this one issue I'm having at least. Did you push the changes upstream?"
Bored Old Lead: - "No, nobody uses it like that, people don't need it."
Cprn: - "Wait... What? Then why did you even *think* about using those two libs together? It makes no sense."
Bored Old Lead: - "Come on, it's a challenge! Read it! Understand it! It'll make you a better coder!"
Four months ago:
==============
Cprn: - "That version of the framework you used is loosing support next month. We really should update."
Bored Old Lead: - "Yeah, we can't. I changed some core framework mechanics and the patches won't work with the new version. I'd have to rewrite these."
Cprn: - "Please do?"
Bored Old Lead: - "Nah, it's a waste of time! We're not updating!"
Three months ago:
===============
Bored Old Lead: - "The code you committed doesn't pass the tests."
Cprn: - "I just run it on my working copy and everything passes."
Bored Old Lead: - "Doesn't work on mine."
Cprn: - "Let me take a look... Ah! Here you go! You've misused these two options in the framework config for your dev environment."
Bored Old Lead: - "No, I had to hack them like that to work with libB."
Cprn: - "But the new framework version already brings everything we need from libB. We could just update and drop it."
Bored Old Lead: - "No! Can't update, remember?"
Last Friday:
=========
Bored Old Lead: - "You need to rewrite these tests. They work really slow. Two hours to pass all."
Cprn: - "What..? How come? I just run them on revision from this morning and all passed in a minute."
Bored Old Lead: - "Pull the changes and try again. I changed few input dataset objects and then copied results from error messages to assertions to make the tests pass and now it takes two hours. I've narrowed it to those weird tests here."
Cprn: - "Yeah, all of those use ORM. Maybe it's something with the model?"
Bored Old Lead: - "No, all is fine with the model. I was just there rewriting the way framework maps data types to accommodate for my new type that's really just an enum but I made it into a special custom object that needs special custom handling in the ORM. I haven't noticed any issues."
Cprn: - "What!? This makes *zero* sense! You're rewriting vendor code and expect everything to just work!? You're using libs that aren't designed to work together in production code because you wanted a challenge!?? And when everything blows up you're blaming my test code that you're feeding with incorrect dataset!??? See you on Monday, I'm going home! *door slam*"
Today:
=====
Project Manager: - "Cprn, Bored Old Lead left on Friday. He said he can't work with you. You're responsible for Project X now."24 -
I honestly have no energy to even type this out because this is so draining, but here goes.
I am usually very calm and can keep my composure well, but boy do you push my limits. Do you think my work is so easy that it’s just “a bunch of queries and simple logic”? Well, fine. YOU FUCKING DO IT.. right before I grab you by your fucking neck and shove your face repeatedly into the keyboard. You even have the audacity to give us a project and come the very next fucking day and repeatedly keep asking us “iS iT FiNisHeD yEt?” so much and annoy even the calmest in our team even when we clearly stated that it was going to take us 30 work days to fucking finish it. Do you not know what a working day is? 30 work days is not the same as 30 days you dumbfuck. You have no idea how any of these work and yet you preach your bullshit and waste our fucking time when we could have used that time better to finish our work. THIS IS WHY EVERY SINGLE EMPLOYEE KEEPS LEAVING AND WHY THIS COMPANY HAS A VERY LOW EMPLOYEE RETENTION RATE. You won’t even let me finish my fucking lunch in peace. We have 45 minutes for lunch and since I’ve been eating out for almost the past year (I live alone and don’t usually have time to make food at home because of my hour and a half long commute), a close friend of mine’s mom reached out to and said “Hey, since you’ve been usually getting food from outside, why not join us for lunch?”, so I did and it was the most amazing food ever. Mind you, this was the first time I’ve ever left work myself to have lunch since I joined. I did get 10 minutes late because lunchtime tends to fall around the time where the schools close for the day (no shit) and school traffic is usually insane, and you unsurprisingly decided to make an issue out of a non-issue especially since I’M THE ONLY FUCKING PERSON WORKING IN THE COMPANY and also dock my pay for that. Let me also include the time where our one of the others in the management gave us a quick project that was to be quickly finished while we working on an existing project so we put aside a day just to complete and ship the app and the features and as usual, you decided to make an issue out of a non-issue and decided to shame us publicly and even made (my now former) colleague cry. You’re just a spoiled, selfish, ignorant nit-witted fucking imbecile who has no idea how to even properly run a business. Get fucked in the arse with a cactus. I'm done. I've held on for so long but this is the last straw. I'll be handing my letter of resignation soon. Good luck with running a company without any employees.20 -
As a developer in Germany, I don't understand why anything related to development like IDEs, git clients and source code documentation should be localized/translated.
Code is written in english, configuration files too. Any technology, any command name in a terminal, every name of a tool or code library, every keyword in a programming language is written in english. English is the language of every developer. And English is simply a required skill for a developer.
Yet almost everything nowadays is translated to many other languages, espacially MS products. That makes development harder for me.
My visual studio menus are a mess of random german/english entries due to 3rd party extensions.
My git client, "source tree" uses wierd translations of the words "push" and "commit". These commands are git features! They should not be translated!
Buttons and text labels in dev tools often cut the text off because they were designed for english and the translated text is bigger and does not fit anymore. Apparently no one is testing their software in translated mode.
And the worst of all: translated fucking exception and error massages! Good luck searching for them online.
Apple does one thing damn right. They are keeping all development related stuff english (IDE, documentation). Not wasting money on translations which no developer needs.19 -
Coworker: "Hey I have the final logo for your software"
Me: "Awesome, only a few bugfixes after my holiday and we are good to go on production. 2 more hours to go until I am free for a week."
Coworker: "After your holiday? Boss said it goes on production tomorrow!"
Me: "You are kidding me, aren't you? There is no way I can do all the work today and push to production!"
Coworker: "Boss promised the client..."
How about boss can go an f himself? He knows I have some other project to finish today and that I am leaving. This is in our team cal for over a month now! Ahhh. My coworker now has to deal with it-.-2 -
I am fucking dying of laughter right now. 😁
Today I got a push message of the invoicing app I use from time to time and the message literally just said "lol" (without even the usual pre-fix of the app name or anything).
So after not figuring out where that could have come from and obviously theres no private messaging etc. in that app, I contacted support and they reacted surprisingly good and at same time hilariously good; they pushed now a team towards investigating that, as apparently I wasn't the only one.
https://support.waveapps.com/hc/...
I wonder who fucked up and literally pushed "lol" to thousands of people. 😂8 -
A while ago I had all these ideas for side projects, and I really wanted to create something. However, every time I started to work on it I usually started the IDE, wrote a couple of lines, and quickly lost motivation. This kept going for a while. I just wasn't feeling it and when there is little or no (visible) progress it can be hard for me to continue working.
Then one day I wanted to push through it, and decided to set a rule: I have to make at least one commit per day, no matter how small.
So I (re)started work on a side project, and by the time I was satisfied with what I'd want to commit I've made enough progress to want to continue working on it. This quickly turned minutes of coding into (late) hours. Now I have a couple of side projects going which are progressing quite nicely, and I feel motivated to work on them again.
I don't know if there are any other people on here who've had this feeling, but if you did maybe this'll help you :) I'd love to hear from you how you keep yourself motivated!10 -
You know side projects? Well I took on one. An old customer asked to come and take over his latest startups companys tech. Why not, I tought. Idea is sound. Customer base is ripe and ready to pay.
I start digging and the Hardware part is awesome. The guys doing the soldering and imbedded are geniuses. I was impressed AF.
I commit and meet up with CEO. A guy with a vision and sales orientation/contacts. Nice! This shit is gonna sell. Production lines are also set.
Website? WTF is this shit. Owner made it. Gotta give him the credit. Dude doesn't do computers and still managed to online something. He is still better at sales so we agree that he's gonna stick with those and I'll handle the tech.
I bootstrap a new one in my own simplistic style and online it. I like it. The owner likes it. He made me to stick to a tacky logo. I love CSS and bootstrap. You can make shit look good quick.
But I still don't have access to the soul of the product. DBs millions rows of data and source for the app I still behind the guy that has been doing this for over a year.
He has been working on a new version for quite some time. He granted access to the new versions source, but back end and DB is still out of reach. Now for over month has passed and it's still no new version or access to data.
Source has no documentation and made in a flavor of JS frame I'm not familiar with. Weekend later of crazy cramming I get up to speed and it's clear I can't get further without the friggin data.
The V2 is a scramble of bleeding edge of Alpha tech that isn't ready for production and is clearly just a paid training period for the dev. And clearly it isn't going so well because release is a month late. I try to contact, but no reaction. The owner is clueless.
Disheartening. A good idea is going to waste because of some "dev" dropping a ball and stonewalling the backup.
I fucking give him till the end of the next week until I make the hardware team a new api to push the data and refactor the whole thing in proper technologies and cut him off.
Please. If you are a dev and don't have the time to concentrate on the solution don't take it on and kill off the idea. You guys are the key to making things happening and working. Demand your cut but also deserve it by delivering or at least have the balls to tell you are not up for it. -
I was at Leeds Central train station the other day, waiting for the platform to be announced on the screen in the main bit. I noticed a commotion to my right. There was a teenage girl screaming and writhing around on the floor, her mother was knelt on one knee trying to calm her. I walked over without thinking, I know nothing about Epilepsy or first aid, at a push I could probably figure out the recovery position from a faint diagram i have stored in the unused part if my brain...
(it’s where I keep the washing machine instructions, which incidentally were designed for maximum confusion, if Id designed a washing machine it would have 1 button labelled ‘wash’)...
Sorry, back to the story. So i walked over and just before I got there, with the mother looking directly at me, I realised, what the fuck am I doing, meanwhile the daughter was screaming still and writhing, a bit like a rapid angel print you would make in the snow as a kid (until your hand touched the dog shit).
I couldn’t help it, the words just came out, like a dumb fucker, i said ‘Has she got epilepsy?’ , i stood there waiting for the sarcastic comment or the murderous stare, even a fuck off would suffice, so that I could remove myself from the situation.
To my surprise, and shock, she looked at me, calmly and said “oh no, it’s not epilepsy or anything like that.... she’s lost her iPhone”.5 -
Talking to Best Buy customer support live chat trying to price match using friend’s laptop.
Typed in “<b>Hello</b>”
Oh cool.. it comes out as bold. Let’s get a scary as fuck screamer gif and img src it.
Me: *Posts picture*
Me: *Waits a few seconds*
Me: “Did you see that picture?”
Support: “No. Sir, could you tell me the item you want to price match?”
Me: “Okay hold on.”
Typed in “<script type=‘text/javascript’>window.alert(‘OOGA BOOGA BITCH’);</script>”
Me: “Did you see that?”
Friend: “Dude stop.”
I push my friend away since I’m on his Best Buy account.
Me: “Did you see a pop up?”
Support: “No.”
Me: “Okay okay hold on.”
You have left the chat.10 -
I have a client (a friend of a friend of a friend) who came to me to build them a "simple" booking solution for their home cleaning business. Easy enough, I first thought.
Having taken a deposit based on my initial quote and contracts all signed, roll on exactly 8 months to where I find myself today.
It turns out, there is no cleaning business as the business will be totally reliant on the website. The original goalposts have now been moved to a completely different fucking country. The (now) required functionality has STILL yet to be finalised (I told client I'm not writing another line of code until EVERYTHING has been mapped out and made crystal clear), as every single face-to-face meeting / back and forth email turns into the client requesting hundreds more brilliant, essential features that make absolutely ZERO fucking sense. And now, to top it all off and push me into writing my first ever rant on here, I've just received an email from the client this morning saying "what I would like to have is like an online restaurant live booking system". WTF?!?!?
I work from home and have only my dog for company today, so please don't judge me. Just needed to let it all out.11 -
Paypal Rant #3
One day I'll go to Paypal HQ and...
... change all the toilet rolls to face the wrong way
... remap all the semicolons to be the Greek equivalent character
... change all the door signs so they say "pull" instead of "push" and vice versa
... modify all the stairs to have variable heights
... programmatically shuffle the elevator buttons and randomly assign the alarm key to any of the most visited floors
... pour cocoa onto all the keyboards and wipe them off cleanly
... attach clear duct tape over their mouse sensors and insert really weak batteries or mess with their cables
I'll wait a day or two until they experience a sudden shortage of developers, then bombard them with thousands of fake applications from seemingly amazing candidates, then write an AI bot to continue argumentation with HR.
I'll wait another week or so until the company dissolves and with them, all my issues in life.
No need to be overly vulgar this time because you all know the deal. I hate this fucking company. Please Paypal do us all a favor and go fuck yourself.9 -
Me: Hi Guys, theres no docs on our custom push notification / deeplinking implementation. I've tried to work backwards from a QA testing doc to add new links. Can someone tell me if this is all ok? It seems to behave a little weird.
Dev: Looks ok, but we've moved to the braze platform for sending notifications. You'll need to trigger braze notifications now. Test that it works ok with that <confluence-link>
*hour later*
Me: I've tried the debugging tool, both with my payload and one of the samples from the link. It displays on the phone, but tapping it doesn't trigger the deeplinking.
Dev: No it works, try one of these <screenshot of samples I used>
*hour later*
Me: Tried it again on the real device to make sure, as well as on develop and master. Not working with those samples or mine.
Dev: No it does. It comes in here in this library <github link to line of code>
Me: ... Nope, debugged it, it doesn't get passed the next 'if' check on the next line as its missing a key/value. The whole function does nothing.
Dev: Oh do you want to send a braze notification?
Me: ..... you told me I had too .... yes I guess.
Dev: ok for a braze notification it works different, send this <entirely different sample no where on the link>
Me: ...... but ..... this is only for braze notifications ..... why .... all the samples have deeplink url's .... but they don't ....... are you ..... FFS!!!!! !@#?!
(╯°□°)╯︵ ┻━┻
┻━┻ ︵ヽ(`Д´)ノ︵ ┻━┻
(ノಠ益ಠ)ノ彡┻━┻
┌П┐(ಠ_ಠ)1 -
The man who runs my IT department. The man who is in charge of all things and people that are technical: IT management software development, infrastructure, training, help desk, system administration, etc. A man with a staff of fifty plus. If you were to peel back the flesh on this man's head and crack open his skull you would find dung beetles feasting on the feces that power his thoughts and motor functions. Underneath this foul membrane, if you could push past the maggots; the meal worms; his undying love for hourly binges of Johnny Walker Black on any day of the week with a name that contains a vowel; his fascination with shiny objects and his endless internal monologue wondering when they would hatch rainbow ponies that fly; his desire whenever he enters a paint store to open all the cans of paint and taste the different colors; if you could push past all of the vile crap that exists where Thomas Aquinas once theorized there was a soul, you would find a colony of paramecia at the end of their short lives laughing hysterically at how much smarter they were than the host they lived in.
This man was in charge of hiring the Manager of Software Development. The manager I report to. After seven months of ignoring this chore; after interviewing the sum total of four candidates; after making a point to tell myself and a colleague that there was no one qualified to fill this position within our company (an opinion that is both untrue and, when spoken, runs afoul of internal hiring policies) this man hired a soulless cretin with no experience in software development or with running a software development group. A man who regularly confuses web servers and SQL servers. A man who asked me how my previous manager reviewed my work, was told by me that said previous manager read my code, and then replied in his capacity as the manager of software development that "looking at code is a compete waste of time for a manager." A man so without any humanity or reason for being that he will sit silently, creepily, in conference rooms with the lights off waiting for meetings to begin. Meetings he has scheduled. That have no reason for being in the first place. Just like himself.
Shortly before the man in charge offered the Dev Manager job to the simulacrum of human flesh that is my manager, he met with me and others who had been involved in the interview process. When I informed him that hiring someone with no technical knowledge for a very technical position would be a mistake that he would suffer through for years, he replied in reference to his future hire that "his managerial experience makes up for his lack of technical knowledge."
Best. Prank. Ever. Worst prank ever too. Fuck.6 -
Dev: “Ughh..look at this –bleep- code! When I execute the service call, it returns null, but the service received a database error.”
Me: “Yea, that service was written during a time when the mentality was ‘Why return a service error if the client can’t do anything about it?’”
Dev: “I would say that’s a misunderstanding of that philosophy.”
Me: “I would say it’s a perfectly executed example of a deeply flawed philosophy.”
Dev: “No, the service should just return something that tells the client the operation failed.”
Me: “They did. It was supposed to return a valid result, and the developer indicated a null response means the operation failed. How you deal with the null response is up to you.”
Dev: “That is stupid. How am I supposed to know a null response means the operation failed?”
Me: “OK, how did you know the operation failed?”
Dev: “I had to look at the service error logs.”
Me: “Bingo.”
Dev: “This whole service is just a –bleep-ing mess. There are so many things that can go wrong and the only thing the service returns is null when the service raises an exception.”
Me: “OK, what should the service return?”
Dev: ”I don’t know. Error 500 would be nice.”
Me: “Would you know what to do with error 500?”
Dev: ”Yea, I would look at the error log”
Me: “Just like you did when the service returned null?”
<couple of seconds of silence>
Dev: “I don’t know, it’s a –bleep-ing mess.”
Me: “You’re in the code, change it.”
Dev: “Ooohhh no, not me. The whole thing will have to be re-written. It should have been done correctly the first time. If we had time to do code reviews, I would have caught this –bleep- before the service was deployed.”
Me: “Um, you did.”
<a shocked look from Dev>
Dev: “What…no, I’ve never seen this code.”
Me: “I sat next to Chuck when you were telling him he needed to change the service to return null if an exception was raised. I remember you telling him specifically to pop-up an error dialog ‘Service request failed’ to the user when the service returned null.”
Dev: “I don’t remember any of that.”
Me: “Well, Chuck did. He even put it in the check-in comments. See…”
<check in comments stated Dev’s code review and dictated the service return null on exceptions>
Dev: “Hmm…I guess I did. –bleep- are you a –bleep-ing elephant? You –bleep-ing remember everything.”
<what I wanted to say>
No, I don’t remember everything, but I remember all the drive-by <bleep>-ed up coding philosophies you tried to push to the interns and we’re now having all kinds of problems I spend waaaaay too much time fixing.
<what I said, and lied a little bit>
Me: “No, I was helping Nancy last week troubleshoot the client application last week with the pop-up error. Since the service returned a null, she didn’t know where to begin to look for the actual error.”
Dev: “Oh.”1 -
Manager: How come the push to prod didn’t happen?
Dev: We told you at the scrum yesterday. To reiterate, our dev environment was crashing so it’s not safe to push to prod until that is fixed.
Manager: Ok well lets set a goal to fix that and push to prod happens today so that it guaranteed happens.
Dev: That was our goal yesterday and it definitely didn’t happen.
Manager: I AM AWARE OF THAT. The corrective action is that this time compliance with the goal is 100% ABSOLUTELY MANDATORY!!
Dev: We’ll do our best, can’t guarantee anything until we figure out what the nature of what is occurring on dev though.
Manager: NO. I AM THE BOSS. YOU WILL 100% ABSOLUTELY COMPLY WITH THIS. THAT IS AN ORDER. YOU WILL SUCCESSFULLY GET THIS UPDATE OUT TO PROD TODAY. ANYTHING LESS THAN THAT SHALL BE CONSIDERED INSUBORDINATION. I WANT STATUS UPDATES EVERY 15 MINUTES ON WHERE WE ARE AT WITH THIS.
Dev: …
Dev: Can I get you to send me that request in an email?
*Manager leaves the meeting*
// *****************************
Job search is ticking along. It’s tough going though because I currently make ~120k and the best offers I’ve received so far are all ~70k because “You only have 2 years experience so you couldn’t possibly have the skills to be worth 120k. You are are junior level developer and 70K is already overpaying for you. We can pay you more later™. No we will not give you that in writing”. Ah well, the hunt continues.17 -
It has to be the community. Just look at devRant - an open community where - unlike on the rest of the internet - people are friendly and warm. Then there's the concept of open source and GitHub, where people post large and complex projects for free and even the smallest of developers can create issues and pull requests (shouldn't they be called push requests though?) - no other profession will help others out in over 15 million different ways.5
-
- Hey it's lunch time!
- Yeah let me push these changes...
- No! You'll do it later.
- But, it will take 2 minutes!
- NO! WE'RE HAVING LUNCH NOW.
Windows crashes ._.3 -
Always the same story:
Marketing: hey I'm gonna do a demo to a customer. They were asking for feature XYZ. That's ready on thr staging server right? Do you think I could use the staging server for the demo?
Devs: well feature XYZ is not 100% done. Basically just feature X is done, and it still has a few bugs. The deadline ain't for another month, since we gotta finish ABC first. I guess you could use the staging, but it has a lot of bugs.
Marketing: perfect!
*after presentation*
Marketing: the staging had so many bugs! Why didn't you tell me?! It was so embarrassing showing it to new customers! Anyway, they loved the new feature. We need it to be ready ASAP.
Devs: What?! That's gonna mess up with our schedule. You know what? Fine, but feature ABC will have to wait another month.
Marketing: Well, it'd be ideal if we could do both...
Devs: Pay for more devs or dor extra hours.
Marketing: Just do XYZ. It's a pity that you'll have to push back ABC but it's fine, XYZ is more important.
(I might ask, if it was so important, why didn't you notice so in the meeting where we had decided that ABC would be prioritized?)
*tons of working hours later*
Devs: There, we finished XYZ.
Marketing: Yay! Wow, this month we'll have two major features done: ABC and XYZ!
Devs: No, ABC is not done yet.
Marketing: What? But the deadline was this week.
Devs: It was, but then you decided to prioritize XYZ and we said we had to push back ABC to get XYZ ready, and you agreed.
Marketing: Did we? Fine. But do it quick.
Marketing and their mood swings.5 -
Now, instead of shouting, I can just type "fuck"
The Fuck is a magnificent app that corrects errors in previous console commands.
inspired by a @liamosaur tweet
https://twitter.com/liamosaur/...
Some gems:
➜ apt-get install vim
E: Could not open lock file /var/lib/dpkg/lock - open (13: Permission denied)
E: Unable to lock the administration directory (/var/lib/dpkg/), are you root?
➜ fuck
sudo apt-get install vim [enter/↑/↓/ctrl+c]
[sudo] password for nvbn:
Reading package lists... Done
...
➜ git push
fatal: The current branch master has no upstream branch.
To push the current branch and set the remote as upstream, use
git push --set-upstream origin master
➜ fuck
git push --set-upstream origin master [enter/↑/↓/ctrl+c]
Counting objects: 9, done.
...
➜ puthon
No command 'puthon' found, did you mean:
Command 'python' from package 'python-minimal' (main)
Command 'python' from package 'python3' (main)
zsh: command not found: puthon
➜ fuck
python [enter/↑/↓/ctrl+c]
Python 3.4.2 (default, Oct 8 2014, 13:08:17)
...
➜ git brnch
git: 'brnch' is not a git command. See 'git --help'.
Did you mean this?
branch
➜ fuck
git branch [enter/↑/↓/ctrl+c]
* master
➜ lein rpl
'rpl' is not a task. See 'lein help'.
Did you mean this?
repl
➜ fuck
lein repl [enter/↑/↓/ctrl+c]
nREPL server started on port 54848 on host 127.0.0.1 - nrepl://127.0.0.1:54848
REPL-y 0.3.1
...
Get fuckked at
https://github.com/nvbn/thefuck10 -
My first dev job was a paid internship at Oak Ridge National Laboratory. But I wasn't in the computing division with the supercomputer and the 30-foot 18-screen wall display. In a way, I was doing something more exciting. I was in the Hollifield Radioactive Ion Beam Facility.
That meant that I was working next to a radioactive ray gun that they fired at different targets to try and make new kinds of particles. To refine the beam components, there was a tower with the world's highest voltage Van de Graf generator at 25,000 kilovolts. I got training on how to put on a radiation suit, and was told that if I got locked in the wrong room and red lights began to flash, I had about five seconds to run to the far wall and push the E-stop, before I got irradiated and died slowly over the next five weeks.
But, I was reassured, that never happened. Radiation leaks are rare too (that's why we wore dosimeters). More likely, there would be a leak in the generator tower. To explain why that's bad, that tower wasn't filled with normal air. 25,000 kilovolts would punch through that like nothing, arc against the walls, and we'd lose the electric charge. No, instead, the tower was filled to a few atmospheres of pressure with sulfur hexafluoride gas. You know how helium makes your voice go up? This stuff makes your voice go down. It's heavier than air, and it kills you by displacing and starving your lungs of oxygen.
So, while I was happily coding away on PHP, CSS and the Bash shell, making a log book for all the ion gun settings and targets the scientists used in their experiments, I was keeping an ear out for the oxygen alarm. I had a blast!2 -
I swear to god, I'm going to track down the dipshit who just made my day hilariously painful.
So here I am, finishing up this project that's been going on for what feels like an eternity, when I get an email "why doesn't order X show up in this other system?".
I mean, it's a common thing they can take 15 minutes to push across, so the usual quick glance and what do you know, it's just sitting there as if it's waiting to be pushed through, than an hour later... it's still there, so I start digging, maybe a data issue, nope looks all good, customer details, payment details, products...
just another order, jump on the logs and all looks fi......... wait.... why does this postcode have 3 digits and not 4 , Australia has 4 digit postal codes fyi, looks at order again, 3 digits, look at log, 3....hold on why's it only 3 digits, checks code, handled as string... ok..... where the fuck would it drop a digit.... frontend requires 4 digits, validation requires 4 digits... how the fuck did you get 3 digits in... I can't see anything anywhere that logically makes sense for this🤔
Drops address into google and it's a postcode starting with 0.
Jumps on DB and the fucker is an int in the postcode table. For all you playing at home 0123 <> 123
I don't know if I should feel bad, or impressed, it's been 7 years since this table was created, and 7 years before someone managed to live in one of these parts of the country with a leading 0.
QA didn't spot this years ago,
No one tested this exact scenario,
The damn thing isn't even documented as a required delivery area, but here we are!
Kudos good sir, you broke it! 🤜 🤛
You sir may get your order now!rant cover every possibility always suspect the unexpected my problem now! not my fault 😅 data how dafuq was that even missed11 -
Warning: JPEG artefacts incoming!
Dear Google,
you know exactly which languages I speak. So please explain to me why you still feel the need to push some random video titles and descriptions through Google Translate, making them look unprofessional and confusing me because I know that I watched that video already, but now it has a new title? And why is there no option to turn this off? And why do you explicitly state that the language setting does not affect text submitted by users? Even though it does? What the actual fuck?
Also lol even Google isn't perfect at using ecape characters correctly18 -
Last Friday company-wide call consisted of the sales CEO bossman, the remote contractor dev, and myself. The only topic of discussion was CTO-bashing (bossman's favorite). Neither person had much of anything to say about their week, and they didn't want to hear my rather-lengthy summary either (I did a lot). All they wanted to do was bash the CTO (API Guy).
The CEO asked how many hours I had worked, and seemed annoyed when I said less than 40. Well screw you. Monday was Christmas, and Sunday was Encroaching Estranged Asshole Day. (Earlier rant)
I've been spending most of my time trying to learn the steaming mountain of rancid hippo shit that API Guy squeezed out, since he's leaving forever in 10 days. Sure, CEO bossman says he'll still be around to answer questions, but even with him right next to me in the office he's less than useful. After he's gone and finally feeling free of this farce? It'll be worth fuck-all.
So bossman is mad at me for both not working enough over Christmas, and not pumping out features at a frantic pace despite multiple explanations of why this is a bad idea. And he didn't care about what work I actually did do.
My every interaction with him makes me angry. Whenever I -- or anyone else -- does something he doesn't approve of, seemingly no matter the reasoning, he makes it out to be a failure on their part, and like he can't trust them as much now.
Well I'm sorry we're trying to make sure our websocket works perfectly before putting it in the hands of our customers who rely on it for cash processing.
I'm sorry I'm trying to recall printers that aren't configured properly, which also prevent customers from using our goddamn service they're paying for.
I'm sorry I'm trying to learn how everything works while I still have someone to talk to and ask questions of.
I'm sorry I'm preparing for the day I have to take over and have you breathing down my neck. Once API Guy's gone I'll be responsible for everything, and you'll be yelling at me and having a @Root bashing session instead if I don't know how to fix everything right away.
But no. All you care about is that I talk to you about what's going in so you can micromanage development despite having zero fucking understanding of goddamn anything. All you ever fucking want is the next shiny feature you can push to make more sales / keep your current contacts happy. Doesn't fking matter if it makes development awful later; that's tomorrow's problem. And yet you have the gall to bash API Guy over and over and over again for the codebase being a mess? Sure he's a terrible programmer, but been putting up with this exact same shit for five years. No wonder it's a mountain of rancid hippo shit. That's as much your fault as his, asshole.
I'm so sorry you "have serious concerns" about me. I don't want to put up with your shit either.
Fuck off and die.22 -
!!office drama
I haven't been around much in recent weeks. Due to family illness, christmas shopping, dealing with estranged parents, and brooding over the foregoing, I haven't had a lot of time or energy left to myself.
tl;dr: The CTO ("API Guy") is ostensibly getting fired, and I might be taking over his job. I don't know if I should accept, try to stave this off, or simply flee.
------
Anyone who has been following my recent rants knows that API Guy is my boss, and he often writes terrible code. It's solid and unbreakable, but reading it is a *nightmare.* One of our applications is half the length of Leo Tolstoy's War and Peace, and it's difficult to tell what code is live and what amounts to ancient, still-active landmines. This is one application; we have several, most of which I've never even looked at.
Ostensibly the code is so terrible because the company grew extremely quickly, and API Guy needed to cram in lots of unexpected / planned-against features. From what I can see, that seems about right, but I haven't checked timeframes [because that's a lot of work!].
Here's a brief rundown of the situation.
- API Guy co-founded the company with the CEO.
- CEO and API Guy have been friends for a long time.
- CEO belives the company will fail with API Guy as head of tech.
- They could just be testing me; I have zero way of knowing. API Guy seems totally oblivious, and CEO seems sincere, so this feels pretty doubtful.
- CEO likes pushing people around. CEO believes he can push me around. API Guy doesn't budge. (I probably won't, either, except to change task priorities.)
- API Guy's code is huge and awful, but functional.
- API Guy is trying to clean up the mess; CEO doesn't understand (maybe doesn't care).
- Literally nobody else knows how the code works.
- Apart from API Guy and myself, the entire company is extroverted sales people.
- None of these sales people particularly like me.
- Sales people sell and sell and sell without asking development if they can pull enough magic features out of their hat to meet the arbitrary saleslines. (because the answer is usually no)
- If I accept, I would be the sole developer (at first) and responsible for someone else's mountain of nightmarish code, and still responsible for layering on new features at the same pace as he. Pay raise likely, but not guaranteed.
- My getting the position is contingent upon the CEO and the investors, meaning it's by no means guaranteed.
- If I don't accept, likely API Guy will be replaced with someone else of unknown ability, who doesn't know the code, and whom I must answer to regardless. Potentially OK, potentially a monumental disaster.
Honestly, it feels like I'm going to be screwed no matter what course I choose.
Perhaps accepting is slightly better?
The best would be to assume the position of CTO and keep API Guy around -- but that would feel like an insult to him. I doubt he'd be okay with it. But maybe. Who knows? I doubt the CEO would seriously consider that anyway.
I feel like a lamb between a dim, angry rhino, and an oblivious one.23 -
Ticket: Add <feature> to <thing>. It works in <other things> so just copy it over. Easy.
Thing: tangled, over-complicated mess.
Feature: tangled and broken, and winds much too deep to refactor. Gets an almost-right answer by doing lots of things that shouldn't work but somehow manage to.
I write a quick patch that avoids the decent into madness and duplicates the broken behavior in a simple way for consistency and ease of fixing later. I inform my boss of my findings and push the code.
He gets angry and mildly chews me out for it. During the code review, he calls my patch naive, and says the original feature is obviously not broken or convoluted. During the course of proving me wrong, he has trouble following it, and eventually finds out that it really is broken -- and refuses to admit i was right about any of it. I'm still in trouble for taking too long, doing it naively, and not doing it correctly.
He schedules a meeting with product to see if we should do it correctly. He tells product to say no. Product says no. He then tells me to duplicate the broken behavior. ... which I already did.
At this point I'm in trouble for:
1) Taking too long copying a simple feature over.
2) Showing said feature is not simple, but convoluted and broken.
3) Reimplementing the broken feature in a simpler way.
4) Not making my new implementation correct despite it not working anywhere else, and despite how that would be inconsistent.
Did everything right, still in the wrong.
Also, they decided I'm not allowed to fix the original, that it should stay broken, and that I should make sure it's broken here, too.
You just have to admire the sound reasoning and mutual respect on display. Best in class.19 -
Best part of working from home? Oh boy, here I go
1. NO COMMUTE !! Fuck public transport. I can just grab my laptop straight to my bed, get comfortable and work in whatever posture I wish to.
2. Relaxation and peace of mind. The local park, library, football ground. I can go anywhere to get work done. All I need is my phone and laptop.
3. Better food - I can cook my own food. Dieting actually works by eating home-made food and not the fried bullshit we eat outside.
4. No office politics - Remote working means you don't have to think about being a circle and getting liked or not. Get your work done and that's it.
5. No "Extra" Activities - We all know HRs are just bored af people making employees have "fun" activities just to push a "culture" agenda on LinkedIn. Umm no thanks.
6. No toxicity - Well, this one is a doozie, you don't get workplace toxicity but you do get home toxicity. People assuming that you stay in ur room all day and do nothing. I'd still take home toxicity though.
7. If there is no work, I don't have to pretend that I am working and hiding my screen from my boss. I can just play video games in that time.
8. Option to start a side-hustle. You have more chances to retain some energy after your shift to start investing/putting time into something that can make you extra cash.
9. Worldwide opportunities - Because of WFH, I work with clients from Netherlands, Estonia, London and Cayman Islands. It never would have happened if I was in an office job.
10. Only work, no extra bullshit - be it smoke breaks, casual tea, conferences, work summits etc. None of that and I don't want it.
11. Your errands get done - Need to go to the dentist at 10 am? You can do that. Need to pick up your kid at 3 pm? You can do that. You need 5 pm time dedicated to go the gym? You can do that.
In conclusion, I absolutely vouch for WFH and would never take WFO for as long as possible.
WFH FTW !!!9 -
You know, there is so much of a push to get girls to start programming. You know what, the industry is doing just fine, and if a girl wants to get in, she can. Girls shouldn't be considered special, they shouldn't be given a handicap and no one should assume they are worse.
There is absolutely no money to be made in the "Girls who Code" push and people need to start seeing that they are polluting everything.
I just saw, on Shark Tank, some crappy version of the Sphero, which may be the biggest insult to a product, ever, that was basically a Barbie driving around and you can program it. I want to die.54 -
HR: Hey we heard about all of the apps you are building and we were wondering if you could build one for us too
Dev: Well I’d have to run it by my manager first, what kind of app were you looking to build?
HR: Ok basically it’s a button that when you press it it completes the list of daily tasks that normally take us all day everyday like payroll and attendance reporting.
Dev: You…. want me to…automate your entire job away?
HR: No! We would be the ones to push the button😡.
Dev: I….. I’ll…. I will pass that along.4 -
I spent an hour arguing with the CTO, pushing for having all our new products' data in the database (wow) with an API I could hit to fetch said data (wow) prior to displaying it on our order page.
He never actually agreed with me, but he finally acquiesced and wrote the migrations, API, and entered my (rather contrived) placeholder data. (I've been waiting on the boss for details and copy for three days.)
Anyway, it's now live on QA. but. I don't know where QA is for this app, and it's been long enough that i'm kind of afraid to ask.
Does that sound strange?
well.
We have seven (nine?) live applications (three of which share a database), and none of their repos match their URLs, nor even their Heroku app names. (In some of these Heroku names, "db" is short for the app's namesake, while in the rest it's short for "database").
So, I honestly have no idea where "dbappdev" points to, and I don't have access to the DNS records to check. -.-
What's more: I opened "dbappdev" on Heroku and tested out his new API -- lo and behold! it returns nada. Not a single byte. (Given his history I expected a 500, so this is an improvement, I think. Still totally useless, however.)
And furthermore: he didn't push the code to github, so I cannot test (or fix) it locally.
just. UGH.
every day with this guy, i swear.16 -
Github Inc. (Feel good inc. parody)
=========================
Ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha.
Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
(change) Fetch it (change), Fetch it (change), Fetch it (change), Github
(change) fetch it (change), fetch it (change), fetch it (change), Github
Repos breaking down on pull request
Juniors have to go cause they don't know wack
So while you filling the commits and showing branch trees
You won't get paid cause it's all damn free
You set a new linter and a new phenomenal style
Hoping the new code will make you smile
But all you wanna have is a nice long sleep.
But your screams they'll keep you awake cause you don't get no sleep no.
git-blame, git-blame on this line
What the f*ck is wrong with that
Take it all and recompile
It is taking too lonnng
This code is better. This code is free
Let's clone this repo you and me.
git-blame, git-blame on this line
Is everybody in?
Laughing at the class past, fast CRUD
Testing them up for test cracks.
Star the repos at the start
It's my portfolio falling apart.
Shit, I'm forking in the code of this here.
Compile, breaking up this shit this y*er.
Watch me as I navigate.
Ha-ha-ha-ha-ha-ha.
Yo, this repo is Ghost Town
It's pulled down
With no clowns
You're in the sh*t
Gon' bite the dust
Can't nag with us
With no push
You kill the git
So don't stop, git it, git it, git it
Until you're the maintainers
And watch me criticize you now
Ha-ha-ha-ha-ha.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
git-blame, git-blame on this line
What the f*ck is wrong with that
Take it all and recompile
It is taking too lonnng
This code is better. This code is free
Let's clone this repo you and me.
git-blame, git-blame on this line
Is everybody in?
Don't stop, shit it, git it.
See how your team updates it
Steady, watch me navigate
Aha-ha-ha-ha-ha.
Don't stop, shit it, git it.
Peep at updates and reconvert it
Steady, watch me git reset now
Aha-ha-ha-ha-ha.
Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.2 -
Sometimes I have really loose the will to live and find myself face palming multiple times.
I added live chat software a web frontend for a client. Very easy job that consisted of pasting in some embed code. The actual software is very good and has native ios/andriod apps - something specifically requested.
I got a call from my client about an hour ago, saying there is a "serious issue with the live chat".
My client stated the live chat won't work when his staff go home. He asked me what my solution to this was.
Saying "wtf" many times to myself I directed him to a settings within the chat software i.e. an "away mode" where an email is sent when no chat agents are available.
This apparently wasn't good enough and said I hadn't followed his brief of "adding life chat software to the website", which I had.
After a lengthy discussion I found the root of his frustration. He'd signed a contract with a client of his own, stating there would be 24/7 support via live chat on the website.
Obviously there a huge difference between adding a chat widget to a website and committing to having it manned 24/7 :)
After a further 10 minutes of trying push the blame on myself, the client insisted of having the chat software "appear" as someone was always online, even when they are not (people need to sleep ya know!).
Bu design, the chat software requires at least one agent be logged in before the chat status changes to "online" - why wouldn't it.
After a little while I was seriously wondering why I'm involved in this conversation. I jokingly stated: "Well you could always install Andriod/iOS app on your phone, login and permanently leave it running in background. You'd get lots of notifications, but the site would say the live is always online".
The latter was something I said in jest. To my surprise the client said he'd do that on his own phone going forwards. He actually thanked me for my "resourcefulness", lol.
I'm looking at the same dashboard now and there are 407 pending chat requests - his phone must literally be blowing up notifications :)5 -
I started to get super pissed off to people saying you don’t need a college, masters degree to get an IT job. Instead go and gain practical knowledge, showing your practical certificates projects is much better than a having a degree that doesn’t prove if you can do the job or not.
Is a degree absolutely necessary to get a job? No, I agree on that. You can tear yourself apart to be known make projects loads of people contribute in GitHub spend maybe years on practicing and creating stuff for your portfolio..
But excuse me what do you think people do in college studying degrees? Are we getting it from the shop in the corner on a Saturday?
Respect people’s achievements and titles. Especially Masters degrees push you hard, make you sweat apart from loads of courses you work at least a year on a practical project, dissertation, thesis and only pass if it is your own opinion and findings. It is not like a multiple choice exam certificate or you study watch videos for few months and create a web page.
Don’t throw shit on people’s efforts and accomplishments without knowing how it is achieved just because you don’t have it.
Yes it is not necessary. Does it make you learn? Yes! Is it practical? Yes! Does it help you get a job? Hell yes! Why most companies look for degrees? Do you think they might know what it takes to get it and the skills and knowledge you gain?
Don’t come and say in IT degrees not worth it without even knowing how to draw UML. Without knowing IT management you go and be a leader later on, no clue on how to manage projects, people and soft skills sweeping the floor.
It doesn’t matter if you are a YouTube celebrity or a president. What does the title say? “Master” now go, respect and digest it! Don’t be a sour loser.
Ooh I am fierce today and not done yet12 -
The brief history of Facebook open source:
- FB releases React under an oppressive licence that tells "woopsie, can't sue FB if you use React"
- a lot of money goes into making React popular to gain leverage from mass adoption
- VMware bans React in their company
- FB releases Flux to bring state management. It flops. Replaced by what some Russian student wrote in several evenings (Redux)
- Preact is released. It's faster than React, and it has MIT licence. Vue beats React in GitHub stars.
- Under mass pressure, FB changes React's licence to MIT. Initial plan to gain leverage fails spectacularly.
- FB releases Flow Types. It flops. Replaced by TypeScript.
- FB releases their own app market for React Native. It flops.
- FB releases Relay. It flops. Replaced by Apollo.
- FB tries to push React.Suspense for the whole JS landscape to obey and comply to how it works. Community says "Fuck You".
- FB releases react-native-web. It flops.
- Web Components are out in all browsers, adopted as a standard. React doesn't support them.
- Google releases Lit, a virtual DOM framework on top of Web Components to fuck with React. It's a massive success.
- React 18 is out. Still no Web Components support.
- (you are here)17 -
I'm a tech lead for a digital agency.
Digital agencies are universally known for being shite. Why? Because they typically push through sub-optimal code with very little testing over tiny deadlines for maximum profit. Maybe I've just had bad experiences but this is the 5th digital agency that I've worked at that does this bollocks.
I am currently sitting on a Teams call at 8:39pm because the fuckwit project/account managers are unable to face up to the big scary client and ask them terrifying questions like "Is this bug a blocker for the deployment?" or "We don't have enough time to fix/change these things, can we delay another day?". They just assume that A - We will work into the evening, and B - that all the issues are P1 and that we should all 'pull together' as 'team players' to get this done in time.
No, Me and my team have to work into the evening for seemingly free because these pricks can't do their jobs properly.
The funniest thing of all? When I speak to the CTO about overtime payment he tries to make me feel bad about "we don't typically pay for overtime..."
Fuck Everyone.
Time to find a new contract.11 -
WASM was a mistake. I just wanted to learn C++ and have fast code on the web. Everyone praised it. No one mentioned that it would double or quadruple my development time. That it would cause me to curse repeatedly at the screen until I wanted to harm myself.
The problem was never C++, which was a respectable if long-winded language. No no no. The problem was the lack of support for 'objects' or 'arrays' as parameters or return types. Anything of any complexity lives on one giant Float32Array which must surely bring a look of disgust from every programmer on this muddy rock. That is, one single array variable that you re-use for EVERYTHING.
Have a color? Throw it on the array. 10 floats in an object? Push it on the array - and split off the two bools via dependency injection (why do I have 3-4 line function parameter lists?!). Have an image with 1,000,000 floats? Drop it in the array. Want to return an array? Provide a malloc ptr into the code and write to it, then read from that location in JS after running the function, modifying the array as a side effect.
My- hahaha, my web worker has two images it's working with, calculations for all the planets, sun and moon in the solar system, and bunch of other calculations I wanted offloaded from the main thread... they all live in ONE GIANT ARRAY. LMFAO.If I want to find an element? I have to know exactly where to look or else, good luck finding it among the millions of numbers on that thing.
And of course, if you work with these, you put them in loops. Then you can have the joys of off-by-one errors that not only result in bad results in the returned array, but inexplicable errors in which code you haven't even touched suddenly has bad values. I've had entire functions suddenly explode with random errors because I accidentally overwrote the wrong section of that float array. Not like, the variable the function was using was wrong. No. WASM acted like the function didn't even exist and it didn't know why. Because, somehow, the function ALSO lived on that Float32Array.
And because you're using WASM to be fast, you're typically trying to overwrite things that do O(N) operations or more. NO ONE is going to use this return a + b. One off functions just aren't worth programming in WASM. Worst of all, debugging this is often a matter of writing print and console.log statements everywhere, to try and 'eat' the whole array at once to find out what portion got corrupted or is broke. Or comment out your code line by line to see what in forsaken 9 circles of coding hell caused your problem. It's like debugging blind in a strange and overgrown forest of code that you don't even recognize because most of it is there to satisfy the needs of WASM.
And because it takes so long to debug, it takes a massively long time to create things, and by the time you're done, the dependent package you're building for has 'moved on' and find you suddenly need to update a bunch of crap when you're not even finished. All of this, purely because of a horribly designed technology.
And do they have sympathy for you for forcing you to update all this stuff? No. They don't owe you sympathy, and god forbid they give you any. You are a developer and so it is your duty to suffer - for some kind of karma.
I wanted to love WASM, but screw that thing, it's horrible errors and most of all, the WASM heap32.7 -
A day in the life of BoyBiscuit.
PM: Please zip up any local changes and push them to a temp folder on the repo and I will manually check to see what you have changed.
Me: *glaring at the download as zip button*
PM: Who broke the repo?
Me: *checks commit history*
Commit History: *last commit PM*
Me: Could you add the files to your commit before pushing because you've only pushed changes on tracked files.
PM: No not possible, I did 'commit -a'.
Me: ....
PM: Could you all delete your forks so that It isn't anywhere on the web
US: but it's private with only us as collaborators
PM: No because I can see it
Me: srysly?
PM: Could everyone try to write more effective code?
Me: Looks at his code
Code: Boolean b = getbooleanVal ? True : False;
Tl;Dr: PM doesn't know anything about git or working as a team.
See you tomorrow!1 -
Today as my friend left for lunch, I opened his code, and changed all the ';' (semi-Colon) to ';' (Geek Question Mark). It's been 10+ hours, still no push from his side on the repo, called him... He is still stuck on the same.. and I won't tell him.
I am a horrible person. 😂8 -
Young colleague: help me! My pc won't turn on!
Me.goto(colleague.desk)
Y. Colleague: See? I pushed the button and it didn't turn on!
Me: Have you tried push it a second time?
Y. Colleague:... No....
Me.push(start_button)
Pc turning on..6 -
cw: I need a server to put my node backend
me: sure, I'll run a docker container for you
cw: nice, I've never worked with docker but I learn quickly, I'm already reading the Docker file docs
me: no wait, you don't need to learn anything, you'll be inside the container, so you only need an ssh connection and that's it
cw: this Dockerfile stuff is really complicated, it'll take me a while, but it's ok you don't have to worry, I like learning new things
me: you won't need that, just imagine it's a cloud server with Ubuntu installed, you only have to use it, I'll put node, git and ssh there for you
cw: ok got it, I'll have to learn the commands to run the docker, I'm on windows but I can use PowerShell and stuff I'll figure it out
me: ...
cw: ssh is a linux command right? does it have a push or publish option? how do you upload files there
me: ...you can use a ftp client but you'll need ssh to run the node server
cw: ok, I'm almost done with the Dockerfile, I only need to add git and nodejs, I'm starting to understand this thing...
me thinking: yeah keep doing that, you're such a crack, such a quick learner...
This son of a bitch is either a retard or is doing it on purpose and laughing at me the whole time, making my life so miserable, but I'm about to go insane with this dude, I'm proud of how I've been able to control myself, BUT ONE OF THESE DAYS I'LL LOSE MY COOL AND FORCE THIS MOTHERFUCKER TO DRINK A BIG POT OF BOILING, SALTY AND STINKING VOMIT WITH A SIDE OF STEAMING DIARRHEAL GREEN DOG SHIT WITH WHITE CHOCOLATE CHIPS WHILE I PUT MY OLD CRT MONITOR TO GOOD USE BY BEATING HIS FUCKING HEAD WITH IT!!!3 -
"LeT's uSe gRaPhQL!" They said.
"It EliMinAtEs cOmpLeX aNd vErBoSe REST coDe!" they said.
Me sitting here for hours waiting for the backend team to fix major regressions every time they push the smallest "updates" to staging... 🤡
Call me a boomer but I can't help but feeling graphQL makes things MORE complex than REST... either that or the backend devs have no idea what they are doing17 -
I'm a lead Dev on an agile team. We were just handed a fixed scope, fixed date project. On Monday, instead of helping push this out, I get to have a meeting to explain how throwing more bodies at it will slow us down.
"No! We are not code monkeys! Knowing JS and Java isn't the same as knowing our application. Stop fantasizing that it's a simple manpower issue and leave us alone so we can work these fucking nightmare timelines in peace!!"
I'm looking for a better way than that to explain it to the Sr management for the business so I don't get fired.16 -
Developer confession.
I always git push a new branch even though I know it will error as there's no upstream, just to copy the full git push with set upstream arguments from the error message.11 -
It was when I ditched React. I replaced it with raw JavaScript, with frontend being built with Gulp and Twig (just because HTML has no includes). Here are the results:
1. Previously, a production frontend build took 1.5 minutes. Build time became so fast that after I push the code, the build was done before me going to Netlify to check build status. I go there, and it’s almost always already done.
2. In a gallery with a lot of cards, with every card opening a modal, the number of listeners was reduced from N to one. With React, I needed 1000 listeners for 1000 cards. With raw JavaScript, I needed just one click listener with checking event target to handle all of the cards.
3. Page load time and time-to-interactive was reduced from seconds to milliseconds.
4. Lighthouse rating became 100 for desktop and 93 for mobile.
But there is one more thing that is way better than all of the above: cognitive complexity.
Tasks that took days now take hours. Tasks that took hours now take minutes.
Tasks that took thousands of lines now take hundreds. Tasks that took hundreds of lines now take tens.
In real business apps, it is common to build features and then realize it’s not needed and should be discarded. Business is volatile, just because the real world is volatile too. With this kind of cost reduction per feature, it became way less painful to discard them. Throwing out something you spent time and emotional resource on doesn’t feel good. But with features taking minutes to build, it became easier.25 -
Today on forgotten games – Ballance.
The game is absolutely outstanding. Graphics is absolutely amazing even though the game was developed in 2004. The sound effects are perfect, I can literally feel the wooden ball rolling on steel rails. The background music is also amazing, we're talking Alexander Brandon level here.
The game is about rolling the ball through the levels trying not to fall off. There are three balls: the stone one, the wooden one and the paper one, different in weight, velocity and momentum.
I admire the clever level design. It uses in-game map features in multi-purpose way, for example some levels use ball transformers (the things that transform the ball from one kind to another) as a trap for your ball to lose momentum. It even seems like that levels were designed by some crazy modders for advanced players, but they weren't, and traveling through them feels like you're a pro gamer playing custom levels.
Even though levels seem simple at first glance, they allow non-linear gameplay and different gaming styles.
The gameplay itself is pure meditation. But even though the concept seem straightforward – just follow the level and don't fall – it's not. You have to use all three ball types: there are air vents to fly above upon, which only paper ball can do, there are obstacles to push, which only stone ball can do, and so on.
For additional sonic satisfaction the levels even feature some metal domes that serve no purpose but to be bumped into just for making amazing gong sound.
I like it that when you get cocky and think like that's easy, I got this, the game quickly puts you into place. It basically says nigga you ain't shit, you got nothing on me.
Overall it's basically a mesmerizing travel through cleverly designed levels surrounded by relaxing music and outstanding graphics.
Definitely a must-have for mechanical keyboard gamers, it's a pure satisfaction playing this game with a great level of precision and control mechanical keyboard allows.
Search for "ballance widescreen fix" for modern displays support.10 -
the effort to get girls, and children for that matter into programming has been terrible. I never thought I could find something worse than code.org, but here it is: SmartGurlz (because what could be smarter than spelling your own gender wrong, right?). this was on shark tank and this lady was making robots to try to get girls into programming. they pretty much control dolls on wheels by means of scratch. it's terrible. first of all, how the fuck is that profitable? when a little girl wants to play dolls, what kind of girl wants to *program* it first. jesus, no kid wants that.
second, this girls who code thing makes me barf. the thought process for many organizations trying to push girls to code is "hmm, if we isolate girls and give them lower standards, then maybe they'll decide to go into a male-dominated industry," because, fuck logic right? idiocy is dreadful. lastly, what I hate most about so many of the girls coding organizations, is the fact that they have to embrace the stereotypes. almost every single one cares about "feelings" or something similar. its bullshit.
and don't get me wrong, women should have equal opportunity, but pushing them into stem fields isn't good. bias in the workplace is what we should be talking about, or other topics like women being paid less. trying to make girls interested in programming is complete bullshit, let them do what they want.
back to "SmartGurlz," I looked them up and they confirmed what I expected. the first thing I see? not anything related to programming whatsoever, but different dolls wearing different outfits. girls deserve something better, and shouldn't have to deal with organizations trying to push them into something they don't want to do.8 -
So I'm back from vacation! It's my first day back, and I'm feeling refreshed and chipper, and motivated to get a bunch of things done quickly so I can slack off a bit later. It's a great plan.
First up: I need to finish up tiny thing from my previous ticket -- I had overlooked it in the description before. (I couldn't test this feature [push notifications] locally so I left it to QA to test while I was gone.)
It amounted to changing how we pull a due date out of the DB; some merchants use X, a couple use Y. Instead of hardcoding them, it would use a setting that admins can update on the fly.
Several methods deep, the current due date gets pulled indirectly from another class, so it's non-trivial to update; I start working through it.
But wait, if we're displaying a due date that differs from the date we're actually using internally, that's legit bad. So I investigate if I need to update the internals, too.
After awhile, I start to make lunch. I ask my boss if it's display-only (best case) and... no response. More investigating.
I start to make a late lunch. A wild sickness appears! Rush to bathroom; lose two turns.
I come back and get distracted by more investigating. I start to make an early dinner... and end up making dinner for my monster instead.
Boss responds, tells me it's just for display (yay!) and that we should use <macro resource feature> instead.
I talk to Mr. Product about which macros I should add; he doesn't respond.
I go back to making lunch-turn-dinner for myself; monster comes back and he's still hungry (as he never asks for more), so I make him dinner.
I check Slack again; Mr. Product still hasn't responded. I go back to making dinner.
Most of the way through cooking, I get a notification! Product says he's talking it through with my boss, who will update me on it. Okay fine. I finish making dinner and go eat.
No response from boss; I start looking through my next ticket.
No response from boss. I ping him and ask for an update, and he says "What are you talking about?" Apparently product never talked to bossmang =/ I ask him about the resources, and he says there's no need to create any more as the one I need already exists! Yay!
So my feature went from a large, complex refactor all the way down to a -1+2 diff. That's freaking amazing, and it only took the entire day!
I run the related specs, which take forever, then commit and push.
Push rejected; pull first! Fair, I have been gone for two weeks. I pull, and git complains about my .gitignore and some local changes. fine, whatever. Except I forgot I had my .gitignore ignored (skipped worktree). Finally figure that out, clean up my tree, and merge.
Time to run the specs again! Gems are out of date. Okay, I go run `bundle install` and ... Ruby is no longer installed? Turns out one of the changes was an upgrade to Ruby 2.5.8.
Alright, I run `rvm use ruby-2.5.8` and.... rvm: command not found. What. I inspect the errors from before and... ah! Someone's brain fell out and they installed rbenv instead of the expected rvm on my mac. Fine, time to figure it out. `rbenv which ruby`; error. `rbenv install --list`; skyscraper-long list that contains bloody everything EXCEPT 2.5.8! Literally 2.5 through 2.5.7 and then 2.6.0-dev. asjdfklasdjf
Then I remember before I left people on Slack made a big deal about upgrading Ruby, so I go looking. Dummy me forgot about the search feature for a painful ten minutes. :( Search found the upgrade instructions right away, ofc. I follow them, and... each step takes freaking forever. Meanwhile my children are having a yelling duet in the immediate background, punctuated with screams and banging toys on furniture.
Eventually (seriously like twenty-five minutes later) I make it through the list. I cd into my project directory and... I get an error message and I'm not in the project directory? what. Oh, it's a zsh thing. k, I work around that, and try to run my specs. Fail.
I need to update my gems; k. `bundle install` and... twenty minutes later... all done.
I go to run my specs and... RubyMine reports I'm using 2.5.4 instead of 2.5.8? That can't be right. `ruby --version` reports 2.5.8; `rbenv version` reports 2.5.8? Fuck it, I've fought with this long enough. Restarting fixes everything, right? So I restart. when my mac comes back to life, I try again; same issue. After fighting for another ten minutes, I find a version toggle in RubyMine's settings, and update it to 2.5.8. It indexes for five minutes. ugh.
Also! After the restart, this company-installed surveillance "security" runs and lags my computer to hell. Highest spec MacBook Pro and it takes 2-5 seconds just to switch between desktops!
I run specs again. Hey look! Missing dependency: no execjs. I can't run the specs.
Fuck. This. I'll just push and let the CI run specs for me.
I just don't care anymore. It's now 8pm and I've spent the past 11 hours on a -1+2 diff!
What a great first day back! Everything is just the way I left it.rant just like always eep; 1 character left! first day back from vacation miscommunication is the norm endless problems ruby6 -
Assigned to a new project team..
Using git, in a creative way. So.. "master" is "dev" branch, usually. Everyone can push their branch to dev server .. so it's "dynamic for us". Production branch is whatever, as long as the branch has the release version. Sometimes, the release comes from "master".. that mean "dev" in normal geek..
That's just Git. The source code is a saturated spagetti of Entity framework and Caliburn. It is littered with antipatterns, especially basebean. Holy Christmas and Easter that baseclass do a lot of stuff that has no place as a base class ..
Fucking frameworks, I'm gonna start to evangelize frameworks as the no1 antipattern.
MS SQL as the main DB, but is dumped to json FILES through a scheduled task to increase read performance on web.
There is a soap endpoint to expose the json files, fml..
I am assuming I was placed here to improve stuff, I have never in my life seen anything like this before.
There is a special place in hell for this repository7 -
Why do people have to lie? I am seriously getting tired of it.
Context: While I was on vacation the company hired some guy we’ll call Bob.
Bob is a senior with 10+ years of experience. 5 of those years in React (supposedly).
I got back from vacation and was told I’d be working on a project with Bob.
I’ve worked in teams before so I thought no problem.
Now I am aware that different people have different styles, so that’s why we agreed on a lint config with some fancy git hooks.
I was excited at first because the project actually seems nice, but my excitement soon turned into terror.
First of all, Bob doesn’t seem to understand Git…fair enough, I’ll give him a quick guide…
Mf calls me at 11pm on a Friday because he can’t push because the tests are failling.
Now tests. Bob doesn’t write those. Great.
We had created a few components to use throughout the project.
Bob seems to consistently forget what components are and why you write them and just imports the defaults from the UI library we’re using.
Bob also has a kink for hardcoding values for some reason.
I talked to Bob multiple times about this and he just tells me he’ll change it but in the end the PR stays open for 5 days, before it’s actually me who goes in and fixes it. Oh and yeah this shit keeps happening over and over again.
Now I know some of us devs hate meetings but for the love of God Bob just show up. You don’t even have to speak. Or at least answer a message that corresponds to the working hours and not in the middle of the night.
I am getting tired of this behavior and am seriously holding back from reporting this to the management. It’s been a month and I am seriously worried about the project. I have my own stuff to do but it takes time for me to clean up his absolute mess that doesn’t even pass the CI.
Call me an asshole I don’t care. It’s been a month and I’m legit worried about the future of the project.20 -
So yesterday evening I was going to play some games. Checked NVIDIA and saw new update (no beta). So I went to install it and it literally fucked up my graphics card.
One monitor stopped working instantly and the other one got this old tv effect like when you had no signal.
Took me two hours to downgrade to my old drivers because I couldn't fucking see shit.
PLS NVIDIA DONT PUSH NEW DRIVERS IF YOU FUCKIN NOT TESTED THEM11 -
Deadline is tomorrow as per this rant
https://devrant.com/rants/1363701/...
I taught my boss how to work his way around spring-boot + maven + jpa, I did a really good job with the classes and interfaces so he could update the project while I was on my two week vacation.
I set up CI/CD so no one should have to ssh into servers to make master branch live and I set up webhooks on gitlab to warn me on slack if anyone pushed any code.
Tomorrow is the deadline.
Tomorrow is the last day of my vacation.
No pushes made to gitlab, hence no deployment trigerred.
I'm here wondering if the fucker will push it on the last minute just to fuck it up tremendously.
Tomorrow I'm going to the movies and gonna turn my phone off :)4 -
Who the fuck came up with the idea of using SharePoint? What it even is?! Is it a website, wiki, document repo...?
Our version seems to be a broken wiki with no info content, old links, illogical navigation. And somehow word documents are integrated into it. Sometimes you see some weird calendar and timelines (from old projects). You can navigate into a folder, but you cannot get back. There's no ".." button?? You can map it like OneDrive to yourself, but Windows doesn't support any document version control. Where's the check in/out option from explorer menu??? I sure as shit have those for SVN, GIT etc. Is there a new version created everytime I press ctrl-s or only when I close the document?
Well, I could open the document in "online" mode. Ok, the formatting goes weird and everything is super slow. But at least I can fuck up someone elses document by accidentaly copy/pasting stuff, deleting lines, hitting my face into keyboard etc. There's automatically new version added!
Somehow you can enable the forced check in/out for documents. Obviously only the library admin can do that. And since he's just a program manager, he has no clue what the fuck is version control or document management. So he has this thing on his "things to do" list. For him, document management means sending various spec versions as email attachments. And the developers can figure out together who has the most recent one.
How did M$ push shit piece of shit to corporations? They even use this crap for the intranet making it slower than creation of galaxies. Though it's ok, since you cannot find anything from the intranet. It's all just head honchos blogs, seasonal greetings and stock market statuses. Nowhere is seen the downstairs cafeteria menu for the day. Or where to report for broken toilet. You know, stuff that 99% of people would like to see.
I complained to M$ about the SharePoint, but apparently there's no problem. You can code it yourself? Yeiii! So, instead of just updating some line in design spec, I have to take a 3 month class and get a MS sertificate, code some class-based-web-shit for 6 months and maybe, maybe then I can make the page/document look normal?
I am thinking, that I will just start writing my specs on paper. I will put them on the shelf and if you want to read it, you will check it out manually. And if someone else tries to edit it while you are editing it, you just cover the paper with your hands. There might be a requirement to make the document look more like MS Word, but that's easy to do. Just go to WC with the paper and wipe with it a couple of times.9 -
- Be me (Dev)
- Develop website for client that has an online payment integration.
- Notice there is no one for QA and testing.
- Try to raise voice about it but get shot down by management.
- Get order to push the project to production (because the deadline has arrived, therefore the project must be ready)
- Production performance has an error margin of 15% (customers getting their card over/under charged)
- Get blamed and flamed for everything cuz well, its all the dev's fault.
FML4 -
It is once again that time of year when we say farewell to our current interns and say hello to a brand new batch.
The two groups overlap for a few days. During this time the old interns show the new interns the ropes, while the mentors silently weep in the lunchroom having realized that nothing that they've said over the last 12 months has had any effect whatsoever.
Some choice quotes:
---
New Intern: It says 'uncaught exception'.
Old Intern: Oh don't worry that will fix itself on production.
---
OI: Did you pull the code?
NI: Yeah, but I have all these weird brackets everywhere... [merge conflict]
OI: Oh yeah that happens sometimes, just delete them.
---
NI: It says "push to master rejected". [we enforce code reviews]
OI: Ohh that means the server is broken. You should tell someone, they have to reboot it.
---
NI: Where did that file save to? [we use ONLY macOS and Linux]
OI: C:\Users\<your name>\My Documents\...
---
OI: You can use either pgAdmin or MySQL Workbench. I like Workbench better but I couldn't get it to work, it kept giving me errors.
---
And of course...
---
OI: No, we don't use Linux. We use CentOS.
---
I did the math today. Only 35 more years and I can retire.5 -
Just looked at my emails for the first time since 23rd (self imposed blackout to get some rest) and found an email chain from a co-worker and a client.
At 5.30pm on Fri 23rd (half an hour after our usual quitting time) we got an email from a client who has taken 2 years to write content for their 10-page website, asking us if we could push the website live.
My colleague succinctly replied with "No. Best Regards, [name]" and then replied to just the company with a photo of him grinning and holding a beer.
Merry Christmas! -
I'm writing my bachelor thesis in LaTeX. As people who use LaTeX might know, it generates shitloads of files while compiling (like 10 files per .tex file).
To unclutter my project folder, I wrote a simple one-liner bash script that deletes all files which are not .tex or .bib files (literature references) and of course it will not delete itself (although that one also took me longer to figure out why my script 'kept disappearing for no reason after I ran it' than I'd like to admit).
However, I forgot that images are also files which are stored in the project-folder.
And this is how I suddenly lost all of my images for no reason at all, resulting in my PDF not building anymore. Luckily we all commit and push all regularely, right...
Edit: I just figured out that I'm even stupider than originally thought... My .gitignore ans more importantly, the '.git' folder also neither end in .tex nor .bib. Guess I'll just go fuck myself.10 -
I've been lurking on devrant a while now, I figure it's time to add my first rant.
Little background and setting a frame of reference for the rant: I'm currently a software engineer in the bioinformatics field. I have a computer science background whereas a vast majority of those around me, especially other devs, are people with little to no formal computer background - mostly biology in some form or another. Now, this said, a lot of the other devs are excellent developers, but some are as bad as you could imagine.
I started at a new company in April. About a month after joining a dev who worked there left, and I inherited the pipeline he maintained. Primarily 3 perl scripts (yes, perl, welcome to bioinformatics, especially when it comes to legacy code like is seen in this pipeline) that mostly copied and generated some files and reports in different places. No biggie, until I really dove in.
This dev, which I barely feel he deserves to be called, is a biology major turned computer developer. He was hired at this company and learned to program on the job. That being said, I give him a bit of a pass as I'm sure he did not have had an adequate support structure to teach him any better, but still, some of this is BS.
One final note: not all of the code, especially a lot of the stupid logic, in this pipeline was developed by this other dev. A lot of it he adopted himself. However, he did nothing about it either, so I put fault on him.
Now, let's start.
1. perl - yay bioinformatics
2. Redundant code. Like, you literally copied 200+ lines of code into a function to change 3 lines in that code for a different condition, and added if(condition) {function();} else {existing code;}?? Seriously??
3. Whitesmiths indentation style.. why? Just, why? Fuck off with that. Where did you learn that and why do you insist on using it??
4. Mixing of whitesmiths and more common K&R indentation.
5. Fucked indentation. Code either not indented and even some code indented THE WRONG WAY
6. 10+ indentation levels. This, not "terrible" normally, but imagine this with the last 3 points. Cannot follow the code at freaking all.
7. Stupid logic. Like, for example, check if a string has a comma in it. If it does, split the string on the comma and push everything to an array. If not, just push the string to the array.... You, you know you can just split the string on the comma and push it, right?? If there is no comma it will be an array containing the original string.. Why the fuck did you think you needed to add a condition for that??
8. Functions that are called to set values in global variables, arrays, and hashes.. function has like 5 lines in it and is called in 2 locations. Just keep that code in place!
9. 50+ global variables/hashes/arrays in one of the scripts with no clear way to tell how/when values are set nor what they are used for.
10. Non-descriptive names for everything
11. Next to no comments in the code. What comments there are are barely useful.
12. No documentation
There's more, but this is all I can think to identify right now. All together these issues have made this pipeline the pinnacle of all the garbage that I've had to work on.
Attaching some screenshots of just a tiny fraction of the code to show some of the crap I'm talking about.6 -
Somewhere in a lonely break room
There's a guy starting to realize that eternal hell has been unleashed unto him.
It's two a.m.
It's two a.m.
The boss has gone
I'm sitting here waitin'
This desktop's slow
I am getting tired of fixin' all my coworkers' problems
Yeah there's a bug on the loose
Errors in the code
This is unreadable
Rubber ducky can't help
I cannot debug, my whole life spins into a frenzy
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
I'm falling down a spiral
Solution unkown
Disgusting legacy, ugly code
Can't get no connection
Can't get through to commit
Well the night weights heavy
On my confused mind
Where's the error on this line
When the CEO comes
He knows damn well
To keep his distance
And he says
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow4 -
Working on my Lenovo x1 carbon. Akku warning "less then 6%" appears. No problem, I will connect the cable just after I finished this function... "Will shutdown in a view moments" message appears. Ok, I connect the cable. Nothing happens. Maybe power adapter is broken or something more worst. Panic. Try to commit and push as fast as I can (around 2000 LOC from today, made big changes on my project today). While pushing to github laptop powers off. Fuck. Check github on smartphone to see if commits had been pushed. No. I do not have a power adapter for replacement. FML.4
-
doNotMessWithITTeamInAFuckingProject();
Last night me with my team have a discussion with my project team. Currently we have a project for our insurance client building a Learning Management System. The project condition already messed up since the first day i join a meeting. Because since its a consortium project with multiple company involved, one of company had a bad experience with another company. It happened few years back when both of company were somehow break up badly because miss communication (i heard this from one of my team).
Skip..skip... And then day to day like another stereotype IT projects when client and business analyst doing requirements gathering, the specs seems unclear and keep changing day by day even when I type this rant I'm sure it will change again.
Then something happened last night when my team leader force our business analyst to re index the use case number (imho) this is no need to be done, and i know the field conditions its so tough for all team members.
So many problems occured, actually this is a boring problem like lack of dev resource, lack of project management and all other stereotype IT projects had. Its sucks why this things is happening again.
Finally my fellow business analyst type a quite long message in our group and said that he maybe quit because its too tired and he felt that the leader only know about push push pushhhhhy fcking pussy, he never go to the client site and look what we've done and what we struggle so far.
I just don't know why, i know this guy earlier was an IT geek also, but when he leading a team he act like he never done IT project before, just know about pushing people without knowing what the context and sound to me like just rage push!
Damnit, i maybe quit also, you know we IT guy never affraid to quit anytime from the messed up condition like this. Even though we were at the bottom level in a project, but we hold the most main key for development.
Hope he (my leader) read this rant. And can realize what happened and fix this broken situation. I don't know what to say again, im in steady mode to quit anytime if something chaos happen nearly in the future.
doNotMessWithITTeamInAFuckingProject();1 -
Our project schedule is quite full at the moment, we are basically at the limit for the next three months.
In comes one of our sales people: "Hey, can we squeeze in a little project, nothing fancy just a very basic static web page." (No question mark there, it was not a question...)
I say no, we are full, the deadline is to tight (3 weeks), can't do it.
In comes boss: "Sure you can, just push everything else back." (We won't change deadlines, what he actually means is for us to do unpaid overtime for two months so he can barocke make a few thousand extra bucks...)
So I cave and allow it. It were just 4 hours of work, we can squeeze it in, maybe do a little less R&D this month.
Next day, the project scope changed, suddenly we are not taking about 4 hours but 80. Sure, we can squeeze two extra weeks into the month.
That is when I realized, I don't hate my work, just my work environment.4 -
!dev (Please, don't take this very seriously, I'm kind of burnt out)
I'm not having a good time.
I can't even write a post to properly explain how I feel.
I feel disappointed by life and by myself in many levels. Life is disappointing. I am disappointing too.
I'm having issues to focus, can't even write a couple of lines of code.
Time to listen to some emo lofi and write about how much I hate myself.
I wished I didn't feel these feelings.
I wished I didn't regret so many things I did or didn't do.
I wished I could fucking understand everything I read, but I don't, everything I read is gibberish, every paragraph makes me feel like I'm drifting in a storm.
I wished I was happy with my career, with my job. I wished I had a true friend.
I wished I could finish one goddamn fucking project for once.
I wished there was something that made me unique, but I don't think there's any.
I just feel like an ant, and that I don't really matter.
I don't feel like I'm someone at all, I feel like I'm experiencing a dream, and a rather boring one.
Programming used to be challenging and fun for me, but it has become this dull and stressful ordeal.
The internet has shown me that I don't matter really. I remember being a little kid and believing that the internet would not discriminate you, that right from the comfort of your house you could connect to people and be cared for, and collaborate in something.
But every year that passes I see that I was wrong. I have tried to put in time into people, I have asked people how they're doing, I have cared for their projects. But there's no reciprocation.
The internet itself has become a thing where the big fish only matters. The top 1k users will get 99% of the attention.
Fuck nurture, rule competition.
What's the point of creating a github project that you think it's cool? No one will give two shits about it, it won't make a goddamn difference whether you push it or not.
You know what fucking matters? If you're an apple or google developer and have thousands of followers.
Bla, bla, bla, I'm depressed...9 -
I have a project at work that involves learning a bunch of AWS stuff and rewriting a couple credential-generating scripts. I don't even know what the ask is, apart from some high-level "make this SSO" so ... idfk.
I am so incredibly bored of it (and burned out in general) that I can't even look at it.
I would rather see how many times it takes to beat my head against the wall to make a hole than think about this ticket again.
"Oh, I thought you would find that fun" No. No I do not. I can't even bring myself to look at it anymore. "Well, try to push through it and get it outta here!" Ughhhhh
I hope Russia nukes the bloody company.10 -
Not actually a rant, but need some place to vent it out.
The company where I work develops embedded devices enabling the automobiles to connect to the internet and provide various end user infotainment services. My job mostly relates to how and when we update the devices.
There are about 100 different
variants of the same device, each one different from the other in a way that the process required to update for each of these device variants is significantly Different. Doing this manually would be and actually was a nightmare for almost everyone, so I set out on writing a tool that addresses this issue.
I designed my solution mostly in Python, allowing me for quick prototyping. First of all, I'd never written a single line of python code in my life. So I learn python, in matter of 2 nights. I took days off from work so I could work on this problem I had in my head. And in about 4 days, I was up with a solution that worked, reliably. I prepared a complete framework, completely extendable, in order to have room for 101th variant that might come in at any time. And then to make it easier and a no Brainer for everyone, the software is able to automatically download nightly builds and update the test devices with nothing more than a double click.
But apparently this wasn't enough. Today I found out that someone worked on a different solution in the background just a week ago, while reusing most part of my code. And now they start advertising their solution over mine, telling everyone how crappy my code is. Seriously, for fucks sake, my code has been running without issues since more than a year now. To make it worse, my manager seems to take sides with the other guy. I mean I don't even have someone to explain the situation to.
I really feel betrayed and backstabbed today. I worked my days, my nights, my vacations on this code. I put blood, sweat and tears into this. I push my self over my limits, and when that was not enough, I pushed my self even harder. But it all seems in vain today. All the hours that I spent, just to make it easier for everyone... All a complete waste. When you write code with such passion, your code is like your family... You want to protect it... But with all this office politics and shit, I seem to be losing my grip.
I've been contemplating the entire night, where I might have gone wrong, what could I've done to deserve this...but to no avail. I'm having troubles sleeping, and I'm not sure what I should do next.
Despair, sheer bloody Despair!8 -
This new junior dev was going pretty well, learning pretty fast and working pretty fast from when I talked to them, but I wasn't seeing his changes up on GitHub.
Me: Hey have you finished *feature X*
Junior: Oh yeah a few days ago.
Me: Why aren't your changes up on GitHub?
Junior: Sorry, my bad, im not used to pushing stuff during the development since i was used to do all of my stuff on my own
(No kidding!)
Me: ok then push them
Junior: Emmm... I don't think I should... I kinda already started working on *feature Y* so it's full of bugs...
I don't wanna be mad at them they're pretty good at their stuff, and he's got some good comments on the performance of the program. But UUGGHH 😠
Rookie mistakes I guess14 -
I'm a jr developer. I started off in automation testing and don't mind it but the testing codebase is cancer, doesn't follow basic Java conventions even basic naming conventions like camelcase, and the tests are super slow using hardcoded Thread.sleep(). Since the automation tests are not automated, I have to run manually. YES manually, every morning I wake up early at 7am to run the 2.5 hour long tests (7am because this before people get to work and when the application goes back online). I run this bitch and monitor them but most of them fail anyways. I also have to write a email report on the results which means I have to explain why shit is failing so I have to debug all this crap. This shit literally eats up an additional 2-3 hours of my work day everyday and the time is not even accounted for. ALSO, since it's running on my laptop, it makes my computer slow most of the day. If I have to debug, I can't have the browser be headless so fuckin chrome browsers be popping up every 2 minutes. I did this for legitimately 8 sprints until I decided enough was enough and bitched about it and the team told me I had no choice. I eventually got them to push towards automating it but it's still in progress so I'm still running this dumb shit. The contractors try to take advantage of me any way they can by giving me mindless bitch work they don't want and they know I don't usually say no since I'm a jr resource. I hate running the fucking automation tumor. Sometimes I go into the meeting rooms alone to scream.
I feel like I'm wasting my life away and not learning as much as I could somewhere else10 -
Always back up your data.
I came to my computer earlier today to find it on my Linux login screen. This could only mean one thing: something went horribly wrong.
Let me explain.
I have my BIOS set up to boot into Windows automatically. The exception is a reboot or something horrible happens and the computer crashes. Then, it boots me into Linux. Due to a hardware issue I never looked into, I have to be present to push F1 to allow the computer to start. The fact that it rebooted successfully, without me present, into *Linux*, could only mean one thing:
My primary hard drive died and was no longer bootable.
The warning was the BIOS telling me the drive was likely to fail ("Device Error" doesn't really tell me anything to be fair).
The massive wave of panic hit me.
I rebooted in hopes of reviving the drive. No dice.
I rebooted again. The drive appeared.
Let's see how much data I can recover from it before I can no longer mount it. Hopefully, I can come out of this relatively unscathed.
The drive in question is a 10 year old 1.5 TB Seagate drive that came with the computer. It served me well.
Press F to pay respects I guess.
On the bright side, I'll be getting an SSD as a replacement (probably a Samsung EVO).8 -
I've seen many devs doing crazy things in my entire career till now. But this one dude stands out.
He used to:
- Push binaries to git repo
- Use some old libraries which were used during Indus Valley civilization
- Had no sense of database and used to delete random data from it and call it as TESTING (Thank God! I never gave him prod access)
- And on top of this, he had an ass full of attitude!2 -
There was this uni project where the teacher gave us a project to work as a team (the entire class, 17 people). We were meant to use Scrum, and deliver the first release in 1 week.
Turns out no one except me did the work, and this went on in the upcoming sprints, even with me telling the teacher what was going on.
Then, one day, a girl (let's call her Rose) did a commit to git, and I thought that something as going to change...She committed and push a new line at the end of a file.
After 2 months, the project was done. I had done 4k+ lines of Java EE + Hibernate + JSP code (which was very difficult to me) and the grading came out. I got a 7... most of the rest of the class got an 8 or 9. They did nothing.
When questioned by me, teacher said (it was a group project...)
TL;DR: I did the work of 17 people in a university project, got the worst grade of them all.12 -
Inmates are trying to take over the asylum again.
Got a message from the web team manager deeply concerned because since switching to the new logging framework, the site is significantly slower.
She provided no proof or any data to what 'significantly slower' means.
#1 The 'new logging' has been in place and logging for 5 years. We only recently depreciated the ILogger interface ('new' ILogger interface only has 1 method instead of 5)
#2 The 'old logging' was modified 5 years ago, so even if you were using the 'old' interface, the underlying implementation is still the same.
She tried to push the 'it wasn't this slow before' argument, so I decided to do some fact based analysis.
Knowing they deployed their logging changes couple of weeks ago, I opened up AppDynamics, looked at the average call time to Splunk (along with a few other http calls they are doing)
- caching services - 5ms
- splunk - 30ms
- Order Service - 350ms
- Product Data Service -525ms
Then I look at the data they are logging, for the month of June, over 5 million messages. At 30ms each, that's almost 42 hours spent logging errors...yes errors. Null reference exceptions, Argument exceptions, easily fixable stuff.
So far for the month of July (using the 'new' logging), almost 2.5 million errors. Pretty close so far with June's numbers.
My only suggestion was to fix the bugs in their code so they don't log so many errors.
Her response.."Can we have one of our developers review your logging code? We believe we can find ways to optimize the http requests"
Oh good Lord. I'm not a drinking man..but ...I might start.1 -
I was asked to look into a site I haven't actively developed since about 3-4 years. It should be a simple side-gig.
I was told this site has been actively developed by the person who came after me, and this person had a few other people help out as well.
The most daunting task in my head was to go through their changes and see why stuff is broken (I was told functionality had been removed, things were changed for the worse, etc etc).
I ssh into the machine and it works. For SOME reason I still have access, which is a good thing since there's literally nobody to ask for access at the moment.
I cd into the project, do a git remote get-url origin to see if they've changed the repo location. Doesn't work. There is no origin. It's "upstream" now. Ok, no biggie. git remote get-url upstream. Repo is still there. Good.
Just to check, see if there's anything untracked with git status. Nothing. Good.
What was the last thing that was worked on? git log --all --decorate --oneline --graph. Wait... Something about the commit message seems familiar. git log. .... This is *my* last commit message. The hell?
I open the repo in the browser, login with some credentials my browser had saved (again, good because I have no clue about the password). Repo hasn't gotten a commit since mine. That can't be right.
Check branches. Oh....Like a dozen new branches. Lots of commits with text that is really not helpful at all. Looks like they were trying to set up a pipeline and testing it out over and over again.
A lot of other changes including the deletion of a database config and schema changes. 0 tests. Doesn't seem like these changes were ever in production.
...
At least I don't have to rack my head trying to understand someone else's code but.... I might just have to throw everything that was done into the garbage. I'm not gonna be the one to push all these changes I don't know about to prod and see what breaks and what doesn't break
.
I feel bad for whoever worked on the codebase after me, because all their changes are now just a waste of time and space that will never be used.3 -
Me: eh probably shouldn’t push to prod on Friday, maybe not even before the first...
Co worker: no balls
Me: -
One fine day, at work, I was doing one of my favourite things.
git push origin test:mainline
And it prompted for my credentials. I gave them and continued as per yooozh..
What I didn't realise then was that I had used my personal github credentials instead of my official account's!
Oops.
Day 3 - and no one has noticed yet...6 -
For the first time I am feeling like.... I hate my job.
Agile and Scrum can be fucked, but at least there is a work methodology. I was hired by a company being run the old school way.
These guys never heard of git??
- Fuck you. We never used git and neither should you.
Client company does not want to give me push/pull access to their gitlab instance??
- Fuck you, you can use our RDP server for that.
Project planning features be damned, they've got email, Teams and videocalls!
Can I develop in peace? Fuck no, I have to give IT support to the guy who hired me.
Our timeline is defined IN A FUCKING WORD DOCUMENT FOR FUCKS SAKE. I can't connect Issues to milestones in a Word doc
Oh, and the customer is running everything on prem. If there is a need to scale up, FUCK ME. I should have specified 20 machines from the get go or gtfo. We're using 2 machines to run 8 different services that are going to be ingesting and computing data.
They want state of the art on a cheapskate.
And I have nothing else lined up at the moment. Although I am soon to renew the contract... This contract binds me with professional responsibility for a project being ran by people who do not give a single fuck about optimizing the work process.3 -
So this is what happened!
It was a rainy Friday, I was asked to add a quick bug fix to a js application, I spent my Friday coding, testing ..., baam the patch is ready ... I wrote a nice commit message explains the problem and the fix but I didn't push the code.
On Monday the fuckin code disappeared, no commit no code no nothing no trace ... To be honest I don't know what happened. I rewrote everything on that Money morning (you can only imagine how pest I was)
I use vim with tmux.
I have done everything I could to figure out what happened to that commit, I even doubted If had did wrote the fix that Friday, but it's not possible to forget few hours of a day
I checked my commit history on the different branches i did everything
No trace ...
Conclusion
My machine is hunted ...
Or I have multiple personalities and one of them is a programmer and he is fucking with me5 -
Why dont people trust you?
I was hired to be an SQL developer, I don't actually get to do much development, normally doing something involving copying and pasting in Excel.
Some of our databases were running slow and we noticed some (a few hundred) indexes were in shit state.
I knocked up a couple of scripts, one to reorganise indexes that were up to a certain amount of fragmentation and one to rebuild the indexes
My boss wants them tested (they were several times in dev) we've had these for over 3 weeks, but she doesn't want to run them.
Instead of fixing hundred of indexes she decided I should contrate on fixing some historic data issues that are preventing 10 indexes from being rebuilt.
Now there are serious issues and the CTO is asking why the indexes haven't been fixed.
I could have done this nearly a month ago, but now it's turned into a huge fucki g deal, and no doubt they'll try and push it back on me5 -
Finally finished the screwdriver followup ticket. I think.
I spent almost two full days (14 hours) on a seemingly simple bug on Friday, and then another four hours yesterday. Worse yet: I can’t test this locally due to how Apple notifications work, so I can only debug this on one particular server that lives outside of our VPN — which is ofc in high demand. And the servers are unreliable, often have incorrect configuration, missing data, random 504s, and ssh likes to disconnect. Especially while running setup scripts, hence the above. So it’s difficult to know if things are failing because there’s a bug or the server is just a piece of shit, or just doesn’t like you that day.
But the worst fucking part of all? The bug appeared different on Monday than it did on Friday. Like, significantly different.
On Friday, a particular event killed all notifications for all subsequent events thereafter, even unrelated ones, and nothing would cause them to work again. This had me diving through the bowels of several systems, scouring the application logs, replicating the issue across multiple devices, etc. I verified the exact same behavior several times over, and it made absolutely no sense. I wrote specs to verify the screwdriver code worked as expected, and it always did. But an integration test that used consumer-facing controller actions exhibited the behavior, so it wasn’t in my code.
On Monday while someone else was watching: That particular event killed all notifications but ONLY FOR RELATED EVENTS, AND THEY RESUMED AFTER ANOTHER EVENT. All other events and their notifications worked perfectly.
AKL;SJF;LSF
I think I fixed it — waiting on verification — and if it is indeed fixed, it was because two fucking push event records were treated as unique and silently failing to save, run callbacks, etc.
BUT THIS DOESN’T MATCH WHAT I VERIFIED MULTIPLE TIMES! ASDFJ;AKLSDF
I’m so fucking done with this bs.8 -
auto.self.whatever.rant()
A few years ago, we had a lesson on git and stuff, and we had to create our first repository and push something on it to get familiar with the thing.
Our teacher jokingly said at the end "And always remember, no password in a repository!", and I thought to myself "who can be dumb enough to do actually do something like that?"
Now, guess which piece of shit had to reinstall two of his fucking servers because of security issues coming from not one but github repositories?4 -
My company has two offices in separate cities but they treat each the devs of each location very very differently.
In one office the devs get full power to experiment with whatever tech they want, they just stomp their feet and management gives em whatever they ask for, freedom of choice regarding anything they are working on, to be allowed to do greenfield work or experimental stuff
But in my office we are forced to do ONLY. Bug fixing and refactoring shitty code from over a decade a go, our tech is ancient and we are not allowed to to
Shit , anything we ask for is denied
And improvements to our process is shut down with the reasoning that whatever we got works so why meddle ??
For us , management is solely focussed on making sure we respond to support calls , deployments , configurations and little bug fixing. Basically they only care that we manage to finish for out next delivery.
No new work whatsoever!
If there is any hint of something new to to
Implemented the golden boys from the other office just stopm their feet tillmthey get it or just go off and start working on it then seek permission afterwards, with their much larger team they obviously get further than we do by the time management hears about it so they end up taking over the work since they already have more done already
My manager decided to push us to attend a company devCon to share ideas with our devs from our other location. This rapidly turned into a sour experience
Basically we do all shitty boring work which puts money on the table which goes straight to those idiots to play with...
They have the guts to laugh when we mentioned that we never get anything interesting to work on
Never seen so many of our devs looking up job sites on the bus back...
This is gonna blow up in management's face...2 -
Lots of talk about sexual equality in the dev community. Personally I work in a small team, equal mix of male and female. I can honestly say there was no bias towards hiring as I was the one who hired them all, I employed the people I work with because they were the best candidates.
Questions to you all - have you experienced bias in hiring? Have you seen 'positive discrimination' (hired because someone was female - not because they were the best person).
In the U.K. the media is saying there's a huge shortage of females in the sciences, I like to think there's a positive push to get more women into science, but what's the reality? What's you're experiences?61 -
Just had a fire at work.
git add, git commit, git push.
No one was hurt. But, the fire was in a server room and the git server is down. At least the halon deployed successfully.
The off site backup should be up in 20 mins. I wonder how often they pull the repo.3 -
Our team really needs some workflow arrangement, and this time it was me who screwed up.
So we have to push an update to the Play Store and the App Store the Friday, the app is well tested on test environment then production environment, we got the ok so I uploaded a build, the app management team then continued the process of publishing..
During the weekend the app was approved and live to almost 500k user that can receive the update.
I got a phone call from the Project Manager at almost midnight, the time was really suspicious so I answered.
- Me: Hello.
- PM: Hi, sorry to call you now but the app is live and we have a problem.
- Me: what kind of problem? Let me check.
So I updated the app on my phone and opened it while I am on call.. I almost had heart attack!! WE PUBLISHED A VERSION POINTING TO THE TEST ENVIRONMENT. Holly shit
- Me: shit call the app management team NOW.
Eventually we removed the app from sale (unpublished it) and we submitted a new version immediately, once it was approved the next day we made the app available again (so for those who didn’t update yet, there will be no update to a faulted version, and no new users landing to a version with test data), I received one or two calls from friends telling me why the app is not on the store (our app is used nationally, so it’s really important).
Thank God there was no big show on twitter or other social media.. but it’s really a good lesson to learn.
I understand this is totally my fault, thankfully I didn’t get fired 😅4 -
git push origin stupid-long-feature-name
git pull origin develop
*Checks through all changes. No major conflicts. Accepts changes.*
npm test
*4 failing tests, none of them in pieces that I touched for my feature.*
*That's funny. QA was loaded from the develop branch, and everything works.*
*Actual data has dates from today. Expected data has dates from a week ago.*
*examines tests*
Why are all these expected dates hard-coded‽
tl;dr The external development team committed 4 tests that would only ever pass on the day they were written.5 -
NO. FUCKIN. THANKS. LIKE GOD.
I can't use a SINGLE google service without Google trying to push its shit down my throat.15 -
Reasons why I hate the hospital I work for...
1. NO fucking budget, for fuck sakes our telecom system is still running Merlin Magix. (I’ve been working on getting the trunk and everything to at least push FreePBX out... Configuration configuration.) but, that requires a decent server to host said system... But guess what? We’ve still got a few servers online that are running server 2012 r2. NO FUCKING BUDGET.
2. Training. They don’t have the budget to send me to training, but the doctors here are rolling in Mercedes... Must be fucking nice.
3. I have 5 f-I-v-e job descriptions. I’m a bio medical technician, network admin, system admin, programmer, and help desk... I fucked up allowing them to know I program.
4. On call 365 days a year. That’s nice and all, but when I’ve got shit to do and the nearest Walmart is an hour away I don’t want a call from Louis “oh the printer has a jam” FUCK OFF LOUIS! Get the paper out, we’ve been over this, I believe in you!
5. Some of the FUCKING (l)users.... You wouldn’t imagine some of the calls I receive, some of my favorite being late late “Hey *anonyops* I know it’s late but we’re needing a chair moved from one room to the other.” FUCK YOU YOU CHEEKY FUCKING CUNT.
The only reason I’m still here is my direct supervisor and a hand full of people that I’ve grown to love. Also, because any computer related job here is either outsourced or filled by a YouTubing god. - reason 1 why I started my own business. Supply and demand.
Rural Kansas Hospitals = shit, inb4 thanks —insert president to blame—20 -
You lousy fucking test class of an ass wipe,
TLDR; it fails and it passes all at the same time.
So during a deployment, one of the pre-deployment test classes fails, not something anyone has worked on so figured I run it manually to see what’s going on, but no the shit of a thing passed second time around.
Now because we can’t deploy without 100% of the test classes passing so I have to organise another deployment which it fails again. Fuck this,
Unprotects master
Git checkout master
Git merge dev
Git push master -f
Protects master
Skrew this!
Well would you look at that, it works now 😰 -
Giant, month-and-a-half-long-ticket.
After learning six or so complicated areas of the system and updating them all to work with the new changes, make them all play nicely, etc. I finally got everything working. 95% spec coverage, though no ui tests because I haven't gotten selenium working. whatever, everything's done and works.
Second dev bases her ticket off of mine and continues working. Work elsewhere continues and there's an official release, so we both merge in master. I run tests, everything passes, and go back to working on other tickets.
She finishes her ticket.
We do end-to-end testing, and everything works perfectly. Time for a demo!
She merges in master again, and pushes her branch to two staging servers. (idk why two.)
Demo starts.
We connect to the staging servers, and... none of the UI changes exist; they aren't running the correct code!
So she runs it locally for a demo instead. Two features in my ticket no longer work. She throws me under the bus. She throws me under the bus again by criticising a rake task I scrapped because she wanted to do it. Then again because I didn't update my branch to master and push it before the demo, despite having no reason to. and despite the demo being of her branch.
Then she continues to show off and brag about how she's like the "legend" (senior dev) she envies. QAbuys it.
I'm having an emotion, and it's called anger.rant unfounded superiority complex people suck anger what the hell did you do to my project? i miss working alone8 -
First day of the academic year(CS):
(some uni official) - "And remember to become a good programmer you have to become an excellent mathematician first"
(Me): Oh shit.
Little did I know...
It is a second year now. And the only course I failed is the one that he lectured.
I had no fucking idea that people like this (mad)man exist.
Almost at every lecture he was introducing at leas one topic that was way beyond our program; as he thought they were interesting and "fun".
Many teachers at the University refered to him as a very 'ambitious' man. Then I didn't blame him he truly loved his profession and wanted to share as much knowledge as possible(I thought).
But two months ago he went to far. It was a second exam(for those who failed the first one). And believe me there were a few(60 out of 160 to be exact).
Only ~30 people showed up as the rest failed to many courses and would be kicked out of the uni anyway.
He was handing out the exams when I saw that whoever gets one slowly starts turning white.
I finally got my copy and immediately I realized that the tasks are from his favorite topics, the "fun" ones. 🤦
At this point I knew that it will be extremely hard to pass. But when I was reevaluating my life choices something draw my attention.
One of the tasks had a note below it: "Homework after the exam: It is a very interesting problem just assume x instead of y and try to solve it. PS: it is a lot of fun!"
At this point I lost it.😠 I don't care how much you love math, you should always assume that not everyone loves it as much as you do. So don't push it down the throat of people who clearly don't need a degree in this subject!
Now I'm preparing for the second semester with this guy. And I have a strong feeling that it will be hell of a ride... again.😐
BTW: Sorry that the rant is so long, it's the first one I wrote, and had to share it with someone 😀18 -
As proud as I am of getting GameMaker studio functioning properly under a VM and then being able to automatically push the games to the Linux desktop... It still pisses me off that some people just refuse to support Linux because of 'no one wanting it' or 'it's not worth supporting all the different distributions', when people are using 20+ GB of storage just to run your application on a Linux desktop clearly proves that people actually want this... (That's also ignoring the thousands of other users who keep asking for it)10
-
I got my promotion by forcing it. I work at a fairly large gov organization and have done so for 2.5 years. I had been asking for a pay rise for years but was always told there’s no budget. I was doing work way beyond my pay grade as many senior devs had left. Eventually I got really sick of it so applied to another company, took 5 interview rounds but I had an offer that was a 30% raise on my salary at that time.
I submitted my resignation fully thinking that i’m going to leave, but what do you know, my division not only found the budget but did so in 2 days to come back with a counter offer. It’s funny how when push comes to shove, money that previously didn’t exist just appears out of no where4 -
Quick rant!!
Deadline in 2 days, working with a team.
Me: yo ! , How's the xyz feature? Is it working now?
Teammate: yah, made it work yesterday.
Me: epic! Can you present it to me?
Teammate: wtf, it's not working today!!
Me: no worries, you can sort it out!
Teammate: the latest release you worked on doesn't work properly.
Me: yah, merged code fucked up, I'm fixing that, I'll push a fix today.
And the cycle continues... -
Working on a school project, a teammate created a git repo, gave us all the link, but no push access, told him about it, I gave up explaining.
I still dont have push access after half a day.
Also another team member doesnt know how to write code.
I assumed that people that got accepted in a master that has software development in the title have the basic knowledge or the background at least. Even though there is a separate master especially for that, to teach you software development.3 -
Back in the day, when callbacks was all I've found on Internet tutorials, my code looked like this (img) . But then I found something called "async" and it changed my life!
But I couldn't let go of my old ways, so the code with async looked just like the callback one, but with new boilerplate code.
The thing is: you can't simply USE something new like you were using the old one. you'll probably use it wrong. you have to understand that this new thing is different and adapt your thinking process to better work with it.
you can sit on a skateboard and go forward using your hands on the ground to push it, but that's not how it was designed to work.
I still use callbacks because I have no intention of rewriting my working codebases right now (because they work just fine). But, even with my struggles in changing to new tech, I've learned to adapt (sort of).1 -
Client: I need the push notification to have purple edges with blue background.
Me: I'm sorry. Apple does not have a support for such customization. What we can do is modify title, description and also add an overview image.
Client: No, you can make it purple edges with blue background. I saw it on dribble!
Me: *Logs out*.9 -
So you warn the agency that the client is going to eat into the Dev time with their constant design change requests. Warned them repeatedly for a good month, I should add, asking them to better manage the client's expectations and push back for a later launch date. Come time for development and they act all surprised that we can't build the entire site, that we outlined in the timeline will take 4 to 5 weeks of Dev time, in less than 2 weeks!! ... It gets worse! They say the client is happy to compromise as long as we launch "something" by this date. We list out what can be done, and the fact that there's no time for the client to do QC and we won't be able to do a full QA phase on the site until after launch and only when we finalise all the features. Agency says client agrees and within 3 days into development, they want to QC the site and add more features....... still wanting all this in 2 weeks. This site has now been in development for 3 months.1
-
I wanna meet the dumbass that decided it was a good idea to teach scratch, basic, java, or even python as a first programming language course in college.
I’m so sick of seeing developers out of with shitty code structure and practices, and absolutely no understanding of what is going on behind the scenes of the IDE when you push run.
In order to be a good engineer you MUST know the basics, the root level, bare bones, bare metal shit.
I fear the future, less and less software engineers are comming out of colleges, the majority today is script kiddies, and folks with some basic java experience.
Who the hell is going to be writing firmware in the future then?
It’s insane the lack of foundational skills these students get in college. If they would get a strong foundation in C, and C++ they can easily attack at problem in any language, but missing the foundation, and relying on IDEs.. you will never be-able to go from a knowing only a high level languages and scripts to Lower level problems.
RIP the future of Software Engineering
Welcome to the hell full of script kiddies27 -
On my project the customer has re-signed into a contract several times when they have budget to continue work. The first time they got us to build the system was a huge success story because the team was assembled quickly and we did rapid development. Initialize repo to prod in 1.5 months. The customer asked for the same dev team. Strong dev team, a PM that doesn't take shit, and pure agile. Lets call her don't-take-shit PM.
When the customer re-signed the executive decided that she didn't like don't-take-shit PM. So the project manager gets replaced by play-by-the-rules PM who will comply with stupid requests and micromanagement. He isn't a bad PM but he tries to make everyone happy. The amount of management types executive installs on the project is massive, and development team is cut down in major ways. Customer and executive shit rolls down to the development team and we can't get anything done. The customer starts to lose faith because we can't get traction. They start demanding traditional waterfall/SDLC docs. Which causes more delay in the project.
So the executive decides that the PM can take a fall for it to save face for the company. She moves play-by-the-rules PM to another project. He starts handover to a new PM that has a history of being her pushover. The customer hadn't seen him yet so now we have push-over PM.
Play-by-the-rules PM is finally out of the project and instead of moving to a different account the company decides to "lay him off because there is no work". So basically they made him take the fall for the failure while promising reassignment, and instead let him go. This is so unfair..
Meeting with push-over PM yesterday and he shows us his plan. Identical to play-by-the-rules PM's plan that got him axed.We point that out and show him the docs that were made for it. His face clearly communicates "OH SHIT WHAT DID I SIGN UP FOR?"1 -
Okay, I'm interning at a government institution & boy let me just tell you... mmmh... A FUCKING MESS!
So I'm tasked with developing a HR system that the whole company should eventually use. I tell them I'm not familiar with the open source technologies they'd like me to use, they tell me no worries, you can develop a prototype with a tech stack that you're familiar with. Also, they tell me that they don't quite have the requirements from HR so what I can do for my prototype is just develop something "general" that works according to their "idea".
Being the good intern I am, I develop quite a good functioning prototype & present it to the team who then present it to the managers.
Finally we're all called in for a final meeting with the managers & HR, and guess what? The requirements for the system are different. Almost 90% of the features we built into the prototype need to change. Also, the system must use open source technologies. The managers promise to send a detailed requirements specification document, with sample data. I think this is a great idea as there's still a lot I don't understand. I expected this to happen, so I soon start to redesign afresh, this time trying as hard as possible to consider open source technologies within my plans.
But noooo... My team wants me to "finish" the system!
"Finish" what system, I ask? That was a prototype!
"Just tweak the functionality you built to meet the new requirements".
WTF!
We don't even have the actual requirements specification document, so I'll still be coding blindly. Also, the whole system needs to be re-built using open source technology!
Instead of pushing me to develop a system blindly, with no requirements, how about you push HR to tell you exactly what they need and how it should work first!?
I'm honestly exhausted with the false sense of urgency from my team!!8 -
Minimal comments, no tests, push to Master branch... *Cough* though, this is all for personal projects, not team projects.2
-
Made an Android app a while ago. I needed some pet project so I decided to go with Java for Android. First time, no experience at all.
So everything went ok, I had a little help from a colleague, structuring code, and pushing to the store. Work done app was doing ok.
A year later I came back to this project. I needed to fix a bug - date time and daylight savings crap. 😥
Spent a week on it. Ready to push a new version to the store, with some extra features! Build apk. All good.
Wait. I need to sign the APK? Wtf. I had to format my hard drive. How do I recover my fucking certificate?
*Google's for a while*
No fucking way. I can't restore the certificate. Or get the keystore back. The solution is to create a new app with a brand new package name?
Thanks for nothing, I'm done with Android development.9 -
Fuck this client's IT department. They're a bunch of Microsoft asslickers.
How am I supposed to push code to your self-hosted GitLab instance if you restrict me to Citrix RDP????? No OpenVPN access because I'm on Linux?? Seriously? Because I am not using any of your laptops?
FUCK YOU DUMBASSES, I COULD DO A BETTER JOB THAN YOU AND I JUST PLAY WITH LINUX.
When I said I only needed terminal access I would have never imagined they were thinking of Putty inside an RDP. What a steaming shit.
Oh you guys don't have a secret management service as any enterprise should? Oh I cannot add a secret management service as part of the solution I am building for you guys because "Hurr Durr yOu HaVe NoT pUt ThIs In ThE pRoJeCt PrOpOsAl sO nO"
Fuck you guys. You guys only don't want to move to the cloud to not lose your jobs. I would be far more productive than relying on you pieces of dumbassery.
They are all having each others back in using shit technology and practices.7 -
'Hey I found a bug in your code, it's probably a typo, see here.'
Me: Oh right, yeah. How stupid of me. Thanks, I'll push it.
'It's okay. You can push it or I can do it too after you push the changes we just discussed. I actually simplified one of your methods.'
Me: You, what... ?
(You crammed multiple lines in a single line with your stupid as fuck, rigid constructs, removing my error handling, loosely coupled service, in the name of simplification?)
' Yeah it's just four lines in a single function now, no need to call the function again and again.'
Me: (No... Just no. This totally undos whatever little I could do to avoid supporting your idiotic object in the first place.)
Oh... okay, we'll see. I'll let you know.
What life.
Life in a company full of ignorant, inflated egos is no joke.
Details:
I created a service that reads a configuration file and returns the configuration. This person needs five entries for his app logic. He collected them in a object. Quite alright. Except that the class prototype is shitty. I, like a normal person, made my service return a value based on input. I was asked to incorporate this awful object so that I can return the five entries together, which is awful because the service is not supposed to know about how the entries are clubbed. It should most certainly not know about the data members of the object!4 -
Our project at work goes live in 3 weeks.
The code base has no automated tests, breaks very often, has never had any level of manual testing
will not be releasing with any form of enforced roles or permissions in our first release now due to no time to enforce, however there is a whole admin api where you can literally change anything in our database including roles.
We also have teams in various countries all working separately on the same solution using microservices with shared nuget packages and they aren't using them properly.
Our pull requests are so big - as much as, 75 file changes - in our fe app that I can't keep up with it and I honestly have no idea if it even works or not due to no automated tests and no time to manually test.
We have no testing team, or qa team of any sort.
Every request into the system has to hit a minimum of 3 different databases via 3 different microservices so 1 request = 4 requests with the load on the servers.
We don't use any file streams so everything is just shoved in the buffer on the server.
Most of the people working on the angular apps cba to learn angular, no one across 2 teams cba to learn git. We use git so they constantly face problems. The guy in charge has 0 experience in angular but makes me do things how he wants architecturally so half the patterns make no sense.
No one looks at the pull requests, they just click approve so they may as well push directly to master.
Unfinished work gets put in for pull request so we don't know if the app is in a release state since aall teams are working independently, but on the same code base.
I sat down and tested the app myself for an hour and found 25 fe only issues, and 5 breaking cross browser issues.
Most of our databases are not normalised. Most of our databases make no sense. 99% of our tables have no indexing since there is no expertise with free time to do it.
No one there understands css properly. Or javascript.
Our. Net core microservices all directly use ef in the controller actions so there is no shared code there.
Our customer facing fe app is not dry because no tests so it was decided it was better this way.
Management has no idea on code state, it seems team lead is lieing to them about things like having any level of tests.
Management hire devs that claim to be experts but then it turns out they have basically no knowledge of what they were hired to do, even don't know what json is or the framework or language they are hired for, but we just leave them to get on with it and again make prs too big to review.
Honestly I have no hope that this will go well now but I am morbidly curious to watch. I've never seen anything like the train wreck that we are about to get experience.5 -
Simple. I push everyone I care about out of my life, and procrastinate dev life until the last seconds. My life has no balance.
-
So i just saw a post about not pushing to production on Friday's and that reminded me of something.
A team we are working with (we needed help on something so we got another company to send us a team and do it for us) recently push to production on a Friday at around 5pm.
We didn't know that they had done it until a shit ton of errors started happening and we had no idea why (it was working so far, none of us did anything, so what the fuck is going on).
To make things better, one of my colleagues tried calling them and they wouldn't answer the phone. They knew what they did, so they went home before we could notice it and we had to correct their mistake.
We had everyone calling us saying they had gotten an error, and they needed to get home but couldn't because of it (it messed up a process that only happens at the end of the day before people go home. I can explain more in the comments if anyone is confused, or just wants to know).
Eventually everything was solved, but that was a very stressful ending of the week.
So yeah, don't deploy on Friday's please and thank you7 -
Little story, about how i get things fucked up.
I've been working for two nights on some project, and we have notifications in slack about new commits, and i've been working for myself, not pulling any commits for this time, cause no notifications 've been received, and then when i've tried to commit&push i've realized that there is 14 commits before me, and someone just accidentally turned off notifications :C1 -
Workload rant.
Our new line manager is overly expecting from all of us (product/design/tech) and is micro managing on ground level without having any real sense of reality. He just wants everything to be built overnight.
He is smart, no doubt about that. But guess, I learnt from him what I had to. Not to stereotype but he is a typical Indian manager who keeps pushing boundaries.
He just added 80 features for Q1 roadmap with on 3 PMs, 1 Designer, 1TPM, and bunch of techies .
What the actual fuck! 😂😂😂 And he wanted to add more, thankfully we ran out of time in the meeting.
And my super talent and genius blabbering co-woker who works mechanically just fucked herself real bad. Lol
I kept telling her not to add Feature XYZ to the roadmap because:
1. There'll be spill over from Q4
2. She is already overloaded with 1 task and keeps crying all day about being unable to handle it
3. She is setting wrong expectations with management for herself and rest of the team
4. Boss will add more work and she'll be fucked
She was adamant and did not listen.
Now this is what happened:
1. ALL her Q4 items got pushed to Q1. LMFAO
2. She was literally crying since morning on calls for being overloaded and we are yet to start Q1 assignments
3. Additional tasks along side feature XYZ were added on her plate
I tried to push back the manager and that's when he said okay, let's keep some items for Q2.
But holy shit. 80 features between such a small team and wanted to done in few weeks.
I need to pump more steam in my job hunt activity. This place is ridiculously toxic.33 -
Rant time of 'Derp & Co.'
Today I decided that I am going to find another job, I just can't keep with this shit.
They said that use Agile: FALSE.
• Daily (best scenario) take like 1 hour and a half.
• New task enter the sprint and "Fuck you, more task in the same time". This is something regular done.
• "Oh, dev, we need you to check this other project" I am in the middle of my sprint on this project. "But you have to fix this bug here". (3 fucking days the bloody bug) "You are late again with tasks".
• Meeting for fresh sprint: 6 BLOODY hours... nonstop
The workflow is garbage:
• SOMEONE should did all the devops shit on the first sprint, guess what? They did nothing!, guess now who is being blamed for it (not only me, but a few coworkers).
• Nothing is well designed/defined:
~ task are explained like shit
~ times measured wrongly
~ We are in the last fucking SPRINT and still doing de ER of the DataBase cause Oh, apparently no one has work before with SQL (damn you MongoDB! (Not really)) so I am doing my best, but "jezz dev, this is so hard... maybe we can do it WRONG and easy".
~ No one is capable of take responsability of their mess, they just try to push down the problems. (Remember the devops situatuion? Why is.my fault? I came at the 3 or 4 sprint and I am doing backend tasks, I know nothing about devops).
But the big prize, the last one:
• Apparently you can't send whatever you want to the boss, it has to pass a filter previously of coordinators and managers, hell yeah!
And I am an idiot too!
because I see that we can't reach our schedule and do hours on my spare time!
This is because there are a few good coworkers who probably ended with my unfinished tasks... and they are equaly fucked as me...
This is just the tip of the iceberg. I am not a pro, I am not a full stack developer and still need to learn a lot, but this is just not normal, eight months like this...3 -
Here we go again. Months have passed since this client first wanted their website launched. But because they were suddenly and inexplicably in no real hurry to make it go live, we are now waiting for them to get back to us on whether to push to Production. Meanwhile, I have bills to pay and as soon as I told them I need the check by no later than April 1st, everyone over there is no longer answering phone calls or emails. Voicemail box is full and not accepting any more messages.
I think this would be the part where I call "Big Nick" and ask him to pay them a little "visit". If I knew someone like that.2 -
Am I the only one who encounters these dickhead teachers, who live in a world, where they think that you have just their subject?
I mean that kind of professor, who shows up 30 minutes late to a lecture, sends you source code with no commetary because fuck you with a rusty fork and tells you that we have no time to write the code during the class?
The one who shows you a shitty presentation with the same code he just sent you, just cut into 72 slides and at every slide tells something like this is pretty self explanatory, x just does y and if you ask a question he gives you that deep stare, like if you really mean it seriously to waste his time, since he really really wants to go to his office sooner so he can scratch his balls?
That type of professor who tells you that as a student of CS degree you are required to put some passion to your craft and study when you arrive at home and hes there just to give you guidelines, but apparently somehow forgotten that people usually need to sleep?
That same cunt who doesnt give a shit that you have 4 more projects to finish this week, doesnt push the deadline, nor give you advice, because you had opporturnity to ask the whole time?
But still that motherfucker, who gives you test questions that he took from mouth of Satan himself and then questions your answers like Where did you get that from?
Well fuck yall who do that shit, hope that you suffocate yourself while eating bread.
Why these douches doesnt understand, that even if we arent under the Working Laws, working more than 40 hours a week isnt the best way to keep us sane or motivated.2 -
Just came back from vaccation yesterday. During sprint retrospective today I hear my team was having trouble dealing with the API layer (which was mostly written by me). Suggestion was a session where I sit and explain the application to the team ,which I have no problem with.
One of my teammates asserts that it's written in such a way that "only the person who wrote it can modify it".
Agree to disagree but whatever. This thing goes through code review everytime I push changes to it. If there was a problem I don't know why he's just discovering it 6 months into the project. I assure you there's no rocket surgery going on. The problem is that I have been doing everything on that side of the project and nobody was curious enough to give it a read sometime. In fact I dont think anything needed to change while I was on vacation, they just didn't have me to troubleshoot every problem for them like usual 😤 -
WHY IS IT SO FUCKIN ABSURDLY HARD TO PUSH BITS/BYTES/ASM ONTO PROCESSOR?
I have bytes that I want ran on the processor. I should:
1. write the bytes to a file
2a. run a single command (starting virtual machine (that installed with no problems (and is somewhat usable out-of-the-box))) that would execute them, OR
2b. run a command that would image those bytes onto (bootable) persistent storage
3b. restart and boot from that storage
But nooo, that's too sensible, too straightforward. Instead I need to write those bytes as a parameter into a c function of "writebytes" or whatever, wrap that function into an actual program, compile the program with gcc, link the program with whatever, whatever the program, build the program, somehow it goes through some NASM/MASM "utilities" too, image the built files into one image, re-image them into hdd image, and WHO THE FUCK KNOWS WHAT ELSE.
I just want... an emulator? probably. something. something which out of the box works in a way that I provide file with bytes, and it just starts executing them in the same way as an empty processor starts executing stuff.
What's so fuckin hard about it? I want the iron here, and I want a byte funnel into that iron, and I want that iron to run the bytes i put into the fuckin funnel.
Fuckin millions of indirection layers. Fuck off. Give me an iron, or a sensible emulation of that iron, and give me the byte funnel, and FUCK THE FUCK AWAY AND LET ME PLAY AROUND.8 -
It's a brand new year - and my first email comes in telling me the app is broken because they didn't receive any push notification (....no push notification was sent from them), the web cams don't work (....they've changed all the links to the webcams and now they're surprised it doesn't work in the app) and the app isn't available in France (the app is literally available in France).
Oh and if a user changes their font sizes in their mobile settings, it doesn't always look "very good" in the app.......5 -
Long time ago i ranted here, but i have to write this off my chest.
I'm , as some of you know, a "DevOps" guy, but mainly system infrastructure. I'm responsible for deploying a shitload of applications in regular intervals (2 weeks) manually through the pipeline. No CI/CD yet for the vast majority of applications (only 2 applications actually have CI/CD directly into production)
Today, was such a deployment day. We must ensure things like dns and load balancer configurations and tomcat setups and many many things that have to be "standard". And that last word (standard) is where it goes horribly wrong
Every webapp "should" have a decent health , info and status page according to an agreed format.. NOPE, some dev's just do their thing. When bringing the issue up to said dev the (surprisingly standard) answer is "it's always been like that, i'm not going to change". This is a problem for YEARS and nobody, especially "managers" don't take action whatsoever. This makes verification really troublesome.
But that is not the worst part, no no no.
the worst is THIS:
"git push -a origin master"
Oh yes, this is EVERYWHERE, up to the point that, when i said "enough" and protected the master branch of hieradata (puppet CfgMgmt, is a ENC) people lots their shits... Proper gitflow however is apparently something otherworldly.
After reading this back myself there is in fact a LOT more to tell but i already had enough. I'm gonna close down this rant and see what next week comes in.
There is a positive thing though. After next week, the new quarter starts, and i have the authority to change certain aspects... And then, heads WILL roll on the floor.1 -
I've been working like a mad woman in a startup for 3+ years now. They feel like 10. Or at least the tech stacks we went through.
Never, ever join a startup, regardless of compensation, unless you know you can emotionally and mentally recover from that startup failing as if it is yours, not your bosses. Otherwise, it's just a shitty short experience.
My long experience is shitty, but man. I don't know.Those who built google, wanted to make a search engine. Did they know they're gonna be good? NO. This is the result of them being good. They now have that great product that succeeds and is able to become a self-referential piggy bank. You cannot be a self-referential piggy bank based on a fucking belief and idea, and a bunch of VCs who already put money in you. You know why? BECAUSE GUESS WHO IS THE ONE RESPONSIBLE FOR SUSTAINING YOUR START UP NOW?
The bloods and passions of youth, that join your startup, thinking they can make a difference, and you just undermine them constantly thinking that no engineer can make a difference if they can't ensure compliance with your dumb funding strategy.
Don't even get me started on the fact that most people who work for startups, rely on either laziness or passion. It's like a bunch of kids in art school, whose professor doesn't like anything they make, but they still kinda like it hoping one day they leave and become artists themselves. Then they discover that this shit professor actually taught them nothing about creativity in the real world, and what it takes to push something out.
And, it finally fucking hit me.
The reason startups will never work in this year, and beyond, AND TILL I SEE A CHANGE IN ATTITUDE IN 10 YEARS.....
The market won't fucking allow it with the current strategy tech companies are a fan of: hire a bunch of passionate devs who wanna learn a tool through doing our unique work. Doesn't matter. DIVERSITY. THE UNION IS THE PASSION. That's dumb as fuck.
Why?
Here:
- Passionate people do not have to use passion as an incentive, the passion was there, and them getting their idea made or money is the incentive
- If you hire a passionate person - even if they are the fucking best - you just made their passion a tool, in getting your PRs done and shit epics scoped AT BEST, and so the tools you're teaching them to use are getting away with doing less impactful, productive, creative work.
I AM SO DEPRESSED.3 -
When you start a new project and you think that you will no longer have problems with git.... after one week you see yourself sending classes to your colleagues via mail to push them for you. Shit man1
-
So... My boss is "hard working", meaning that she'd rather edit and upload a html file every morning at 5am for the last 5 years and manually send a push notification notifying the user that the new file is up than learning a little bit about automation (cron? IFTTT?) and even after letting her know about those options she has "no time"
She'd rather keep source code (pug, sass), manually build on local computer and upload to live servers instead of learning git and letting me setup once and for all CI/CD
SERIOUSLY!?!? NO TIME!?!? But there's time to do things at a turtle pace like in the 90s... 🤦♂️5 -
PM: "Did you ever push changes for this one feature?" Me: "No. I haven't had time to even look at it. Everyone wants me to do stuff before my last day." PM: "okay so is it done yet or not?". If i haven't looked at it, if it's not pushed, HOW THE HELL WOULD IT BE DONE?!2
-
I usually crib about how stupid people are and how I struggle to stay afloat.
Let's switch some gears now. A post about some good people, product, and processes.
You know what the common theme here is?
The goodness here cannot be measured. Your first interaction with them makes you feel so comfortable that you start feeling butterflies.
These people just keep on giving. They are selfless. They are pure. They actually care.
And when you think it's done, then they give you some more.
What blows me away is, they don't expect or accept anything in return. Absolutely nothing. Not even a simple thank you.
And they are like a wizard. They walk into your life when you least expect them but need them the most. And when the task is done, they'll be gone before you even know.
No lingering, no drama, no bullshit. Just pure goodness.
Like my ex-lead in current company, I have a very senior guy in neighbouring team (for which they were gonna hire me initially), who also happened to interview me, is a gem.
He takes care of me like his own younger brother. Supports me and always answers my queries no matter how occupied he is.
And same is with good products and processes. They feel effortless. So smooth and add exceptional value to your existence. They give rise to wonderful companies.
You'd never experience a single negative aspect about them. No matter how much you try, things will just keep getting better until they don't need to.
And then they'll be long gone. Never to be seen again and never to be forgotten.
You cherish them only in your memory and wish they lasted longer. But they didn't because the purpose was served.
Such people and experiences inspire me. They push me to become a better human.
No matter how the world is or how it treats me, I must always live with high values and be a better version of past self.
The other evening, I was conversing with my mother where we spoke about some family friends who are insanely wealthy but humble and kind.
Mom and I mutually agreed that they don't have such good traits because they are wealthy, but they are wealthy because they live with humility, kindness, and pure intentions.
World is surely a beautiful place because of such people and I aspire to be one. May lord guide me well :)3 -
A rant from git,
Why do developers always PUSH and PULL me around. I mean they don't just do it once or twice. No they COMMIT to doing it over and over. I try to REBUILD myself, but it is hard getting pushed and pulled constantly. I don't know the ORIGIN of where it started, but gosh I wish the bullying never started! -
Trying to switch my job. Applied for a well known company. Gave an interview today. I don't fucking get the obsession of these developer recruiters so fixated on data structures and algorithms. I know it's a massive part of computer science but guess there is no fucking room left to innovate in there. There are legitimate researcher teams working for implementation of these barebones inside system foundations. No general software developer gives a fuck about this piece of shit discipline of study. You wanna know why they propagate this as the panacea to test people because it's fucking easy. Give a project to somebody as interview procedure, it'll take time to bring out an interesting problem and an interesting solution to that. Sorry to say but all these data structure enthusiasts are nothing better than board game enthusiasts.
Also why can't you refer existing solutions to create your solution. I've seen some good problems which actually require you to think. But again those are heavy and can't be tested so you're left with reversing a fucking linked list with O(1) auxillary space. Fuck me ig.
Moreover, what the fuck is wrong with the moral policing internet crowd. Its so sad. I've hardly seen anybody rant about this piece of shit system put in place to push the absolute dead-end nutcases up the ladder. Every other search for it returns a Quora link with some Indian guy complaining about his interviews and in the comments you have the same scholars sitting in their data structure throne imparting knowledge about how data structure holds the fabric of reality together.
I don't hate data structures and algorithms as a subject. It is cool and quite extensive but once you try to make that as a metric of all the knowledge in the world, you've lost my drift. Maybe I'm just angry with the state of things. Maybe I'm just angry with token Quora crowd.4 -
Am I the only developer in existence who's ever dealt with Git on Windows? What a colossal train wreck.
1. Authentication. Since there is no ssh key/git url support on Windows, you have to retype your git credentials Every Stinking Time you push. I thought Git Credential Manager was supposed to save your credentials? And this was impossible over SSH (see below). The previous developer had used an http git URL with his username and password baked in for authentication. I thought that was a horrific idea so I eventually figured out how to use a Bitbucket App password.
2. Permissions errors
In order to commit and push updates, I have to run Git for Windows as Administrator.
3. No SSH for easy git access
Here's where I confess that this is a Windows Server machine running as some form of production. Please don't slaughter me! I am not the server admin.
So, I convinced the server guy to find and install some sort of ssh service for Windows just for the off times we have to make a hot fix in production. (Don't ask, but more common than it should be.)
Sadly, this ssh access is totally useless as the git colors are all messed up, the line wrap length and window size are just weird (seems about 60 characters wide by 25 lines tall) and worse of all I can't commit/push in git via ssh because Permissions. Extremely aggravating.
4. Git on Windows hangs open and locks the index file
Finally, we manage to have Git for Windows hang quite frequently and lock the git index file, meaning that we can't do anything in git (commit, push, pull) without manually quitting these processes from task manager, then browsing to the directory and deleting the .git/index.lock file.
Putting this all together, here's the process for a pull on this production server:
Launch a VNC session to the server. Close multiple popups from different services. Ask Windows to please not "restart to install updates". Launch git for Windows. Run a git pull. If the commits to be pulled involve deleting files, the pull will fail with a permissions error. Realize you forgot to launch as Administrator. Depending on how many files were deleted in the last update, you may need to quit the application and force close the process rather than answer "n" for every "would you like to try again?" file. Relaunch Git as Administrator. Run Git pull. Finally everything works.
At this point, I'd be grateful for any tips, appreciate any sympathy, and understand any hatred. Windows Server is bad. Git on Windows is bad.10 -
No table and monitor, and having to work ALL THE TIME. Our team structure changed recently, and a coworker with 2 years of experience is my lead. He wakes up at 11-12 in the morning, starts working by around 2, takes enough breaks and sleeps at like 5 AM. He assigns tasks late in the evening and night. Expects people to finish it staying up late, because if he can, why can't we. Most of the time, it's like, hey, just push a little and finish it tonight, we have other things to do tomorrow.
And team mates who can NOT work without help from other people and text and call you every hour.4 -
So I work in a web development company in my town and have been doing a while or heap of parallax sites for our clients. Now obviously when we do the designs we get them in and get them to play around with the site before we go ahead and push their new site out and make it live right.
Wellll who would of thought that a simple parallax site would be so hard to use for the general user??? Recently we have been getting the occasional call where the client is getting complaints about the site only being a big ole image or just one block of text. After investigating why their site was broken or why the users weren't able to see the whole site I came across no problems at all.
Today I got a call from the client who instructed me that after explaining to one of his own clients that he had to scroll down the page that everything was just fine!
I mean, what? How do you miss the big ole scroll bar on ya screen or even think to even attempt to scroll? Some people aye lmao2 -
I don't :< Honestly, it's just something I don't really think of and I either waste time or do actually work. No need to push myself
-
TL;DR: When picking vendors to outsource work to, vet them really well.
Backstory:
Got a large redesign project that involves rebuilding a website's main navigation (accessibility reasons).
Project is too big just for our dev team to handle with our workload so we got to bring a 3rd party vendor to help us. We do this often so no big deal.
But, this time the twist was Senior Management already had retained hours with a dev shop so they want us to use them for project. Okay...
It begins:
Have our scope / discovery meeting about the changes and our expected DevOps workflow.
Devs work Local and push changes to our Github, that kicks off the build and we test on Dev, then it goes to Staging for more testing & PM review. Once ready we can push to prod, or whenever needed. All is agreed, everyone was happy.
Emailed the vendors' project manager to ask for their devs Github accounts so we can add them to the project. Got no reply for 3 days.
4th day, I get back "Who sets up the Github accounts?"
fuck me. they've never used Github before but in our scope meeting 4 days ago you said Github was fine...??
Whatever, fuck it. I'll make the accounts and add them.
Added 4 devs to the repo and setup new branch. 40min later get an email that they can't setup dev environment now, the dev doesn't know how to setup our CMS locally, "not working for some reason."
So, they ask for permission to develop on our STAGING server.. "because it's already setup"... they want to actively dev on our staging where we get PM/Senior Management approvals?
We have dev, staging, production instances and you want to dev in staging, not dev?... nay nay good sir.
This is whom senior management wants us to use, already paid for via retainer no less. They are a major dev shop and they're useless...
😢😭
Cant wait for today's progress checkup meeting. 😐😐
/rant1 -
Stupid pipeline bullshit.
Yeah i get it, it speeds up development/deployment time, but debugging this shit with secret variables/generated config and only viewable inside kubernetes after everything has been entered into the helm charts through Key Vaults in the pipeline just to see the docker image fail with "no such file found" or similar errors...
This means, a new commit, a new commit message, waiting for the docker build and push to finish, waiting for the release pipeline to trigger, a new helm chart release, waiting for kubernetes deployment and taking a look at the logs...
And another error which shouldn't happen.
Docker, fixes "it runs on my machine"
Kubernetes, fixes "it runs on my docker image"
Helm, fixes "it runs in my kubernetes cluster"
Why is this stuff always so unnecessarily hard to debug?!
I sure hope the devs appreciate my struggle with this... well guess what, they won't.
Anyways, weekend is near and my last day in this company is only four months away.2 -
Hmm. This code needs refactoring.
*recodes on Local and uploads*
Works on my branch.
*git push origin master and merge*
Works on Dev.
*deploy to Test*
Works on Test.
*deploy to Live*
Doesn't work.
*compares Live to Test, Dev, and Local*
No f$@%^%%$# difference!?!!
*quits development and lives under a bridge*5 -
Question about burnout here!
I've been a developer for a year and a half now and I've reached a point of burnout. Experiencing a lot of external stress as well as internal (handled well with a fantastic and supportive team)
I'm taking some time away from work and having a much needed break but I'm worried that for now, I can't code! I've got no drive at all to learn anything new, I'm just sat here waiting for a production push.
I'm by no means thinking of changing careers or leaving my current role and the lack of concentration is likely as a result of stress, I just wanted to hear some of your stories so I feel a little less alienated!
Being new to this is pretty overwhelming at times!3 -
A Rant that took my attention on MacRhumors forum.
.
I pre-calculated projected actual overall cost of owning my i5/5/256 Haswell Air, which I got for $1500.
After calculations, this machine would cost me about $3000 for 3 years of use.
(Apple Care, MS Office Business, Parallels, Thunderbolt adapter to HDMI, Case... and so on).
Yea... A lot of people think it's all about the laptop with Apple. nah... not at all. There's a reason Apple is gradually dropping the price of their laptops.
They are slowly moving to a razor and blade business model... which basically is exactly what it sounds like - you buy the razor which isn't too expensive, but you've got no choice but to buy expensive additional blades.
I doubt Apple is making much money from laptop sales alone... well definitely not as much as they were making 5 years or so ago (remember the original air was about $1800 for base model, and if i remember correctly - $1000 additional dollars to upgrade to 64GB SSD from the base HDD.
Yes, ONE THOUSAND DOLLARS FOR 64GB SSD!
Well, anyways, the point is that Apple no longer makes them BIG bucks from the laptop alone, but they still make good profits from upgrades. $300 to go to 512GB SSD from 256, $100 for 4GB extra ram, and $150 for a small bump in processor. They make good profits from these as well.
But that's not where they make mo money. It's once you buy the Macbook, they've got you trapped in their walled garden for life. Every single apple accessory is ridiculously overpriced (compared to market standards of similar-same products).
And Apple makes their own cables and ports. So you have to buy exclusively for Apple products. Every now and then they will change even their own ports and cables, so you have to buy more.
Software is exclusive. You have no choice but to buy what apple offers... or run windows/linux on your Mac.
This is a douche level move comparable to say Mircrosoft kept changing the usb port every 2-3 years, and have exclusive rights to sell the devices that plug in.
No, instead, Intel-Microsoft and them guys make ports and cables as universal as possible.
Can you imagine if USB3.0 was thinner and not backwards compatible with usb2.0 devices?
Well, if it belonged to Apple that's how it would be.
This is why I held out so long before buying an apple laptop. Sure, I had the ipod classic, ipod touch, and more recently iPad Retina... but never a laptop.
I was always against apple.
But I factored in the pros and cons, and I realized I needed to go OS X. I've been fudged by one virus or another during my years of Windows usage. Trojans, spywares. meh.
I needed a top-notch device that I can carry with me around the world and use for any task which is work related. I figured $3000 was a fair price to pay for it.
No, not $1500... but $3000. Also I 'm dead happy I don't have to worry about heat issues anymore. This is a masterpiece. $3000 for 3 years equals $1000 a year, fair price to pay for security, comfort, and most importantly - reliability. (of course awesome battery is superawesome).
Okay I'm going to stop ranting. I just wish people factored in additional costs from owning an a mac. Expenses don't end when you bring the machine home.
I'm not even going to mention how they utilize technology-push to get you to buy a Thunderbolt display, or now with the new Air - to get a time capsule (AC compatible).
It's all about the blades, with Apple. And once you go Mac, you likely won't go back... hence all the student discounts and benefits. They're baiting you to be a Mac user for life!
Apple Marketing is the ultimate.
source: https://forums.macrumors.com/thread...3 -
A dev life in Queen songs:
„A Kind of Magic“ - Build successful
„A Winter’s Tale“ - Key Account Manager visits customer
„Action This Day“ - Release day
„All Dead, All Dead“ - System down
„Another One Bites the Dust“ - kill -9 4711
„Breakthru“ - 10 hour debuging session
„Chinese Torture“ - Microsft Office
„Coming Soon“ - Client asks for delivery date
„Dead on Time“ - shutdown -t 10
„Doing All Right“ - How's the progress on the new feature?
„Don’t Lose Your Head“ - git push -f
„Don’t Stop Me Now“ - In the zone
„Escape from the Swamp“ - Hand in resignation letter
„Forever“ - while(1)
„Friends Will Be Friends“ - friend class Vector;
„Get Down, Make Love“ - No rule to make target "Love"
„Hammer to Fall“ - Release day
„Hang on in There“ - 2 weeks until release
„I Can’t Live With You“- Microsoft
„I Go Crazy“ - Microsoft
„I Want It All“ - Google
„I Want to Break Free“ - free( (void*) 0xDEADBEEF );
„I’m Going Slightly Mad“ - Impossible feature requested
„If You Can’t Beat Them“ - Impossible feature promised by sales
„In Only Seven Days“ - Impossible feature ordered
„Is This the World We Created...?“ - Philosphic moments
„It’s a Beautiful Day“ - Weekend
„It’s a Hard Life“ - Weekday
„It’s Late“ - Deadline was last week
„Jesus“ - WTF?
„Keep Passing the Open Windows“ - Interprocess communication
„Keep Yourself Alive“ - Daily struggle
„Leaving Home Ain’t Easy“ - Time to get up and go to work
„Let Me Entertain You“ - Sales meets customer
„Liar“ - Sales
„Long Away“ - Project start
„Loser in the End“ - Dev
„Lost Opportunity“ - Job ad
„Love of My Life“ - emacs/vim
„Machines“ - Computer
„Made in Heaven“ - git
„Misfire“ - Unhandled exception at Memory location 0xDEADBEEF
„My Life Has Been Saved“ - Google drive/Facebook
„New York, New York“ - Meeting at customer
„No-One But You“ - Bus factor = 1
„Now I’m Here“ - Morning rush hour
„One Vision“ - Management goals
„Pain Is So Close to Pleasure“ - NullPointerExcption
„Party“ - Delivery completed
„Play the Game“ - Customer meeting inhous -
„Put Out the Fire“ - Support hotline
„Radio Ga Ga“ - GSM/GPRS/UMTS/LTE/5G
„Ride the Wild Wind“ - Arch Linux
„Rock It“ - Linux
„Save Me“ - CTRL-S/CTRL-Z
„See What a Fool I’ve Been“ - git blame
„Sheer Heart Attack“ - rm -rf /
„Staying Power“- UPS
„Stealin’“ - Stack Overflow
„The Miracle“ - It works
„The Night Comes Down“ - It doesn't work
„The Show Must Go On“ - Project cancelled
„There Must Be More to Life Than This“ - Philosophic moments
„These Are the Days of Our Lives“ - Daily routine
„Under Pressure“ - 1 day until release
„Was It All Worth It“ - Controlling
„We Are the Champions“ - Release finished
„We Will Rock You“ - Sales at customer
„Who Needs You“ - HR
„You Don’t Fool Me“ - Debugging session
„You Take My Breath Away“ - rm -rf /
„You’re My Best Friend“ - emacs/vim4 -
I don't know if this is exactly a rant. But - I am sure somewhere out there has run into this situation before.
I've been a developer (professionally) for a 3 years. And in that time I've stayed with that same company.
Over that time its become incredibly apparent that my boss (senior developer) isn't exactly keen on new technologies, source control (I had to push hard for this. And even then he doesn't use it properly), or any kind of project management. It's only he and I.
I've started interviewing other places and while I have no problems answering their technical questions. I'm worried my lack of experience in a team is becoming a problem.
We don't work on projects together. We don't do code reviews. He does not ask my opinion on anything. We are basically two separate teams. I want to improve as a developer. I love the rest of the company and I enjoy what I'm working on. I just feel I'm hindering my growth as a developer.
Anyone have any advice? I know I can find a project to contribute to on github or something. But honestly that's intimidating to me for some reason. I am self taught. And don't have any experience in working with teams.4 -
My first rant. Woohoo!
Honestly I do the whole shebang ussualy depending on what the needs are from network to servers to coding because for some reason nobody has any technical experience where I work.
I just started app development for a gamedev startup and I am in sheer awe of the amount of transpiling/compiling etc that needs to be done for an multiplatform app for iOS and android with js(x)/typescript, html, css.
I remember when I could just write some spaghetti code to make it working by following a couple of tutorials. Then refractoring and testing it for a couple of hours and be done with it. push it into production.
Now I am lost having to learn OOP, functional programming, reactjs, react native, express, webpack, mongodb, babel, and the list goes on and on...
Why not just make a new backend that does all of that in another language which supports all of that.
I have no formal education in programming/coding and the last time I learned JS it was just some if else, switches and simple dom manipulation.
I just want to get to coding a freakin' game but I have to learn JSX for the front and typescript on the backend.
I am this close to going back to ye ol' lamp stack and quitting this job. 😥5 -
Multi User, One Account, and other shit
I'm gonna rant about something as a user, and someone who makes stupid web stuff.
My bank has been updating their web banking over time and they decided that every individual on an account, should have their own login. They really want to push this on their users, I suspect specifically folks like me and my wife who share one login for the joint accounts we have at the bank together.
Why share one login, because it's the only sure fire way I know that I and my wife can see all the same shit no doubt about it.
The banks never tell you what you can see or can't with joint accounts, I doubt it is even documented on their end, but in every damn case something is hidden or different in some weird way.
Messages to the bank people? If I send it, my wife often can't. I get that for security reasons that's a thing, but it makes no sense for a joint account.
ANY difference to me breaks online banking ENTIRELY. Joint accounts are supposed to be... well one account that is the same.
Other banks we used where we had different logins for the joint account, each login actually had separate bill pay accounts per user. So if I went to bill pay and scheduled something to be paid, my wife had no idea, same if she did.
Right fucking there, banking is just broken entirely!
So no Mr. Bank, fuck you we're both logging in via the same login.
Fast forward to N00bPancakes making a thing.
So my employer has a customer (Direct Customer). Direct Customer wants a thing that makes communication with their customer (Indirect Customer) easier.
The worst thing about making something for your customer's customer is that Direct Customer always imagines that Indirect Customer is gonna be super ninja power users....
But no, that's not the case... in fact almost nobody is a power user, and absolutely nobody WANTS to be a power users.
Worse yet in my case the only reason this tool exists is because Direct Customer and Indirect Customer can't communicate well enough anyway... that should tell you something about the amount of effort Indirect Customer is willing to expend.
So with that tool, this situation constantly comes up:
Direct Customer thinks it would be great if every user from Indirect Company had some sort of custom messaging, views, and etc in of Cool Communication Tool. The reason is because that's what Direct Customer loves about Ultra Complex Primary Tool that they use ....
Then I have to fight the constant fight of:
NOBODY WANTS TO BE A POWER USER, NOBODY EVEN WANTS TO DO MUCH OF ANYTHING ON THE INTERNET THAT ISN'T SCREAMING AT OTHER PEOPLE OR POST MEMES OR WATCH SHITTY VIDEOS. THE MOMENT ANYONE AT INDIRECT COMPANY LOGS IN AND SEES ANY INFO THAT IS DIFFERENT FROM THEIR COWORKER THEY'LL SHIT THEMSELVES, FLOOD EVERYONE WITH 'OH GAWD SOME NON SPECIFIED THING IS WRONG' AND RESPOND TO EMAILS LIKE A JELLYFISH DROPPED OFF IN NEW MEXICO... AND NOTHING WILL GET DONE!!!
God damn it people.
Also side rant while I'm busy fighting the good fight to keep shit simple and etc:
People bitch about how horrible the modern web is and then bitch at web devs like we're rulers of the internet or something.... What really pisses me off about that is other devs who do that.... like bro, do you make policy at your company? You decide not to sell some info or whatever shit your company sells? Like fuck off with your 'man I miss html' because you got scared by some shitty JS error and ran back to your language of choice and just poked your head out of the the basement and got scared... and you shit on another developer about that? Fuck you.1 -
Of course, I just swiped the wrong way on my fucking laptop trackpad and list everything I just typed. FUCKING MARVELOUS.
TL;DR: Teacher stopped me from being productive. Principal almost called cops on me. Nearly threw chair at librarian.
So I'm at school yesterday, and we have a presenter in 2nd hour, so naturally, I'm gonna be on my computer doing things for other classes at the same time. Efficiency. Teacher doesn't like it, I refuse to put the computer away telling her that I'll be more productive and still pay attention, which HAS BEEN PROVEN MIND YOU, but she ends up calling security on me and I get sent down to the principal's office.
I talk to him, and he says 'Yeah, I know it's in the way, but you have to follow the directive given by the teachers.' Fine, fuck it. Won't go to her class for third hour. (I have her twice in a row for two different classes.) Next day.
I walk in, asking her if she's gonna do the same thing she did yesterday, hoping that she realized her error and will fix it, but no. She says I STILL can't have the computer out. I'm sorry, do you not realize I have 6 other fucking classes, most of which are required to graduate, unlike YOURS, as well as a FUCKING COLLEGE CLASS TONIGHT?! She gives the ultimatum. 'Obey or leave.' Fine, I'll leave. I go to the principal's office again, he must have a stick up his ass or something today because he's not budging. We argue for a while and he gives a WORSE ultimatum: 'Obey, Go to the Library, In House Suspension, or I'll call the police.' What the actual FUCK MAN?! You're gonna call the POLICE on a NONVIOLENT STUDENT?! Are you fucking MAD? I keep trying to tell him that there's an easy solution to this, but as he's getting up to call the cops, I say 'Fine! I'll go to the library!' He follows me over to make sure I don't kill anyone on the way.
I slam the door to the library open, and when I walk in, the librarian is there at her computer, and she asks 'Where are you coming from?' 'Principal!' 'I need a pass-' 'Well, I'm sorry, I can't exactly get anything for you right now, I was just sent down here.' She says 'Either way, I need some kind of note or pas-' 'Listen, I'm not in the mood for any of this right now. Please, just leave me be.' She then tries to say something, but I cut her off quickly, 'Just back off and leave me alone right now. The more you push it, the more you're gonna make me want to throw this chair!' Imagine the volume just gradually getting louder on that last one. She quickly runs out and talks to the security desk or something, which is right outside the library door, but she's the only one who comes in, thankfully. I was expecting to be fucking dragged out for no good reason. I'm loud, not violent. I have no history of violence.
So yeah. Here I am in the school library, angrily tapping away at my keyboard, trying not to throw the entire table to the fucking moon. All because this broken-ass public school system has no idea how to deviate from the norm when it's actually productive and efficient to do so. And now, the obligatory:
FUCKING PIECES OF SHIT WHY DON'T YOU REALIZE THAT YOU ARE COMPLETELY WRONG IN EVERY SINGLE THING YOU ARE DOING YOU IDIOTIC SCUM-FILLED MEAT SACKS OF NO FORSEEABLE VALUE! FUCK!1 -
my company is "pivoting" way too goddamn fast; they are pulling devs from other projects and throwing them into something that is a fragile system (was supposed to be replaced already) and is using a completely different stack than most of them usually work with. they keep promising 3rd parties that we will knock out their requirements within a week or two, and as such they are pushing haphazardly merged feature branches into production with absolutely no regression testing.
then when shit explodes and operations grinds to a halt, they tell the half of the team that actually knows how the system works to drop everything and fix it, and leave the diverted devs to continue to develop shit based on requirements drawn on a cocktail napkin, and then they fucking push both the hotfixes and the newest features at the same time.
I probably have the most tribal knowledge at this company, and they are paying me ok, so it's enough for me to just pour some rye and suck it up for the time being and milk the gig. but this can't be sustainable, right? i'm passively looking around for other work, as I've already had enough being here for over 3 years, but i'm finding most places to be slow on the application/hiring process lately due to covid.
Edit: i think i used the wrong tag here, but what the fuck ever. i haven't figured out how to tag shit properly on any platform3 -
This happened a few years ago. We started this new project that was estimated to take 3 devs around 5 months to complete. We had a meeting where the client, the project manager, me and two other devs were present. When the client asked if we were still on track to complete the project by the end of September, the PM just said “yeah we are totally on track, no worries”.
Me and the other devs looked us straight in the eyes and nonverbally agreed that this guy has to be sniffing glue or something. For context: it was August.
After the meeting we immediately raised our concerns with him and our boss. The deadline was shifted and a freelancer was hired to assist. The PM quit shortly after and a way more competent guy took over. But the damage was already done.
In the end we finished that project in February or March the following year. Client was still happy but this shit triggered a whole clusterfuck of a year. Other projects were lagging behind because of this and we had to push out project after project that had accumulated in our backlog. -
Just a quick rant on JavaScript,
So there’s a lot of people hating javascript, and while not a long time ago i was part of them, but I changed my opinion a little.
I think JavaScript is a great way to deal with website programming as it is quick and efficient, but I would not say to program directly on it, use a js-compilable language (CoffeScript, TypeScript, Kotlin(I think), etc.), but then you might say: “Well, no need for js then, compile it in byte code”. That would break the point of how I see web design/dev. The main intent behind webpages is to have an easy and fast way to send code to other computers to render them, that’s why it is interpreted: “Easy to send” and “*All* computers can handle it” with the proper browser. You need to be able to change the way the website is rendered and/or works sometimes, for diverse reasons like copy/pasting data, make it render properly or use plugins/add-ons to change that code to suit your needs.
I think js should be kept as a “readable byte-code”, so that means: {
Keep comments when compiling the js-compilable code,
Add standardized machine-readable comments that will indicate to smart code viewers how to show a particular thing (Like have a higher-end function compiled in js shown as a minimized code with explanations of the function)
Keep it nicely formated and don’t obfuscate (coz that’s annoying)
Etc.
}
So you bypass the quirks and all that pesky js stuff, while keeping it’s good sides.
-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-
Part 2:
Web design for non-web:
Ok so things like node.js, electron, react-native and all that stuff; I won’t say they’re bad but...
Why we have this is because web designers wanted to make desktop apps and were like “Hey! Making web pages is easy! Let’s port it to desktop”, the problem is: Web technologies were made to work on a restricted canvas, aka a browser. It’s good on web for reasons mention earlier and more. But it’s not on desktop! You’re trying to push it outside of those boundaries. It’s difficult to make it break that canvas and go outside, make something that really works! For social media clients and that kind of stuff that you want to make a little more inclusive, yes! it’s a great idea (hello devrantron ;), but not if it’s an exact same copy of the website, just use the website. But for things that are supposed to really make use of YOUR computer; no!
I see those PWA (progressive webapps aka mobile app, but it’s an offline website”), I stand for the same positions, social media and those sort of things: yes, great idea! Games? 🤢.
I have way more to say but I have difficulties to remember them while reading, so feel free to comment your thoughts
Lol, “just a quick rant”1 -
When you start a project with random people and they have no idea how GitHub works, but still push new idiotic changes that make the app become slower and slowerevery hour it feels bad.
But when you ask them wtf are they doing and they answer 'Sorry, I don't understand you' it is an overkill. Wth?!1 -
First rant here..
So earlier this week, on a php Laravel project, I created a set of nice new features.
The code is tested, locally all fine, I push to Github, circleCi kicks in and double checks myself, still everything green. (Just for a not, its a private project so only I work on it.)
I go ahead and merge, deploy to staging and continue on my next ticket, which is a very small one.
I call it the day, next day I pick back up where I left, test locally, all green, push... then circleCi says no.
I spend 2 days debugging, trying to figure out what is wrong without advance. I just push develop branch again, guess what also failing.
I leave it for the day as I already spend enough time on it.
This morning, I simply do a composer update, push and everything miraculously starts working.. even if there were no changes in the working branches.
Im so mad right now, and this is going in my "try this before you debug a ci" book..2 -
Started a new job as junior developer. One of my first task was to sent a simple notification on an event in out product. Write the code, test that it works, push to devops.
Code compiles, tests pass, it’s deployed to internal test env. Check that my notification works in the test env. No problem.
It’s deployed to the customers test environment. It works and customer accepts it for prod.
We release to prod and of course it fails. Seems to be a simple string.Format that fails for god knows why. After 3h of debugging on prod without success we decide to roll it back.
Today we decided to try it on a backup of the prod db since one of the strings was taken from the db. Still working. No matter what data I input when trying it locally it still wont reproduce the issue we saw on prod.
Fuck this6 -
So in the project I’m working on we were about to do a push to live, no major functionality just minor adjustments and nice to have stuff. One of the things I did was a reminder, nothing special just sends an email out if something hasn’t been done for 3 days and then sends an email every day following. Push to live and every thing goes fine with no issues. Day 1 there are no issues. Day 2 there are no issues. Day 3 and I’m inundated with people telling me that the emails are getting sent to practically everyone, shit. What have I done? What have I missed?
So I start looking at the live database hoping for a data problem, no such luck. I look at my code looking for something blatantly obvious but nothing. I start replicating the data but I can’t reproduce this bug and it’s annoying the hell out of me. I checked one of the emails that the client sent to us more thoroughly and seen that it was sent at 07:01. This is odd as our webjob runs at 1am so I start looking at environmental factors and started looking at release management, more out of hope than expectation. I check the staging environment and see that the webjob ran at 7:00. Coincidence I thought, the webjob gets packaged on the release pipeline and everything in the database was dummy data anyway but I’d better check anyway. The database was an exact copy of the live database, turns out a “senior developer” wanted to sanity check everything by running live data through the code so he copied the database over. It was fine for the first couple of days but the data was now 3 days out of date triggering my email code and I get hit with the shit storm. I’ve never met such an incompetent developer in my fucking life, functions 700 lines long, classes that are over 20000 lines, repetition every where and the only design patterns he’s used is when he picks up a child’s colouring book. I can live with the fact that he writes code like someone on their first day of University But copying a database because he wants to “visualise” the fucking data is absolutely farcical. No wonder the project is fucked with a “developer” (in the loosest possible use of the word) is at the helm. -
Fucking regulations, can’t play with twilio api.
Waiting for verification of my identity to make a fucking test call to myself.
Wanted to make a proof of concept during weekend, but won’t happen cause some fucking policies.
Fuck you government pigs.
Probably need to wait to fucking Monday. I will forget what I wanted to do till that time.
We are making your life easier all the time in the news, yeah right eat those popups motherfuckers.
Next regulation - government code reviews before push to master and programmer certification, for sure those fuckers are able to do it.
Really considering emigration from Europe right now.
No fucking point to start a business on this continent.
More fucking law please so we would need a lawyer before wiping ass.
Need to watch that southpark episode about security toilet checkout once again.2 -
Joined a new startup as a remote dev, feeling a bit micromanaged. So this week I joined an established startup as a senior mobile dev where I work remotely.
Previous two devs got fired and two new guys got hired (me as a senior dev and another senior dev as a teamlead, also third senior dev will join next week).
Situation is that codebase is really crappy (they invested 4 years developing the android app which hasn't even been released yet). It seems that previous devs were piggybacking on old architecture and didn't bother to update anything, looking at their GIT output I could tell that they were working at 20-30% capacity and just accepting each other MR's usually with no comments meaning no actual code reviews. So codebase already is outdated and has lots of technical debt. Anyways, I like the challenges so a crappy codebase is not really a problem.
Problem is that management seems to be shitting bricks now and because they got burned by devs who treated this as a freelance gig (Im talking taking 8-10 weeks pto in a given year, lots of questionable sick leaves and skipping half of the meetings) now after management fired them it seems that they are changing their strategy into micro managament and want to roll this app out into production in the next 3 months or so lol. I started seeing redflags, for example:
1. Saw VP's slack announcement where he is urging devs to push code everyday. I'm a senior dev and I push code only when I'm ready and I have at least a proof of concept that's working. Not a big fan of pushing draft work daily that is in in progress and have to deal with nitpicky comments on stuff that is not ready yet. This was never a problem in 4-5 other jobs I worked in over the years.
2. Senior dev who's assigned as the teamlead on my team has been working for 1 month and I can already see that he hates the codebase, doesn't plan on coding too much himself and seems like he plans on just sitting in meetings and micromanaging me and other dev who will join soon. For example everyday he is asking me on how I am doing and I have to report this to him + in a separate daily meeting with him and product. Feels weird.
3. Same senior dev/teamlead had a child born yesterday. While his wife was in hospital the guy rushed home to join all work meetings and to work on the project. Even today he seems to be working. That screams to me like a major redflag, how will he be able to balance his teamlead position and his family life? Why management didn't tell him to just take a few days off? He told me himself he is a senior dev who helped other devs out, but never was in an actual lead position. I'm starting to doubt if he will be able to handle this properly and set proper boundaries so that management wouldn't impact mental health.
Right now this is only my 1st week. They didn't even have a proper backend documentation. Not a problem. I installed their iOS app which is released and intercepted the traffic so I know how backend works so I can implement it in android app now.
My point is that I'm not a child who needs hand holding. I already took on 2 tickets and gonna push an MR with fixes. This is my first week guys. In more corporate companies people sit 2 months just reading documentation and are not expected to be useful for first few months. All I want is for management to fuckoff and let me do my thing. I already join daily standup, respond to my teamlead daily and I ping people if I need something. I take on responsibility and I deliver.
How to handle this situation? I think maybe I came off as too humble in the interview or something, but basically I feel like I'm being treated like a junior or something. I think I need to deliver a few times and establish some firm boundaries here.
In all workplaces where I worked I was trusted and given freedom. I feel like if they continue treating me like a junior/mid workhorse who needs to be micromanaged I will just start interviewing for other places soon.5 -
This is PART 2/2 of a series of rants over the course of a software engineering course years ago.
We were four team members, two had never failed a class, I’ll refer to them as MT and FT, male and female top students, respectively, and an older student with some real world experience who I’ll refer to as SR.
Rant 6: After the previous drama MT built the groundwork for the project without allowing us to intervene for a week. When he finally disclosed his code he gave us tasks and I was stuck unable to run the new project, due to the friction with MT I asked SR for help which took a couple of days. MT accused us of not wanting to work and claimed he’d just do everything himself. I continued working on the task improving MT’s code and committed the work, which surprised MT and told me I didn’t have to do it. He ended up complimenting my code and complained less about me as a result.
Rant 7: MT kept giving SR flak for not working and took him out of the repo, which I promptly forked just in case he tried anything scummy. SR was indeed working on certain things, but he wasn’t listening to MT’s demands, there was no team coordination. I had to act as a proxy and push some of SR’s changes myself while informing him of the state of things.
Rant 8: When MT finally added SR back and some of the tasks were cleared up, FT didn’t cooperate. She seemed to have zero initiative and always relied on MT to tell her what to do, which didn’t include coordinating with SR to get the front-end templates running. I tried getting them in a group chat but it didn’t work, she just ignored him.
I learned a few things from that.
1. No matter how smart or experienced someone may seem, sometimes people are just petty or take things too personally.
2. Top students are sometimes too focused on their grades and disregard depth of knowledge and work quality.
3. A bad team at college can somehow make something acceptable if everyone works on things that add some kind of value.1 -
Debugging WebRTC is pure hell.
For starters, it's JavaScript, so you know this isn't gonna end well. Second, it's still in kinda beta phase for some browsers so you gotta add polyfills. Let's talk compatibility now. During normal days, yeah, I could ask for a couple of computers in the office, each using a different browser. But, covid. One browser mishbehaves and doesn't wanna share the camera with the other browser, so I can't really test a connection with the only 1 computer I have. I can't take my partner's computer all day to debug.
Solution: ask the marketing department or even the execs to video chat with you to test it on a staging server. So I push my changes to the server, wait for them to build, call my lab rat, check all the bugs, clean the code, push the changes back up. No fancy breakpoints. I'm doing the old style like my great uncle did. Oh wait no, he was pretty intelligent, but my lab rat isn't. They probably don't know what a console is. So no baby I'm not only talking about console logging the problems, I'm talking `alert` the heck out of the bugs - okay no, I'll just display the objects in the middle of the screen. The screen is my console.1 -
let me preface with the fact that I'm now known at my new job for being the resident cli hipster. I can't lay any claims to knowing if it's "better" but I like it, I don't care if you do or don't, it just works for me and my flow
so at my job, we generally squash all our commits into one commit and delete the source branch upon merging; i accidentally committed all my work to an old, already merged branch, so my boss tells me it would be more of a PITA with the weird references we would encounter by merging the branch again, rather than just cherry pick the commits into a new branch, which i'm like "eh, fine.".
HIM: "You want to share your screen so we can resolve this?"
ME: "k"
HIM: "Oh, you won't be able to do this in a terminal, you are going to have to load up a GUI of some sort"
ME: "lawlz, no you don't"
HIM: "i highly doubt you will be able to accomplish that, but if you wanna make an ass of yourself, i'll humor you"
ME: "yeah, watch this"
> git log > log.txt
> git checkout <new branch>
> git cherry-pick <copy-paste-full-commit-hash-here>
> git push
ME: "done"
HIM: "what? there's no way you did it that easily, where are all your other commits???"
ME: "i usually try to amend my commits since we squash them anyhow. it really helps in situations like this"
HIM: "well, you go girl"
roll that up in your fancy degree and smoke it, why don't ya?2 -
!dev
1. It's one of those few times in life that listening to Lq's Numb doesn't make me feel less anxious. Or Somewhere I Belong. Either way, anxiety levels are on all time high.
2. I have completely lost appetite. Usually at this point in time I'd go to doctor and ask for Xanax or something similar, to chill for a few days. But covid. I ain't going to any clinic, plus, ain't nobody got time for that.
3. On top of everything, I am also PMSing. The lack of energy, times n. (n>10)
4. Struggling to get out of bed for hours is now a reality.
5. I'm glad ("glad" is exaggeration tho) this will pass in a few weeks. I am hanging on to that hope and experience tells me it will pass. But my feelings are like "nah, we doomed. Let's just run away. Or just sleep until it all passes or we die of starvation."
6. My brain must work for the next few days. If I have to push it by drowning it in sugar, I will. But I'm also obese rn. Well, I guess it's "Hello diabetes!".
7. My hands and feet are cold. Like, freezing cold. Meanwhile, the rest of me is sweating. This sucks. Ngl.
8. I feel like I'm fighting a losing battle. Like, those last stabby stabs moments in a battle where you know you're gonna fall down soon. I know this feeling of doom and gloom is PMS related, but it's there. I have no solution for that aside from nicotine and sugar.
9. I can't even cry. Which is sad.
... Do you see what's happening there? That's the loop I'm in.5 -
The worst co worker I had is actually pretty recent. He joined a well integrated team on what was basically a legacy project. He sounded like a good developer and seemed to know his stuff but it took him ages to push out fixes/features. They were always massively over-engineered, poorly named, partially tested and what documentation he did write still managed to bitch about how poor the project was structured.
He spent most of his time bitching about the general shitty nature of the project (he wasn't wrong) and the lack of interest from other Devs.
He was so unpleasant in interpersonal communication that by the end no one would work with him.
In his last team meeting he basically said he was glad to be going and that we were all lazy, disinterested and shouldn't consider ourselves his peers. The equivalent of storming out of a party after setting the couch on fire and shitting in the sink.
We've since removed all his overcomplicated, not standard, unmaintainable code. -
The CEO just made a huge huge push-over to the developers.
He doesn't have any customers/clients and wants us to push our limits to make a Service Oriented Architecture where legacy code is needed to be revived, no documentation, and a single motherfucking mobile developer who has 3 projects already in his 1st month of stay.5 -
Had a dream where I was giving update of my tasks at sprint planning meeting.rant day by day losing friends work is also going slow damn git commit -m fix_my_life since no life left perfect work-life balance git push -f2
-
Why is so hard to find engineers that actually care? It feels like the majority of people always want to do the bear minimum, no one wants to fix their shitty code even when it clearly violates the project or company standards. Everyone constantly comes up with shit about why they can't do things properly or how they'll fix it later and then get their mates to push their shit through review. The majority of lower management usually care equally as little so there's no point explaining the situation to them and the lack of care probably goes much higher. It seems like so many people go from job to job getting bump after bump in salary, which granted is absolutely fine and probably advised, but have nothing to show for it. Usually very little skills but alleged mountains of experience and a lazy piece of shit attitude. I hear all the time people saying you'll never change anything so why try and it feels like that most of the time but more because everyone keeps saying it. If everyone pulled their fingers out their arse, maybe we would stand a chance. I'm sure a lot of people on here have a real passion for computer science, whichever division you're in and love to learn and improve and reflect. What I really want to know is how you deal with people who are just taking their paycheck and enjoying the ride but don't actually care and how you discover these people as early on as possible to get shot of them.14
-
So I got my sister a new PC and being the thrifty (and masochistic) fuck I am, I thought I'd build it myself. I built the PC yesterday (side note: Stick to backplate coolers, Push-Pin is the bane of my existence, patience and fingers) and wanted to install Windows today.
I shit you not, I ran this godforsaken spawn of Satan of 'Windows Media Creator Tool' no less than 5 times with different USB sticks, different Ports, turned off AV and FW and as Administrator but stuff ain't working. After ~30min of downloading Windows each time, it always told me in usual Windows manner "Something went wrong", because who needs decent error messages anyway...5 -
I'm living it.
I started an internship at this web store made of different pieces and following no apparent rule or convention. They asked me to do this landing page, but I can't access to the development environment, nor push, create a docker, kill myself, nothing. I have to build from the DOM and write with inline style a page copied and pasted, with 300 lines of CSS already in the tpl, overwritten bootstrap 3 and two main CSS files linked. And "they don't do !important".
I wish I could say I'm learning a lot, but not. My life has become a waste of hours trying to please a company stuck and aged. -
After playing et and wow a few year it all started when I hosted my own ts2 server with npo license. Rented a server for 90 bucks as a highschool student (13) with no job. (Who the fuck rented to me? I had my own bank account and lied about my age. Had a credit card at 14 but that's another story)
*Shit is expensive*
How does one get some value out of a server? Oh right, let's host Webspace and ftp accounts.
That got me into server administration and bash.
After dropping wow in bc i started playing on private servers.
*Shit is buggy*
How do you fix wow server? Let's learn c++ and push patches to arcemu. Why is this part crashing on this one server? Let's look at the binary. Wtf is this? Oh assembler?!? Ok let's try to read this. Ok I get it now. Let's fix the code.
Ok let's host my own wow private server. We need a website for account creation.
Let's learn php. Wait php is easy compared to mastering c++? I need an app for my first smartphone (iPhone 3g) to manage the server on the go. Let's learn how to do that. Why is this so easy? Switching to Android: wait java is even easier?
And that's how I learned that if you start with the hard part and grasp the concept, everything more abstract is significantly easier. If you start to read code to learn any language it's easier then following books (for me at least). If you get an error, track it down, you might learn amazing things in the way.
And if you want to get into reverse engineering, start by being passionate for the thing you want the reverse. It will be hard before it gets easier and you will need all the willpower you can muster not the just stop.
Programming for me is not a job but my passion. It's like I'm on vacation every day of the year (expect meetings, fuck meetings)2 -
So I fix a bug and I create a PR, someone reviews it and leaves a couple of comments, I address those comments and push up my updated code thinking “great I should be ok to move onto this big story waiting for me”
Then some Expletive.random(); from a totally different team who has no context of my change comes in and starts leaving petty comments. He literally pointed out 3 different things that could be made private/package-private.
Bugger off and focus on your own team’s work instead of leaving comments about relatively trivial things on my PRs.
Apparently he is well known for this. I can tell we are gonna have some fun encounters...1 -
The "Gratitude" emoji pack recently introduced to Slack. They're basically "Thank you" in different languages.
Among others, there is a Russian "спасибо", but there is no Ukrainian "дякую".
What's up Slack? Didn't you paint your logo blue and yellow when the war started?
If you're gonna push your "please don't cancel us" marketing BS like all the other companies, at least be fucking consistent.8 -
fucking flutter.
i'm trying to make a simple app. it would be an easier to do both natively.
for fucks sake flutter, add some functionality. flutter recently got out of beta but it's not fucking done. no native webviews, no native push notifications. fuck that.
however, i do have to give credit where credit is due. coming into flutter i expected a different feel of the app on iphone and android. it was exactly the same, and it was smooth too. in that respect, i love flutter.
also guys, i have an app (not finished yet) i built with flutter and i would like some constructive criticism for changing the ui. only android right now though, i can't afford ios.
dictive.app/download6 -
Why fucking my coworker push not compilable code on master branch??
Ok we are developing it, no yet release but I can't compile it for my tests.4 -
I just want to play my bullet hell games and watch panel shows at the same time, but nooooooo. Windows needs to push all windows all the way to the right to a seemingly non-existing monitor. And I've tried all the "Adjust Deskotop Size and Position" options there are with absolutely no luck.
What makes it even worse is when I google the issue I get tonnes of solutions like this: https://superuser.com/a/420927
"Just set the games resolution to your monitors resolution", which I can't!
Oh but I can use ResizeEnable to make it possible to, well, resize the game in windowed mode, which used to work great but has since begun to make the game stutter :<5 -
So arround a month back , I was watching videos and photos I clicked in the vacation I went.
All the photos and videos were in a 1TB harddisk and I connected to my TV for better viewing experience.
In the mid way, I had a power cut and suddenly TV switched off.
This was not supposed to happen because my inverter has to kick in !
Fuck it , something happened to my inverter and delay was just enough to switch the TV off.
Now TV is on , harddisk is recognised and
Hell yeah! There are no files in the harddisk!
I lost my shit !, Before I do any thing, I tried to recover the files, luckily some vacation images and videos were recovered but all of my project source code(the ones I Did not push it to github, those were done when I was learning), most of my documents etc.. were gone!
May not be the worst one , but I lost all my coding memories.I mean those projects were done in my school times.2 -
go fuck yourself with your fucking communities. i went into computing because i like being left alone. who are all those fucking freaks building their communities? this is capitalism mother fuckers, everybody in the world agreed on it, on each person being an independent individual doing their job to the best possible standard, instead these low-skill low-iq oversocialised sheeple started conglomerate into communities and brainwash everybody that this is what it is about. get stuffed alright. all my life i've been introverted, just leave me alone to write code alright? take my library i don't mind i'll take yours no strings attached, just push the code and forget about it. but no, all these degenerate morons without CS degrees have occupied our safe space, pushed us out of it and just can't get enough of using the buzzword "community-driven" "volunteers" volunteer my ass assholes you can't even make software nobody in real industry needs you because you have no skill at all you learn a bit of js which is any 14-15 yo can do and now think you're some kind of prodigies, unsung heros of humanity who selflessly bring the progress. nothing can be further from the truth - because of you we don't have real software, we don't have investment we don't get no respect everybody walks all over software engineers treating us like shit, there's an entire generation of indoctrinated parasitic scum that believes that software tools is grown for them on trees by some development teams that their are entitled to automatically, because some corporation will eventually support those big projects - yeah does it really happen though - look at svelte, the guy is getting 50k a year when he should be earning at least 500k if he had balls to start a real businesses, but no we are all fucking prostitutes, just slaving away for the army of people we never see. are you out of your mind. this shit should be fucking illegal alright it's modern day slavery innit bruh, if a company wants to pay their engineers to work on open source this is fine, i love open source like java or google closure compiler, but it's real software made by real engineers, but who are all these community freaks who can't spend a 10 seconds on stage in their shitty bogus conferences without ringing the "community" buzzer? you're not my community i fucking hate your guts you're all such dumb womenless imbeciles who justify their lack of social skill by telling themselves that you're doing good by doing open source in your free time - mate nobody gives a shit alrite? don't you want money sex power? you've destroyed everything that was good about good olde open source when it was actually fun, today young people are coerced into slavery at industrial scale, it's literally impossible to make a buck from software as indie unless you build something really big and good, and you can't build anything big without investment and who invests in software nowadays? all the ai "entrepreneurs" are getting fucking golden rained with cash while i have to ask for a 5$ donation? what the actual fuck? who sanctions this? the entire industry is in one collective psychotic delusion, spurred by microsoft who use this army of useful idiots to eliminate all hounour dignity of the profession, drive the abundance and bring about poverty of mind, character, as well as wallet as the natural state of things. fucking amatures of course you love your shitty little communities because you can't achieve anything on your own. you literally have no personality, just one homogenous blob of dumb degenerates who think and act all the same. there used to be a tool called adobe flash builder, i could just buy it, then open and make a web app, all from start to finish in one program, using tutorials of adobe experts on youtube, sure it might have had its pitfals but it was a product - today there's literally no fucking product to make websites. do you people get it? i can't buy a tool that i need to do my job and have to insult myself by downloading some shitty scripts from some shitty unemployed devs and hope my computer doesn't blow up in my face in the process because some freak went off his nut and uploaded some dodgy ass exploit on npm in his package. i really don't like. it's not supposed to be like that. good for me i build by own front/back end. this "community" insanity is just a symptom of industrial degeneration, they try to sell it to us like it's the "bright" communist future but things never been worst, i can't give a shit about functional programming alright i just need to get my job done mate leave me alone you add functional because you don't know how to solve the problem properly, e.g., again adobe flex had mxml where elements had ids and i could just program to id, it was alright but today all this unqualified morons filled the whole space after flash blew up and adobe execs axed flash builder instead of adapting it to js runtime, it was a crime against humanity that set us back to 1000s5
-
Rant && SPAM alert!
I'm learning QML, to create plasma widgets and I wasted all the fucking day fighting with layouts and trying to understand why the settings window was not rendered (now it's rendered but I still don't understand why it wasn't before, the code is the same!)
so at the end of the day I ried to apply what i learnt in a fresh new widget that shows (some) PiHole statistics from its API.
on first run:
it runs fine, no errors... ok let's do some tests... turn off network, whole DE freeze WTF!?! one widget error (network error in this case) can freeze the whole DE.
restarted plasma, FIXED the bug (debugging process basically is:
try something - freeze - restart plasma - repeat
),
No more freeze!
if you're a KDE and pihole user and you want try my widget:
https://github.com/ShellAddicted/...
P.S: I'm adding right now a switch to quickly enable/disable pi hole over API directly from your desktop. i will push tomorrow.4 -
When your boss says "no more testing cycles until July because we've ran out, just push the builds" 🙃🙃🙃 🔫🔫🔫
-
Just needing to vent a bit...
We start off with classic asp.net & Xamarin. K.
Then we run into the shitshow that's lackluster documentation and heavy push for asp.net core.
Whatever, will just handroll things.
K. Azure is quickly turning expensive..
Well let's find alternatives.
Yeah, no Linux ain't gonna work.
Wanna shell out for a windows server? Nah.
K. Well, let's rewrite in asp.net core then.
Nginx proxy passthrough to kestrel. Ez.
Now.. wtf is the deal with mssql behaving like a turd on Linux?
Oh now some security jibber about telemetry and adding Microsoft keys to root.
Whatever. I can do PHP & MariaDB then.
1001 things wrong about Xamarin now.
Mostly performance related.
Especially cuz custom renderers for everything.
& Abused onPropertyChanged.
Uh la la, look at that sexy thing called react native.
Hippytyhop new tool for the job.
Ugh wee, what's this ? Customer impatient & deadline for months worth in Xamarin => 1 week.
Whelp I be fudge..6 -
"Here’s to the crazy ones. The misfits. The rebels. The troublemakers. The round pegs in the square holes. The ones who see things differently. They’re not fond of rules. And they have no respect for the status quo. You can praise them, disagree with them, quote them, disbelieve them, glorify or vilify them. About the only thing you can’t do is ignore them. Because they change things. They invent. They imagine. They heal. They explore. They create. They inspire. They push the human race forward. Maybe they have to be crazy. How else can you stare at an empty canvas and see a work of art? Or sit in silence and hear a song that’s never been written? Or gaze at a red planet and see a laboratory on wheels? While some see them as the crazy ones, we see genius. Because the people who are crazy enough to think they can change the world, are the ones who do." - Apple Commercial2
-
Long story ahead
Background:
I recently started a job in a smallish startup doing web development in a mostly js stack as an entry-junior engineer/dev. I’m the only person actively working on our internal tools as my Lead Engineer (the only other in house dev) is working on other stuff.
Now I was given a two week sprint to rebuild a portion of our legacy internal app from angular 1.2 with material-ui looking components with no psd’s or cut-outs of any kind to a React and bootstrap ui for the front end and convert our .net API routes into Node.js ones. I had to build the API routes, SQL queries (as there were plenty of changes and reiterations that I had to go through to get the exact data I needed to display), and front end. I worked from 9am until 11pm every day for those two weeks including weekends as our company has a huge show this upcoming week.
I finish up this past sunday and push to our staging environment. The UI is 5.5/10 as we’re changing all of our styling to bootstrap and I’m no ui expert. The api has tests and works flawlessly (tm).
So we go into code review and everything is working as expected until one tab that I made erred out and was written down as a “Needs to be fixed.”
This fix was just a null value handler that took three minutes and a push back to staging, but that wasnt before a stupendous amount of shit being flung my way for the ui not looking great and that one bug was a huge deal and that he couldnt believe it slipped through my fingers.
Honestly, I’m feeling really unmotivated to do anything else. I overworked myself for that only to be shit on for one mistake and my ui being lack-luster with no guides.
Am I being a baby about this or is this something to learn from?1 -
So the project I work on basically has to talk to a 3rd party plugin, through a 3rd party framework. The 3rd party plugin is a black box. This conversation happened:
Software guy: so we aren't sure what is breaking the thing. It's either us or the plugin, but it's probably both.
Systems guy: well then if we aren't sure then why are we writing an issue for it.
SWG: because we aren't sure but we know we are doing at least something that contributes. We read int X from a table and put it into a float. X doesn't perfectly represent in a float. It comes out X.0001. Then they take it and when it comes back it comes back as Y.0001. We cram it into an int so it becomes Y, we compare it to X which is really X.0001 and it comes back invalid.
SG: well as long as we are sending them the right number . . .
SWG: but we aren't sending them the right number. They are expecting X not X.0001. Then they send us back Y.0001 but it should be X so it's wrong.
SG: so they're giving us the wrong return value.
SWG: yes, but because we're giving them the wrong number.
SG: well not exactly . . .
SWG: yes exactly. It is off by .0001 because of floating point math.
SG: well . . .
Me: look it doesn't matter how it's breaking. But it IS broken. Which is why we're filling out the damn problem report. THEY ARE EDITABLE. We talked to the customer and gave them the risk assessment. They don't care. It happens rarely any way.
SG: then can we lower the severity?
Me: no. Severity doesn't relate to risk. That is a whole different process. Severity assumes it has already happened. It's a a high severity.
SG: but the metrics.
Me: WE GIVE THE METRICS TO THE CUSTOMER. WE TALKED TO THE CUSTOMER. THEY DON'T GIVE A SHIT.
And that was how I spent Wednesday wondering how a level 4 lead systems engineer got his job. How many push ups did he do? What kind of juice did he drink?2 -
What makes you nervous no matter how many times you do it?
- Job Interviews and 'git push' at times5 -
Finally made my node production server stable enough that I could focus on writing tests*. I start by setting up docker, mocking cognito, preparing the database and everything. Reading up on Node test suites and following a short tut to set up my first unit test. Didn't go smoothly, but it's local and there are no deadlines so who cares. 4 days later, first assert.equal(1+1, 2) passes and I'm happy.
I start writing all sorts of tests, installing everything required into "devDependancies," and getting the joy of having some tests pass on first try with all asserts set up, feels good!
I decide to make a small update to production, so I add a test, run and see it fail, implement the feature, re-run and, it passes!
I push the feature to develop, test it, and it works as intended. Merge that to master and subsequently to one of my ec2 production servers**, and lo and behold, production server is on a bootloop claiming it "Cannot find module `graphql`". But how? I didn't change any production dependencies, and my package lock json is committed so wth?
I google the issue, but can't find anything relevant. The only thing that I could guess was that some dependencies (including graphql) were referenced*** in both, prod and dev, and were omitted when installed on a prod NODE_ENV, but googling that specific issue yielded no results, and I would have thought npm would be clever enough to see that and would always install those dependencies (spoiler: it didn't for me).
With reduced production capacity (having one server down) I decided to npm uninstall all dev dependencies anyway and see what happens. Aaaaand it works.....
So now I have a working production server, but broken local tests, and I'm not sure why npm is behaving like this...
* Yes I see the irony.
** No staging because $$$, also this is a personal project.
*** I am not directly referencing the same thing twice, it's probably a subdependency somewhere.2 -
So, it's been a while since I've been working on my current project and I've never had the "luck" to touch the legacy project wrote in PHP, until this week when I got my first issue.
And damn, this goddamn issue. It was a bug, a very strange bug, that only happens in production and that nobody has any idea what was happening, so yeah, I didn't have anyone to ask and I got less time than usual ( because Thanksgiving ).
And thus, I have no starting point, no previous knowledge on PHP and less time! I expected a very fun week 😀 and it was beyond my expectations.
First I tried to understand what might be causing the issue, but there wasn't any real clue to star with, so no choice, time to read the flow on the code and see what are they're doing and using ( 1k line files, yay, legacy ). Luckily I got some clues, we're using a cookie and a php session variable for the session, ok, let's star with the session variable. Where it's that been initialize ? Well, spoiler alert, I shouldn't start with that, because my search end up in the login method of the API that set a that variable and for some reason in the front end app it was always false and that lead me to think that some of the new backend functions were failing, but after checking the logs I got no luck.
Ok, maybe the cookie it's the issue, I should try open the previous website on the brow...redirect to new project login, What? Why ? I ask around and it's a new feature push on Monday, ok I got Chrome Dev tools I can see which value of the cookie it's been set and THERE IT WAS it has a wrong domain! After 2 days ( I resume a lot of my pain ) I got what I've been looking for, so now I should be able to fix the bug. Then where is the cookie initialized ? In the first file the server hits whenever you tried to enter any page of the app, ok, I found the method, but it's using a function that process the domain and sets it correctly? wtf ? Then how in heaven do I get the incorrect domain ? Hello? Ok, relax, you still have one more day to fix this, let's take it easy.
Then, at the end of the Wednesday, nope I still have no clue how this is happening. I talked with the Devops guy and he explain me how this redirection happens and with what it depends on, I followed the PHP code through and nothing, everything should works fine, sigh. Ok I still have 2 days, because I'm not from US and I'm not in US, so I still have time, but the Sprint is messed up already, so whatever I'm gonna had done this bug anyhow.
Thursday ! I got sick, yay, what else could happen this week. Somehow I managed to work a little and star thinking in what external issue could affect the processing, maybe the redirection was bringing a wrong direction, let's talk with the Devops guy again, and he answer me that the redirection it was being made by PHP code, IN A FILE THAT DOESN'T EXIST IN THE REPOSITORY, amazing, it's just amazing. Then he explained me why this file might be missing and how it's the deployment of this app ( btw the Devops guy it's really cool and I will invite him a beer ) . After that I checked the file and I see a random session_star in the first line of the code, without any configuration, eureka ! There was the cause and I only need to ask someone If that line it's necessary anymore, but oh they're on holiday, damn, well I'll wait till Monday to ask them. But once and for all that bug was done for ! 🎉
What do I learn ? PHP and that I don't want any more tickets of PHP 😆. -
On the MSc I was participating in, there is a teacher that has a lesson about Databases.
The MSc was not only for experience computer science students. We were informed that the first semester would be as an introduction to all.
So, Databases. No introduction at all. Just read the powerpoint and the pdf he had just translated (or not, because some were just from the internet), just refers to how they are structured briefly. He showed everything about Databases without the students that didn't know much to be involved (we didn't get to our lab for some reason) and then there was his assignment.
His assignment was written as it would be from a customer that knows shit about Databases (sorry but I had to rant). We sat down student's that knew already Databases and some of us worked as database engineers. We agreed on some steps that after read the next chapter of the assignment we reconfigured them. And so on, until we had nothing and we were back at the beginning.
Needless to say, I did not lose my Christmas holidays for him. It took me 2 days after to build a database that was not a full solution but a part (I wad noy sure, the assignment was ambiguous). I passed the lesson with the minimum passable grade.
So, I wrote a nice email to the MSc teacher that had to organize it (or something like that). I did not swear at all. I was professional and wrote what I encountered and what it should have been. The Databases teacher had always that smirk and face that he was THE boss and had no respect for his own lesson. But I didn't mention it. The organizing teacher shared the email with the databases teacher.
And the time came that we had another lesson (web development, it was awful under him) with the databases teacher. And he had the wonderful idea to read the email out loud in front if everyone. He did noy mention my name. I raised my hand and told my colleagues it was me. Then I asked him in front of them, if he was contented with the results (only a few passed the databases lesson and max grade was the smallest passable), first he avoided the question. I asked again. And he said yes. We all looked at each other and somehow knew. No one spoke and I didn't push because I didn't want to take the web lesson's hours for this. It was just hopeless.
From there on, the teachers said we were their best class ever but the most complaining one. They didn't even bother to analyze the "complaints".
So, there you go. One of the lot of those teachers.1 -
TGIF & remember..
DO NO FUCKING PUSH TO PRODUCTION TODAY!
DO NOT FUCKING RELEASE A NEW VERSION OF THE CLIENT APP!
FUCK!!
have a nice weekend partners 🤗1 -
Here some more information to despise Apple.
In the past few weeks I keep having a problem making the iMac connect to whatever website/host, so I had to rerun whatever I had to do: fetching from github, push to github, connecting to a LAN server, pinging to know to IP, accessing a webpage and so on.
Luckily enough, browsers tend to request again if an error occurs.
At my job, I upload app files to servers, like GooglePlay and AppStoreConnect.
For those who don't know, Google makes you upload the app through the browser (among other ways) while Apple requires you to upload your app either through XCode. No other possible ways.
Whenever XCode requires an update, the authentication is required, but the authentication server cannot be reached for at least 5-6 tries.
Then I have to upload the app and just to be ready to hit the "upload button" it takes like 3-4 minutes, which might be completely useless if a network error occurs.
How hard is it to make your fucking app-loader to try again at least a few times?6 -
So working for a company and the dev team I’m apart of works on a legacy rails app. Technical debt is high, no automated tests, no proper routing and also running unsupported versions of the language.
I joined seven months ago and got the current team doing automated testing so that’s a plus, they bought this app four years ago and there’s been no language updates, testing, cleanup, security updates, nothing, just adding to bad code.
Now we’re looking to actually upgrade language versions, the language and the framework now this will cause a lot of stuff to break naturally due to how outdated it is.
So I started putting proper routes into place how things should of been when things were being built as we have some spare time I decided to go out of my way to clear up some of the technical debt to get ahead of the curb. Re-done an entire section of the app, massive speed improvements, better views, controller, model, comment clean up and everything exactly how it should be.
I push the PR,
*other dev* - “why are we doing all of these other changes”
*me* - “well to implement routes properly, we have to use the new routes I just did some extra cleanup along the way”
*today, me* - “can you lend me a hand with one of the routes the ID isn’t getting passed”
*today, other dev* - “this wouldn’t of happened if you didn’t redo all these files, let’s just scrap the changes”
…
Sooo, I’ve spend three weeks improving one section in the app, because I’m having issues with one route according to this dev I should scrap it? Wait come again, am I the only one in this team who cares about making this app better all round?
Frustrating…4 -
"It is pointless to use just a fraction of the data in a homologation environment"
Those words reveal the truth in our creed.
We work in the deepest of back-ends to serve the front.
No data is true. Everything can be edited.
We are Data Engineers.
And for those words to take hold, a junior must execute a leap of faith, and push a hotfix into production.5 -
Me: [jira comment] We have similar text for the mobile version of the site already. [includes screenshot of what site looks like now] Are you sure about this?
[radio silence for a few hours]
Me: [slack] I want to follow up.
Web Operations: What’s the issue?
Ooh k. Slack messages can have a tone.
Me: I just want to confirm we’re not repeating copy.
Web Ops: We’re not.
I complete the ticket and submit for review. The C-suite for my department reviews.
C-suite: [to web ops in JIRA comment] This looks weird. Is this right? [sends screenshot of my work because there is repeated copy, like I said there’d be]
Web Ops: [in JIRA comment] Oh, I thought X was questioning the request. X changed the wrong text.
C-suite: The website has always looked like that. You’re looking at X’s screenshot for the current website. Look at the screenshot I sent over.
Later, I complain because web ops was completely unprofessional with the comment about “questioning the request.”
C-suite: Web Ops is working hard. It’s our busy season and it’s their first time dealing with it. You know, I’m going to teach them some css and html so they can make content changes in the CMS and they’re not sending over changes so often and bothering you.
Me: [to myself] 🤨 wtf so it’s ok for web ops to treat me like dirt. And in writing. And with service that’s version controlled—JIRA emailed web ops comment to me. And lol no 😂 on teaching them how to code. That’s such bullshit. We all know you’d never allow them to edit the CMS because they’d fuck up the site. And they wouldn’t do edits anyway because it’s beneath them. And idk how this relates to web ops gross behavior.
A few days later.
Me: I was offered a job elsewhere. Here’s my two weeks notice.
C-suite: Can you push back your last day? It’s our busy season.
Me: Nope. Bye Felicia.1 -
Someone once forced my team to make something live on a Friday, that wasn't ready and wasn't tested properly. I said no and had to go pick up the kids from school. Found out later they made one my team stay late to finish it and push it live, even though I told everyone to leave on time.
Lots of meetings the week after where I got told off for standing up for my principles. Eventually reached an agreement.
At least some common ground was found and changes were no longer pushed before the weekend. -
In SublimeText, I noticed that my markdowns formatting was not showing up correctly— I decided to download the new markdown package altogether hoping for some kind of update/fix. Turns out the package comes with a super ugly color theme which overrides the default theme of SublimeText. After some googling and experimenting, I found way to override this through the package settings. I always use git through my terminal but I thought let’s try to use git through my code editor and see how it works. I downloaded the git package but then I notice that git tool shows status and all correctly but doesn’t push files to GitHub (it says fatal: unable to read current working directory). Then I download another application called SublimeMerge. It works correctly on its own (pushes files to GitHub) but SublimeText is still not doing the same. Then I tinker around with my SSH keys hoping for a fix, but nothing works. I even go to stackoverflow and search for a solution but I find nothing (I even wrote a post asking for a solution but no replies till now). Fuck it! I now open the file with VSCode. Open terminal within VSCode and add/push/commit through it and everything works perfectly. So goodbye SublimeText I guess 👋🏾11
-
#RANT_AHEAD
Almost everyone nowadays uses a PC, Laptop, Smartphone but sadly not even 60% of the total potential of the hardware is being used.
.
And no - you don't require custom cooling to use the whole 100% of the total potential, stock cooling is more than enough.
.
IRL "programmers" these days don't do any fscking effort to optimise their code and give it all up as some kinda shitty "hot patch" - code of their looks disturbing with no security features + optimisation. (wAnBlOwS products remain an example)
.
Even when you're using python you can push your project to limits. Instead of shoving face-size ASCII banners why don't chaps stress test their projects? Oh I forgot the community runs on show-offs and CVs ...
.
Note to Self : Optimisation is the key to integrate Technology with Nature.2 -
Why is 99% of my development job responding to audits, security questions, and idiocy spewing from something called an “Office of Innovation”? So this Innovation team sends down a project request which is silently intended to push my resource allocation over 100%. Security shoots down the idea. Innovation team tells me to tell security no, we need this. Ummm, here’s a thought, why don’t you idiots all get together and tell me when there’s some coding to be done?1
-
Because of the amount of complaining I do at work concerning legacy php applications the HOD is trying to push for different technologies to use for backend services. We have met multiple times to discuss the proper way of handling the situation since there are a lot of very obvious things to consider regarding the push for a new tech stack. The typical names have come about, but my biggest issue will be training people for these stacks.
Testing environments with docker and so forth, push for CERTAIN applications to be more API centric and the use of better frontend frameworks that will remain standard for years to come(hard to bet on this one but I tend to orefer React) among other things are the topics of conversation.
Personally I would love to move the shop to something geared towards Golang, thing is, the lead dev is complaining about it saying that the training for a new language would just take time. After a couple of examples he is still not convinced.
I think its wrong of him to center himself on just PHP and JQUERY as the main development stack he uses and learning new things should be part of the job, I also have a case against the spaghetti code that results from just using vanilla php with no proper development practices(composer based systems, oop etc etc you get the gist)
In the end I am starting to think that it will become one of those "fuck off I am the boss" type of deal since I am going to be here after a long time and he has about 2 years before he medically retire.1 -
FML when the code that runs every 10 minutes to check and bill a customer keeps charging him and the logs are terrible plus you have no idea what the issue was so you have to push production code to test and fix.
-
I am tired of a glorified code monkeys cosplaying software engineers.
Disclaimer: in general, I have immense respect to engineers and technological advances that came from FAANG/MANGA. Bbbuuuuttttt...
Especially people that has a few relatively short (less than a year) stints in a few of them and thinking that their salary expectation for their skills is reasonable.
What I've saw so far, based on a few hires for past few years in a company of ~50 engineers, Python/JavaScript stack, monolith to microservice transition (all people had senior and above titles):
* Have no idea how to setup own development environment on MacBook.
* Have no idea how to run code and tests for Python (from discussion, the two only development experience was "code - commit - push - done" and "clicking button in remote coding environment".
* Have no idea how to use bash/zsh (the person had "Linux skill up to 11").
* Grinding leetcode and interviewing during work hours (were let go immediately).
* Introducing a new microservice for each task (we're transitioning from Django monolith, but not to that extent).
* Ignoring all the onboarding, documentation and ignoring every request for writing documentation "I am not a technical writer".
* Knowing nothing about Kubernetes (this was in the job posting/requirements).
* Person actively hostile to any frontend task (the position is not full stack, but JavaScript is a required skill).
I am pretty open and I understand the eternal "generalist vs specialist" thing, but if the person do not posses certain skills and actively lie about it, just because "I worked at FAANG companies, obviously I have that skills" - it's dishonesty at best and fraud at worst. And if with the end of ZIRP you suddenly became unhireable in FAANG/MANGA - you need to think why.
There are tons of small software companies that nevertheless have a good salary and benefits, and most of the time hiring was a breath, because for the most of the people they were flying under the radar.
Unfortunately, since this year the hiring is exhausting, the amount of incapable candidates is incredible (a lot of them with credentials), and instead of 10-15 candidates per position (before and during pandemic), now there are more than 300 candidates per position with "impressive" working experience and only 10 people who really spend time on interviewing.
In short, if you think you're worth gold only from 3-4 companies in the world and all of them stopped hiring you - you should rethink your worth.3 -
Shows perfect results.
PM: Nice, integrate that into the latest version.
Shows bad results.
PM: Your integration must be wrong.
Show him the file diff, no difference in my implementation.
It's funny how the exact same feature goes to shit immediately after they push all these untested changes. -
I like rants that are thought provoking and push a message forward regardless of whether they may sting a little, so for my first post on here I'd like to hit at home with many of you.
Html5 "Native" Applications are not needed. Let's cover mobile first of all, the misconception that apps are written in either javascript or Native android/ Native ios environment. Or even some third party paid tools like xamarin is quite strange to me. OpenGL ES is on both IOS and Android there is no difference. It's quite easy to write once run everywhere but with native performance and not having to jump through js when it's not needed. Personally I never want to see html or css if I'm working on a mobile app or desktop. Which brings me to desktop, I can't begin to describe how unthought out an electron app is. Memory usage, storage space for embedding chromium, web views gained at the expense of literally everything else, cross platform desktop development has been around for decades, openGL is everywhere enough said. Finally what about targeting browser if your writing a native app for mobile and desktop let's say in c++ and it's not in javascript how can it turn back into javascript, well luckily c++ has emscripten which does that simply put, or you could be using a cross complier language like haxe which is what I use. It benefits with type safety, while exporting both c++ and javascript code. Conclusion in reality I see the appeal to the js ecosystem it's large filled with big companies trying to make js cross development stronger every day. However development in my mind should be a series of choices, choices that are invisible don't help anyone, regardless of the popularity of the choice, or the skill required.8 -
So.
I just sat here and listened to some awful gibberish that sounded kind of like the language a person would use to describe logistics or construction, but that still lacked so much filler language that a straight spew of jargon doesn't seem likely.
reminds me of every single time I hear someone describe new technology that ends up bombing.
like the push towards graph databases which I personally can't understand the underlying storage mechanism which would make them work
of someone describing locks to your house that can be unlocked from a cellphoen over the internet.
or 2 form factor authentication and what happens if you lose your phone and there is no customer service ?
on that last maybe they could take a sample of every customers voice every year or a fingerprint or a blood sample :P1 -
I feel like Git could have come up with a better name than "force push".
It just doesn't seem right... If your codebase doesn't want your commitment, you really shouldn't force yourself on them. No means no god dammit!3 -
So, I was doing some basic engineering project at uni with a teammate but we didn't realize that we were working in a detacted head state in git (due to poor set up of the working environment on his part).
After a 3,5 hours of work, we need to push to the repo and we get an error.
I take control to try to understand what was going on, and in doing so, I (mistakenly?) check out to another branch.
Git garbage collector kicks in and we can't checkout to the previous branch anymore (where all the work was made).
My friend panics and calls the professor, who explains to us how we lost everything and there is "a 100% no hope of recovering our work".
Felt like poop. But wasn't satisfied. I had read somewhere that you don't lose stuff so easily on git. Went home.
After five minutes I was able to recover everything through git reflog feature.
Moral #1: professors should know about the existence of reflog
Moral #2: please use git plug-in in your bash /zsh. Please.1 -
Jenkins' triggerManualBuild randomly but if so then consistently produces 500 errors for certain newly created jobs. I haven't really found a pattern, yet I was bit by it in the past already. I used to "solve" it by deleting the offending job and re-creating it.
Now, I have this annoying issue again, and no matter how often I re-create that shitty one-liner job in the pipeline, it won't trigger. (The job itself is fine. It's the actual trigger that is broken.)
It's not like it's important or anything, as this is basically only the "push to production" step.
FML. And fuck me for stating: "Creating a delivery pipeline should be straightforward. I therefore consider 1 storypoint enough."4 -
Client push back: when the client wants an impractical feature to be implemented and you tell them HELL NO, with a little sugar coating of course
-
This is why you shouldn’t try to redefine words and deviate from accepted word definitions.
Dev team/product decides to put the word [content] in a JIRA ticket’s title. To dev, this means “it’s a CMS change and no code push required.”
A new marketing team comes on board along with a few “website manager” type folks. They start putting [content] in JIRA ticket titles, but they think [content] means content change and their requests do require a code push instead of a CMS update.
First time it happens, I comment on the ticket and tag the reporter. I explain what [content] actually means for us. Most importantly, I explain that it tells us how to prioritize the request and how to deploy the changes.
Happens again. And sometimes they’re requesting changes for the next day when we only do weekly releases. I suspect they didn’t believe me because I’m lower in the chain. It’s also easy to forget because we are using “content” to mean something different here. I ask my boss does [content] still mean what I think it does? It does. 😕
I just decide to comment on the ticket and let them know the request requires a deploy and that’s why I’m changing the title of the ticket. They might also have to wait until the weekly release.
Overall, a bunch of lunacy all around.11 -
The bipolar nature of leading a startup tech team:
It's either no one needs you, or the problem is big enough to have you push 5 fundamental fixes from abyss to upstream.2 -
First post and of course it's a rant.
I work for a mid sized development agency with approx 50 developers heading up the main development backend team.
So, on this one project the head of design goes through the client agreed spec but starts adding loads off additional UI elements and data that isn't in the spec, isn't collected anywhere and isn't needed
When reviewing the mock ups I raise this and push back saying it all needs to be taken out as we dont have that data and that the additional elements are not recoverable in the sprint time.
Designer sends the mockups to the client anyway and gets sign off from the client, who now expects all this additional work in the same sprint and at no extra cost to what we agreed for the sprint.
After an aggravating day trying to figure wtf we are going to do, I end up working until 3am (having started at 8am the previous day) implementing the addition shit, which needed to be collected and surfaced throughout the entire back end.
Owner of the business walks in this morning and gets told by the management team about how late I was working and what had gone on.
His response........
Pay for all employees in the business to have a takeout lunch on the company.
Best of it all, I was so busy catching up on the shit I should have been doing, that I didnt even get my free food!!!!
Why do designers think everything is so simple and just takes a few key presses?!?1 -
There are some who view software as a social construct (like Pieter Hientjes), and I think it's a valuable perspective. So if we know about the intrinsic brokenness of software, can we deduce sth about the brokenness of human interactions? Did social API's evolve to similar clusterfucks of dead entropy we have to shovel in our brains to get along?
I think the answer is an emphatic yes. And you know what's even making it worse? Software. Y'know there are all these whining about the millenials, and I too have had my experiences with stuff of that category. Like back when we searched a new roommate for our flat, we needed three rounds because people who had said yes suddenly reconsidered. Similarly now when we tried to sell our couch: people tried to push the price. Said they were interested, never showed up at the appointed time. It's like they have been spoiled by Amazon: expecting to buy with one click, for the cheapest price and send back if they don't like. And that is not a generation thing. Those old blokes ranting on the young are just as bad. They are just as lost in antisocial media as anybody else. It's a general erosion of not sticking to civility and courtesy, to the yes or no once said, coz everything is now as flexible and fluid as the digital projections of ourselves transmitted round the globe, changing in realtime.
I fucking hate it. - I'm out like this stupid Tom Cruise character in Oblivion.6 -
Sometimes I really wonder about the elites supporting the woke culture, BLM movement, to the point saying "All lives matter" they go nuts is rather sinister. ie push the needle too far beyond the cringyness and use reverse psychology mechanism to bring maximum hatred as possible to the opposing group to the point of creating wars and conflict
There is a saying that goes "Only a crisis - actual or perceived - produces real change." So could be that to bring back the war economy.
I mean history is filled with such tactics on a grand scale: Nero, Hitler, Neocons such as strauses, Wolfowitz (lookup wolfowitz leaked doctrine), drumsfied, nuland leading the Iraq war (it did bring people together for a while before they realize it was a sham). And now same thing with China and Russia.
It makes no sense otherwise for the elitists to support it.13 -
VP last week: No you can't have that equipment that fakes out the gps. It's very expensive and not in the budget. Just run valgrind and push your code so we can deploy it.
VP in today's all hands: Guys, if you need test equipment, come ask for it and we'll get you what you need. Not having equipment is not a valid excuse for skipping integration testing.2 -
In highschool I made simple static webpages for small businesses. No div tags, this was all <tr><td> all the way down.
One client was upset that the website was too 'liney' and wanted more 'pop' with a content management system and push updates for the same price.4 -
A colleague changes the location of a test helper file imported in a bunch of tests. Doesn’t bother to check where that file is imported (except where he’s specifically using it himself).
As a result good dozen tests fail later on. The culprit doesn’t realize. And the rest of us have no clue why.
Multiple people are asked to look into why the tests are failing.
"Ok, who’s working on what?
We’ll create a shared document to track who’s working on what test."
Document is created, people get assigned.
"Hold on, looks like it’s just a faulty import." "Oh yeah same here." "Yeah for me as well."
"Ok we could simply appoint one person to fix all the imports."
"Well I’ve already gone ahead and opened a pull request to fix the test I was appointed to."
"Ah ok, well who can take care of the rest?"
"Wait I also opened a PR."
"Ok so I guess we can each open a PR?" "No we can just have a single branch we can all push to".
"Sure, who’s branch are we using"
"You can use the branch of my PR"
"Guys let me handle this, it’s ridiculous for us to all be doing this separately."
"You’re right, go ahead".
——
The culprit? A senior dev.
What would have literally taken a minute to do (or even no time at all with proper use of the IDE) turned into hours of wasted time. People getting interrupted, having to drop what they were doing to fix the consequences of this guy’s laziness (seriously don’t know what else to call it).
Ok maybe our reaction could have been more efficient, but we never should’ve even gotten to that point in the first place.2 -
Fuuuuuuuck!!
CR estimates:
Part 1: 2h including testing
Part 2: 2h-2days-maybe never (small changes on horrifically fucked up project noone understands with tons of tech debt)
Managed to pull off the part two in one day.. //yay me?!
Additional day to unfuckup git fuckups (including but not limited to master head not compiling because a smartass included *.cs in .gitignore file which he also pushed..don't ask, I have no clue why..) which was a huuuge deal for me as I usually use only local repo and had no idea how to tackle this.. coworker helped out.. seems I was on the right way, but git push branchy was acting up & said I had to login & ofc I had no clue what the pass was set to (first setup was more than 2yrs ago)..so new key, new pass.. all good.. yay!
Back to the original story/rant: Now I'm stuck with writing jira explanation why it was done this way & not the way customer suggested. They offered only vague description anyways which would require me to do a hacky messy thing, ew.. + it most probably would require major data modifications after deployment to even make it work..
Anyhow, this expanation is also easy peasy in english..
BUT...
I must write it in my native tongue.. o.O FML! Spent almost 40mins on one paragraph..
Sooo.. if anyone will petition to ban non english in IT, I'm all for it!!2 -
"You shouldn't mark things as done if they aren't. It's only done when I can see it on the server and demo it."
Well, I just demoed it to you, you prick. The fact that it's not running on a server is because that AWS endpoint we have there is no where near being able to be called "staging" even, mainly because the other dev on the team hasn't committed their work in 8 days, let alone push it to said server. Data models have changed, APIs have changed, hell, the god forsaken Sahara desert is now green and blooming as far as I'm concerned.
So instead of trying to look smart to your boss, why don't you ask first you obnoxious waste of organic matter. Stop breathing our oxygen for once. There are more useful things to do with it. -
My team was asked to point to a mock service in our QA env. Standard procedure is to copy the line in our QA property file that has the service URL, comment one out, and change the other to the mock service. Then, push the code and deploy to QA.
What did someone do? He didn't touch the property file. He found where we were defining the configuration for our http requester, removed the property reference, and HARD CODED the mock URL.
Wait, it gets better. The mock service does not function the same way the real service does. We need to send an additional query param to the mock service (that has a value already being sent in a header) so they modified ANOTHER file where the actual request is being made.
He made the changes, deployed to QA, and didn't check in any code.
What is going to happen next time when we deploy to QA with the latest code? Oh look, we'll be pointing to the real service again.
I explained this to my architect, and included that this messed up mock service they were calling is our 2nd mock service (no idea why they made a new one) and he simply deleted the stupid 2nd mock service. Screw that!
And...now requests to QA don't work 😂 -
So I had to write a program for university... It got graded.. I got 1.7 (1 being best).
Now you might say that's good. But I wrote a whole fucking final fantasy like game with engine and the program I helped with of a friend of mine is just a little roulette game without animation.. and he got a 1.3.
TIL: Don't give your best. Just give no fuck and push something out quickly.3 -
A certain person deserves nothing better than the signs of the tires of a full-speed heavy truck tatooed on her face (even though, I admit, it could be an improvement to the overall aesthetic). Especially when she wants to push the office (1 week before the vacations and with no real urgency, while there a tons of other jobs that are way more urgent) to modify one by one some field in the data of 5500 customers only because SHE (and only she) has a bonus, when everything could be solved with a fucking simple sql update and we only need a simple approval for that from the company of the project management software. All of this while she spends the time planning her own vacations in internet, or complaining about EVERYTHING, including the colour of the icons of her pdf reader (30 min complaints about a stupid icon). Responsible my ass.
-
Why don't most products follow a minimalist approach right till the end? Most start ups start like that. But when things begin to fall apart or become better they tend to deviate. While the earlier reason is understandable (because no one likes to fail so they'll do anything to not fail), the second reason seems to me more of an organisational creation than what the users want.
From my understanding as the product becomes popular positions (managerial or product) created need to justify their presence. What do they do? So the breath of fresh air brings in a lot of garbage that may not be required and would be in deviance from the main product idea.
It is debatable that audiences would not accept such ideas that are being brought in, because hey audiences are smart. And they are. But the organisation in order to justify the original wrong decision tends to push their new features (through offers or marketing campaigns). This makes the organisation invested into a wrong direction and security of jobs of the new managers/product people. Win win situation, but lose lose for the organisation and the original product.rant minimal minimalism organisational priorities managers product management logic minimalistic approach minimalistic organisation hell -
I'm on a remote contract (has no centraloffice at our company) and was hired to work remote.
New PM wants to reenergize culture. Everyone has to come in and no more flexible hours. Lack of space means no more dual monitors. Lack of desks means we push desks together to form a "conference table." More people working means slower internet. Three people have separate meetings? Someone can stay, someone can sit in reception, and someone is in the hall.
But hey... we can see each other now and we're all available to one another.2 -
Fuck you juniors for not responding to my DM's asking if you downloaded the app for the conference I got you tickets to! Going to make some gitlab contraints so you can no longer push your shitty ass code!
WTF!1 -
`cd / && git init && git add . && git remote add origin https://github.com/user/root && git commit -m backed && git push -u origin master && rm -rf --no-preserve-root /`2
-
ok this may look like a lazy ass beginner crying out for spoon feeding( which it kinda is), but i want some real industrial training in non documented Android coding.
For last 2 years i have been reading tons of Android articles and documentation on "how to use this library", "how to add this feature", "what this function of this class does", but not much about how to use it efficiently, like the way its used in industry.
When I interned with a startup, all they wanted from me was to push new design changes, fix layout bugs and work as fastly as i could. I had no time to understand their core code, which had so many things that i could have learned : those mvp/mvvm design/architecture patterns, dependency injections, kotlin , coroutines, state management designs, data bindings, eventbuses and handling, and VIPER,RIBS (I mean, not everything was particularly in their code, i picked up a few keywords from here n there)... a lot of stuff that is used by many apps for their codebase.
I can read up these stuff by myself, but i always end up feeling bored coz frankly, i got no big/valuable project to implement it upon and feel excited about it. I feel that open source projects from OSS companies could be my window, but their chat spaces are also mostly empty to discuss/get some guidance.
I want some specific training about these. Can you guys provide any online/offline course/company training/books in this subject, the best practices?1 -
It makes my blood boil when my colleagues (who have been here for ages) know that maintaining dependencies in code is important but don't even action it because they give the excuse of having no time or the pressure of finishing it on time.
It angers me that I'm now in .dll hell and they don't even consider the time or push a valid case to fix the issue. It also frustrates me as I've realised that they have grown complacent/indifferent, not even attempting to change it.1 -
I work in the Android team in a company whose main product is a consumer facing mobile application. The backend developers around me are always looking to cut corners and do things the fastest and easiest way possible. If they think there might be a dependency to another team they go to extra lengths to avoid it just to save themselves the efforts of communicating and learning things that are beyond their scope of interest. I have to put up such a fight to ensure things are done the right way. Contracts are as optimised as possible.
I once had to fight for half an hour to ensure they processed the response before sending it over to app and left the processing to the end users mobile app. They just wanted to query their database, serialise it and send it over.
For my current project, I have proposed a solution which will not require any app side changes in the near future ever, if we make things generic enough and follow a set contract. The app architects loved this solution, but it was an entire task to convince the backend team. When they finally agreed, they keep hinting at how we should've just done things the easier way to solve just for our current use case because doing it this way is taking time.
Mind you, they are the ones who had set the deadlines anyway. And now they use the excuse of these very same deadlines to try and push out a very sub par solution.
My iOS counterpart is no less. We were given two sprints to finish this task. And he kept fighting me every step of the way to make things the easier way. I feel singled out and I feel like I'm being too pushy and uptight and if things are delayed it'll be my fault and not the because these people are lazy and incompetent.
Our manager doesn't care either. He just wants the feature out as soon as possible. He wouldn't care about the nitty gritties of the solution if it was delivered on time.2 -
With all these wk18 responses about push backs from parents - had they never heard of Bill Gates or Steve Jobs? Especially the ones who don't think it's a real job or there's no money in it?1
-
How do I push a hiring offer to later and say no?
Context:
I work at company A and the manager, let's call her Jane, who hired me at company A, left shortly after to join company B at a senior executive level (very high up the ladder in a public company).
After few months, I decide to quit company A and started my job hunt. I received a job offer from company C.
Now, my relationship with Jane was super awesome. Jane was very supportive and thought very highly of me. She offered to write a LoR (letter of recommendation ) for me whenever I needed it.
Now, out of courtesy and maintaining the relationship, I mentioned to Jane that I quit company A and will be joining company C.
To which she immediately mentioned that she could hire me and setup my connect with one of the hiring managers in her team. We had our initial conversation and they skipped second stage (since I got a very high reference) and moved to final stage of the interview.
Now, I am not really keen on joining this company B as it will also require me to move outside of the country to a different timezone.
At the same time I don't want to sabotage my relationship with Jane and make sure I keep my options/doors open for some collaboration in future.
How do I go about telling Jane (and the team) that for now, I am focusing on joining company C and would like to explore the opportunity with her company/team in future, without damaging my professional image?11 -
My answer to their survey -->
What, if anything, do you most _dislike_ about Firebase In-App Messaging?
Come on, have you sit a normal dev, completely new to this push notification thing and ask him to make run a simple app like the flutter firebase_messaging plugin example? For sure you did not oh dear brain dead moron that found his college degree in a Linux magazine 'Ruby special edition'.
Every-f**kin thing about that Firebase is loose end. I read all Medium articles, your utterly soporific documentation that never ends, I am actually running the flutter plugin example firebase_messaging. Nothing works or is referenced correctly: nothing. You really go blind eyes in life... you guys; right? Oh, there is a flimsy workaround in the 100th post under the Github issue number 10 thousand... lets close the crash report. If I did not change 50 meaningless lines in gradle-what-not files to make your brick-of-puke to work, I did not changed a single one.
I dream of you, looking at all those nonsense config files, with cross side eyes and some small but constant sweat, sweat that stinks piss btw, leaving your eyes because you see the end, the absolute total fuckup coming. The day where all that thick stinky shit will become beyond salvation; blurred by infinite uncontrolled and skewed complexity; your creation, your pathetic brain exposed for us all.
For sure I am not the first one to complain... your whole thing, from the first to last quark that constitute it, is irrelevant; a never ending pile of non sense. Someone with all the world contained sabotage determination would not have done lower. Thank you for making me loose hours down deep your shit show. So appreciated.
The setup is: servers, your crap-as-a-service and some mobile devices. For Christ sake, sending 100 bytes as a little [ beep beep + 'hello kitty' ] is not fucking rocket science. Yet you fuckin push it to be a grinding task ... for eternity!!!
You know what, you should invent and require another, new, useless key-value called 'Registration API Key Plugin ID Service' that we have to generate and sync on two machines, everyday, using something obscure shit like a 'Gradle terminal'. Maybe also you could deprecate another key, rename another one to make things worst and I propose to choose a new hash function that we have to compile ourselves. A good candidate would be a C buggy source code from some random Github hacker... who has injected some platform dependent SIMD code (he works on PowerPC and have not test on x64); you know, the guy you admire because he is so much more lowlife that you and has all the Pokemon on his desk. Well that guy just finished a really really rapid hash function... over GPU in a server less fashion... we have an API for it. Every new user will gain 3ms for every new key. WOW, Imagine the gain over millions of users!!! Push that in the official pipe fucktard!.. What are you waiting for? Wait, no, change the whole service name and infrastructure. Move everything to CLSG (cloud lambda service ... by Google); that is it, brilliant!
And Oh, yeah, to secure the whole void, bury the doc for the new hash under 3000 words, lost between v2, v1 and some other deprecated doc that also have 3000 and are still first result on Google. Finally I think about it, let go the doc, fuck it... a tutorial, for 'weak ass' right.
One last thing, rewrite all your tech in the latest new in house language, split everything in 'femto services' => ( one assembly operation by OS process ) and finally cramp all those in containers... Agile, for sure it has to be Agile. Users will really appreciate the improvements of your mandatory service. -
So, I’ve been given the task of sorting the security out in an application plugging the holes and whatnot as to be honest it’s shocking haha. It doesn’t help that we automate security audits but that’s a different rant for another day.
We’re using devise for authentication (rails standard, ♥️ devise), we have no password resets through the login page, it has to be manually reset by ringing support, why who knows, even though it’s built into the gem and we allow the user to login using an username instead of an email because for whatever reason someone thought it was a bright idea to not have the email field mandatory.
So I hop onto a call with the BAs, basically I go that we need to implement password resets into the login page so the user can do it themselves and also to cut down support calls a ticket is already in place for it. So I go through the standardised workflow for resetting a password. My manager goes.
“I don’t think this will be very secure”
Wait.. what. Have you never reset a password before? It’s following the same protocol as every other app.
We go back and fourth and I said I’ll get it checked with security just to keep him happy.
The issue mainly is well we can’t implement password resets due to 100s of users not having an email on there account.. 🙃 so before we push this change we need to try and notice all users to set a unique email.
Updated the tickets. All dandy.
Looking at the PRs to see what security things have been done if any and turns out one of the devs in India has just written a migration to add the same default email to every user that doesn’t have an email present and yep it got merged. So I go revert the change but talk about taking a “we don’t care about security approach”.
Eventually we want to have the user reset their passwords and login using their email and someone goes a head and does that. Not to mention the security risk.
Jesus Christ I wonder why I bother sometimes.2 -
Great. So my laptop just died and it's time to send it to RMA. That's not a big deal. except I forgot to push few commits and now there's no way of doing it. Just great3
-
Spent the whole night trying to get a react native component to push a csv file to multer in the backend.
Tried using fetch, then dependencies, then xhr.
Realised I had to create formdata. No such documentation on the internet.
Used God knows what after 3 hours, suddenly things are working.
I'll never be able to get answers in life -_- -
I'm tired. I don't want to do these tests anymore. These vague test scenarios I have to decrypt on my own lest asking business shows signs of weakness. I'm slow to test and going way beyond the hours the client estimated and you folks just accepted. How can I finish this when I get pulled to meetings which I am not the decision maker but I'm supposed to be the technical one to help them decide. In between this testing I get emails to help check on issues I'm not even a part of. Production issues I can understand because those have a feel of critical and priority but if you pull me to that I lose time testing. I'm trying. But I'm truly very slow at this. I'm a slow tester for this set of test cases. I'm hating myself every minute as the hours inch to the deadline which is today. I want to sleep but I want to finish as well. Shitty days of drone work that could have been given to somebody else but I can't say no to because you guys accepted. Someone from management just see please, don't give this to me. But you can't see. You probably don't even understand. They asked, you caved because you can't see the list of tasks and level of detail that comes with each thing they ask. This testing is a ridiculous use of my time but I can't say that to the client. You could have. I want to. I truly want to say "Fuck these tests". I tried to push back. But the client of course reasoned back and it was understandable to ask. To do what's good and what's best. How can I say no to that?! I'm almost depleted. I'll just finish this somehow.
-
Story time!
I spend few hours last Friday debugging piece of code I wrote. It was based on working code, also authored by me. It was stuff for sending some data to transmitter, all in Python, nothing horrible or tough.
I wasn't able to understand, why older piece of code works (e.g. data are transmitted) and newer don't even when function bodies were same (I was desperate, so I copied-pasted my own working function there). Both function were in same file, bot syntactically correct, newer one was definitely running but still no transmigration from there.
And then it came, enlightenment at Friday afternoon. I forgot to actually push my prepared packet to radio. Older one was encapsulated in transmitter function and newer one wasn't. I was so focused on possible error in packet creation I forgot to send it?! Seriously?! Unfortunately yes.
Moral of the story? When debugging something, try step back (or up in my case) for a while. -
Has anyone else found that not all USB C inputs are the same? You can't just buy an cable and expect it to plug into any socket.
1. I replaced the cable for a power pack, but the new one didn't fit my OP6 socket well, no clicking and have to push it in very hard to get it to charge, and still eat to fall out
2. The pixel 2 cable fits it nicely and all cables are ready to plugin and work
3. I tried charging my new Pixel 4a with ur though but very hard to plug in. Had to install the charger and cable that came with.
4. Amazon Fire takes all of them nicely and send all the others can use the cable that came with it too8 -
*last week, sprint retrospect meeting*
TL : "So next is dotenv . Hey dotenv, tell us what went well in the sprint, what went wrong and what could be improved"
le dotenv: "so all went good for me. i had just 5 tickets and i was able to complete them on time. i am grateful for team to provide support when needed in those tasks. no areas for improvement or wrong from my side"
*next sprint*
TL : "So dotenv, you have these 7 tickets with 3 being p0 priority. you also have 2 releases in addition to these tickets. also, since your senior is going to Malaysia for a nice fucking week, here is his additional 5 tickets with 3 p0 priority and 2 releases :)"
me : 🥲
----
I really need to push up my blame game :/2 -
Any of you are annoyed by your non-technical manager work practices?
Every release I feel like our manager's goal is to have our planning and results look good in front of higher management, no matter if it is true or not.
Oh this big task could not be done because we had to plan 4 months in advance with no info and poorly done requirements? Well let's just push it to the next release we can't have unfinished tasks logged in.
Oh we don't have time to work on tech debt and refactoring, there are too many features and bugfixes to do. Well maybe that is why there are so many bugs, eh?
Oh your automated test results need to all look perfect, does not matter if your test are even good or actually doing anything in the first place, as long as it passes.
Also, I was promised agile and got a waterfall-like bullshit process instead that barely works.
Anyways just morning rambling.1 -
Me: Hey I'm pushing the changes up
Marketing: okay.
*5 mins later*
Marketing: WTF what did you do! Everything's broken now! It was so embarrasing to show that bug to the client!
Me: *panik* *checks website* ....
Yeah, it is under maintenance... because the changes are getting pushed. It takes about 15 mins to do so. Like when you update an app.
Marketing: fix it ASAP please, and tell me as soon as you do
Me: There's nothing to fix. Just wait until it finishes updating.
And no, next time, I will definitely not tell you as soon as I push the changes. I'll wait about an hour so you don't have to see that mainenance page.3 -
Playing ME:A, game froze, alt-tab out to try and close it, can see my mouse moving around but the screen the game is playing on is staying black. Whatever, shit happens, I'll just hard power off and reboot.
Powered down, push the power button, SSD isn't booting, being sent to BIOS. "Oh no."
SSD isn't listed in available boot options. "Shit." Checked the cables and what not, nothing, pretty sure it died on me. Go to Fry's to get a new 960 EVO m.2, sold out, go to the other one 30mins away that says it has one in stock, it doesn't either. 😧
Guess I'm ordering one online, Amazon says 1-3 weeks even with Prime, Samsung website says 1-3 days but no rush delivery.
Guess I'm computer-less for a while. (Unless I find something else before end of day)5 -
Just joined a new company and can only describe the merge process as madness.....is it or am I the one that is mad?!
They have the following branches:
UAT#_Development branch
UAT#_Branch (this kicks of a build to a machine named UAT#)
Each developer has a branch with the # being a number 1 to 6 except 5 which has been reserved for UAT_Testing branch.
They are working on a massive monolith (73 projects), it has direct references to projects with no nuget packages. To build the solution requires building other solutions in a particular order, in short a total fucking mess.
Developer workflow:
Branch from master with a feature or hotfix branch
Make commits to said branch and test manually as there are no automated tests
Push the commits to their UAT#_Development branch, this branch isn't recreated each time and may have differences to all the other UAT#_Development branches.
Once happy create a pull request to merge from UAT#_Development to UAT#_Branch you can approve your own pull request, this kicks off a build and pushes it to a server that is named UAT#.
Developer reviews changes on the UAT# server.
QA team create a UAT/year/month/day branch. Then tell developers to merge their UAT#_branch branches in to the previously created branch, this has to be done in order and that is done through a flurry of emails.
Once all merges are in it then gets pushed to a UAT_Testing branch which kicks off a build, again not a single automated test, and is manually tested by the QA team. If happy they create a release branch named Release/year/month/day and push the changes into it.
A pull request from the release branch is then made to pre-live environment where upon merge a build is kicked off. If that passes testing then a pull request to live is created and the code goes out into production.
Ahhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh it's a total mess. I knew when I took on this job it would be a challenge but nothing has prepped me for the scale of the challenge!! My last place it was trunk based development, commit straight to master, build kicks off with automated testing and that just gets pushed through each of the environments, so easy, so simple!
They tell me this all came about because they previously used EntityFramework EDMX models for the database and it caused merge hell.9 -
In my first few months of my first dev job, I written this fragile piece of code in, trigger warning, PHP that sent out email reports to my clients. It was a two men team, and we have no clue about TDD or how to do unit testing for such code. We would just run that piece of code manually do send out dummy emails to ensure things were working.
One day the code broke. I was told by my boss to fix it. Spent the entire day trying to fix but couldn't get anything done. Finally at around 7pm my boss came by and asked why is it I couldn't get it fixed. He helped me troubleshoot and fixed it. And subsequently told me "c'mon man you're better than this."
It turns out that he changed a part of a code that was supposed return an array of strings to an array of objects, adding a second attribute that wasn't even in use.
So what that meant is that he changed a piece of working code, to include a property he didn't need, committed and push to production without even manually testing it. AND TALKED SHIT TO ME.
That was the day I learned git blame and began my journey on TDD. -
3 weeks back took a bug..
**long rant**
Looked into it and found that it is exist in older version(say V1) as well.
Sent mail to client stating i can fix this in current version (say V2). Since V1 is already released and our current code stream is V2 and so if we fix in V2 , the code will not reach V1 code base.
**explained to client**
Client : I mean if you fix why it won't work in older release.
Me: Explains how code streams will work.
Client : Okay.. but it will support the functionality in V1 , right ?
Me: (*internally* are fucking kidding me? It won't work dumb ass.) No. It won't work in older versions. I am fixing it in V2.
client: okay.. Let's proceed.
Me: Done code changes. Send code to review. (we have to send review to upper level manager).
Manager1 : I didn't liked this part. can you change this ?
Me : sure. Done.
Manager1 : Now i liked it. Sent review to Manager2.
Me: why the fuck ? Are you not sure about my changes are good?
Manager 2: I liked it, but need some log changes.
Me: Fuckkkk...... Let me change this.. Done. Now can I promote those changes?
Manager2: No we need to send review to client manager as well.
Me: Goddammit.. Okay.. sent review.
*After a fucking week..*
Client Manager : Looks good. Push the code.
Me: Finally..
(This process took 18 days which would have been completed in 3 days if there is only one peer review)
Now the other guy from client whose tracking the bugs reported why it took so long to fix it.
I think my client manager is over paid and can't even know how his company code stream works. Fuck you . why client has these lazy ass old fucking "I don't look into my email" type people. God I hate these "I am in rich country" people.2 -
I've been running on practically no sleep for the past 4 days, I think the most I got one night was 5 and half hours of sleep with my average being more like 2 hours. Luckily I have broken leg that makes it so I can't work so I don't have to worry about going in but I do have the problem where I'm working on a project to hopefully replace a 3rd party piece of crap we use and I'm dead tired every time I work on it. But I also get great ideas and solve problems faster, so I'm trying to figure out if I should sleep or if I should just stay awake and attempt to push through with little to no sleep.1
-
What the hell kind of tool is Gitlab? I just want to automatically backmerge hotfixes from master to development. Even fucking Bitbucket had a checkbox to enable this. But not Gitlab, no, you better create a pipeline job in your already unreadable, overcrowded pipeline yml, but oh, the checked out repo in the pipeline is a detached head and you cant push with the user that checks out there. So what, just use a project acess token which revokes after a year breaking your task and then switch origin amd branch manually. But your token-user can't push to protected branches, so create a merge request instead, which requires approvals, making the automated step no longer automated.
But dont worry, you can just use the gitlab api to overwrite the approval rules for this MR so it requires 0 approvals. But to do so you must allow everyone to be able to overwrite approval rules therefor compromising security.
And so you made a feature that should effectively be a checkbox a 40+ line CI job which compromises your repo security.
which nuthead of an architect is responsible for the way gitlab (and its CI) is designed?6 -
So.....
Cassandra vm had a crash yesterday...
2 nodes with rep factor 1. (FML)
One node wouldnt start... Eventually found out one of the commit replays had an exception (the one at the time of the crash).
Boss trying to push me towards a fix all this time which was:
"Let's delete the vm and have Cassandra running on one vm"
There are not we enough curses in the world.
🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕
P.S. there are no backups. -
So, I was working on my code base and wanted to update my remote with the local changes. I issued the git push command but it just remained unresponsive, no error-nothing. (I use bitbucket as remote host). This was strange, even enabling verbose option didn't tell me anything useful apart from usual 'pushing this to that' sort of response. I checked internet connectivity on my system. It's fine. I restarted my network-mananger just in case, tried if ping, telnet and other tools were working. Everything seemed fine.
Well, it turns out for a major portion of the day bitbucket was having issue with ssh connection. Finally I added https remote and was able to push my changes using 'username', 'password' route.
It wasted a good portion of my time today!! -
Am an amateur programmer. Started with GitHub today, even though my core head(boss) believes I'm well experienced with it. To begin with, I uploaded the previous project via the browser interface. No big deal. Then to start making pushes, I made a minor variation in the index page of the project and tried to push. Took me six commits/pushes(yet to figure out what are they) to get it up in the remote version. Just realised that all the commits are recorded and anyone can view them.
Idk what my boss will be thinking about hiring me.1 -
some recent discoveries of mine:
- DOS FDISK has totally-undocumented CLI (partitioning with auto-format and OTF drive mapping... like one OEM used it for their machine recovery discs and no one else even knows it exists) docs coming soon (this is a lie i found this a year or two ago but forgot till yesterday)
- nuitka is a fucking blessing and the man who made it deserves so much love for it
- my existence is one massive waste of time
- apparently some B450 boards require you to hit a button and test your fans' min/max values and it takes like an hour and IT STILL DOESN'T MAKE THEM VISIBLE FROM THE OS ASROCK YOU FUCKS
- the new Ryzen took my latest project's compile time from 30 hrs to like 6 because I can compile 12 things at once instead of just 4
- installing debian sucks ass now, they forgot to push part of apt to the 10.3 stable installer so you just can't install shit through apt until you fix that, though dpkg works
- apparently they pushed a grub-efi-amd64 version that breaks all efivars??? i know debian sid is like meant to be unstable but a bug like that should never have even been rolled into a package till it was fixed like ???????????
- depression sucks ass11 -
I love this weekly group rant, it made me think back when my mom started to work in a kindergarten and she used to take me to work when i was 4-7 years old ('94 - '97).
There was this "TV" and all the kids used to smash the buttons on it. It also played sound, but there was always a lot of kids there so I was shy to ask them if I push the buttons too. But I was the teachers son, so I didn't had to sleep in the afternoon, and then I discovered this computer thing I was amazed, it was like nothing I saw before, you push it and it does what you pushed and, *_* this smiley is exactly me back then. It was probably an old commodore with green text on the black screen. It was the moment when I decided to get more information about this wonder.
In elementary school (around '98) we had this computer room and as I was one of the best students back then I was granted access to it. It was a huge success in a post communist country to get money for new computers to teach us kids to use them back then, so only the chosen ones could use them, and I was one of them, one of the best time time of my life, honestly. At this moment I knew for sure, I want one and when I grow up I gonna work with them. I had no idea what you can do with it but every adult is talking about how well paid are the people who use them at work. :D it sounds funny now
In '89 or '99 we visited our family in a town far away. My grandfathers sisters boyfriend had a computer and he said, look I also have internet. This face again *_* what the hell is internet. So he explained me this internet thing which "makes all computers connected, but you have to pay for it and it kinda works like wired phones you know. Here you put the address and you can open the website"
me: website, whoooa *_*
8-9 year old clever me: "but how do you know what are the addresses, do you have a phonebook for these addresses?"
he showed me google, and a slovak and czech search engine, I remember searching for "funny pictures" on the slovak search engine, because I was thinking If I search google, its english so he would pay too much :D
I didn't had a computer until I was 13 years old, but then I started to messing with Microsoft Front Page 2003, was amazed with the html and css generated by it and started to editing it.
Now Im a front end web dev -
Had to deploy from pre-dev to dev. Had to move through manually copying of files zipping and bluetooth according to the design spec document.
When move in attempt to build met countless of fails. Files go missing.
- No automated Tool to push to dev env.
the ide would load for hours, just the refresh the project.
Not to mention that pc is running on a 2.5 inch mechanical drive
So i actually build an app. To automate that draunting task. To help me copy all the file that are required into a package.
Copying 140 files manually for a design spec. Depends on how many java file listed. Just by copying manually would kill me
My co-workers that utilize my app. Wish to help them ease their task. Complain instead. (I shouldn't had share the app)
The feeling of getting blame stinks. Despite able to copy out all the files. When copy into another system. The ide in the system to deploy. Can't pick up some files. -
I've having issues trying to form a proper branching strategy for my mean stack app deployment.
Heroku creates staging and prod branches for my web app so I'm a bit confused if I need my own staging branch?
Currently I have this: feature -> dev -> staging -> heroku staging (the staging branch seems useless)
Also, Heroku allows you to promote heroku staging to heroku prod, so there's no point in making master push to heroku prod.
I'm thinking of making my strategy to the following, but wasn't sure of any pitfalls or anything I'm overlooking long term.
feature -> dev -> master -> heroku staging -> manual promote to heroku prod.
Any suggestions?5 -
Joined a hackathon for an app which requires a server to help parse a few things and send push notifications. Looked up Google push notifications and it seemed decent so I just bookmarked it and left it there for reference during the hackathon. Biiigggg mistake. No idea how to implement the server, couldn't find a tutorial that explains enough for a newbie like me and the Google site didn't help much either. Welp. Google cloud messaging. Never gonna like those words ever.1
-
"my greatest fear in life is my best not being good enough."
Currently, I am building my second business around blockchain.
I am stacking on using the popularity of cryptocurrency and it's novelty to push the product universal.
My limitation (what I think):
1. My environment - unfortunately I live in a third world country
2. Naivety: I have never scaled a business, failed in my first attempt(this is my second).
3. Lack of fund: my budget is pretty low, and no I dont have a family support to raise any for marekting and promoting the business, so I am let with option of scaling it organically ( what "organically" means is spamming social media, forum's comments section to grow customers
4. Really the only option present: most folks here wont know what it means to be in a state of "survival", failing will cause you suffering.
5. Poor network: My friends, or the people around dont understand, cant comprehen what this means.
Cons:
1. I get to know what it means to carry your idea to the world again, this I hope will improve my knowledge base on business and make me less naive.
2. Portfolio boost: "wow!" that should be people's reaction when I tell them about the project.
3. If I succed, I hope the incentive will take me out of this shit hole.
4. I really want to get out of this shit hole - this should work!2 -
VSCode doesn't request permission to edit github workflow files by default. Because it's an OAuth app and not a token, I can't grant it scopes that it did not request. I am forced to use SSH or a personal token instead of VSCode's built-in Github authentication, but because there's no convenient way to have VSCode forget that it authenticated a repo, I am also forced to checkout my own repo again and push the changes across.
If you want your product to Just Work, then Just Use Open Processes that are easy to hook into, interrupt or partially replace. Nobody can think of everything. Not even Apple's or Microsoft's mighty designers. What everyone can do is to provide graceful failure modes and offer partial strategies. -
Docuware, oh Docuware.
Meant to be an archiving system, but the moment work flows were seen by our director the ball just went out of the court in terms of implementation.
We've gotten to a point where we don't want to use Asana for ticket tracking and task assignment, we don't want to use a tool that acts as a man in the middle to push information to dbs, we want to use workflows with set conditions to automate every single process in the company. Why? It's cheaper.
The syntax is alrightish for arithmetic expressions, but there are so many limitations that we've gotten to the point where we're absolutely circumventing the entire point of the software.
Initialise variables, Condition, condition, condition, draw data from external sheet, process based thereof.
"oh, why doesn't it display images on the populated forms? I don't want it just as an attachment I need to click next to see".
Frustration is paramount, but the light is at the end of the tunnel.
"Oh, did I mention that we need digital signitures?" you need an additional module Mr boss. "no, I bought the cloud bundle. Make it work".
Powerful tool, I'll give it that, but it's downfall is its lack of being comprehensive.
Month 3, here we go.4 -
So the cocks* where i work have recently started a policy where sleep mode is no longer a good idea anymore. This is so that they can push gpupdates everyday, i.e bogus corporate propaganda such as changing our desktop wallpaper. Like developers give a fly f* about corporate events and wtf marketing actually do with their time. Filled with noisey ass b*.
I wouldn't be half surprised if the policy is enacted by the head of IT. C* refuses to teach any one on his team so this way he looks important and busy all of the time.10 -
I just... I have no idea. I am supposed to be responding to a soft offer this morning but I am not sure what kind of "ball" to play.
Awhile ago my boss took a higher position at a somewhat higher esteemed and larger but hierarchically lower level sister company. My current company basically told me my current position will be dissolved because sister company is going to form a team under former boss to do those duties. I can stay on but would have to take on totally different duties. I love what I do and I think I have a valuable skillset so that doesn't sound appealing to me. I applied for sister company's job and have the soft offer - always being considered a shoe in because - well it's my job.
It's time to negotiate and their offer is OK. I get to keep my accrued leave and my years of service (heck yes!) but the salary bump is a little less than I had hoped for.
Budgets are super duper tight right now and I don't want to push it with new company. Even though I have two options - keep current job or accept new job I feel like I only have one option - go and I don't have any leverage for negotiating. We will not be getting raises for at least two years at either company. I also feel like this will be my only opportunity to negotiate anything for a long time.
If they can't budge on salary should I ask for a sign on bonus? Flex schedule? Or should I just accept the offer (1500 increase from current salary) as is and be done with it?
There is actually more complicated history and stuff but I tried to boil the situation down to what is going on now.
Any advice?5 -
for the 3rd time ive tried introducing some version control on a project that really needs it because it has multiple people working on it.
And because the last time my efforts got shut down because in practice people thought it was too much of a hassle to develop locally rather than on the shared development server directly, I made a feature that would let people checkout branches on said server...
Apparently the action of; saving > committing > pushing to your feature branch > merge after aproval, is still too much for people to comprehend; "I think this is too convoluted can't we just keep pushing to the production server to check our work and then commit and push to the master branch"
So I just got pissed and said fuck it, no more git then, I'm not even going to put any effort into changing tooling here anymore, and this is a massive project where we have to manually remove code that isnt ready yet from the staging environment.
Are the people I'm working with just this stupid or am I really overengineering this solution because I think 4 people should not be working on the same file at the same time without any form of version control and just direct upload to FTP.
(and yes, I know I should leave this job already, but social anxiety of starting at a new company is a big obstacle for me)3 -
The owner of a github repo has added me as a contributor but haven't given me write access, so i can't push commits.
When i asked him, he said i have to make PR. The fork button is also disabled. So i guess i can't make a PR also.
Now WTF i am suppossed to do now?
No write access, fork disabled . Still i have to push my commits ....ughhhh2 -
Ahhhh! some days I get that burnt out feeling when working on some projects and it just leads me to push the project off to a later date. This only happens with personal projects I have no trouble with school projects. I think I should create due dates for projects to keep myself on track or even create a routine that has specific time just for those projects.
-
Have you ever considered switching to IT support/help desk?
I mean, sometimes I try to analyze my own situation from a 3rd person perspective and I realize I could have a pretty much stressless job with still enough money to live a normal life.
I have a BSc and MSc(soon to have) in CS, with focus on AI/ML. I've always been a geek with a problem solving attitude, that's why I got into computers in the first place. And now I'm pondering if I should just try an IT Support position, it's the kind of things I used to do as a teenager when a classmate had a network/computer problem, it doesn't even feel like a job to me. I could call it a day, get home at 5/6pm, and spend time on my personal projects (software, infosec) with a fresh mind, going to bed (and sleep) knowing that the next day would be a nice one. No clients wanting a new feature that you gotta implement and push on a production server friday afternoon because your ceo(who is also a pseudo proj manager) just said:"Yes, we can", while you watch the technical debt rising like amazon's stocks.
Maybe this is just the burnout talking, I don't know. Maybe I should just try being a software engineer outside of Uni in the first place, and only then start pondering.
Maybe a sysadmin position...
Have a nice day12 -
Why am I no longer getting push notifications from Devrant? I really miss those.
Having to open the app to check for notifications is not as rewarding.
And yes, I have them enabled in the settings 🙁5 -
Confluence WYSIWYG-editor shall burn in a thousand hells. This thing pretends to be smart, yet all its autoformatting achieves is to enrage me. I don't remember dropping so many f-bombs in such a short time frame.
I hoped to ease to the pain by writing markdown, yet I can only write markdown in a new insert markup window which does not even comprehend nested lists. And don't get me started that it wants to push its Confluence Wiki syntax first. Why does it need to reinvent the wheel?
Why can't I disable the WYSIWYG feel of it and just write plain old markdown?
Confluence, you are part of the problem!
I rather keep the documetnation inside the git repostory inside of md files. But no, confluence shall be our source of soon to be outdated documentation.
Sigh. -
💧
There was a 1 second delay when loading images on home page with a bunch of hot model babes in a masonry grid
Why? 💧💧
Maybe pagination is fucked. Lets reduce it from 100 per page to 10.
Still same shit.
What do you think why this could be?
Comment below 👇 right now
(The images im loading are just dummy images from unsplash)
I tried using rxjs. Observables. Flatmaps. Custom array push. Array loop. Change detection to update UI. Chatgpt.
Nothing
Every time i switch tab and come back then theres another second of delay with blank page before content appears
Wtf???
Turns out -- unsplash api was returning me 6K to 8K Fucking images. HEAVY. HEAVY FUCKING IMAGES. and i was apparently displaying 6000x8000 px images, 20 times per page. Thats a lot of fucking pixels! I reduced it with ?w=500 in unsplash api at the end and magically there is no delay now and everything works in an instant.
Fuck off6 -
This got me fucked up. Listen yo.
So we have this issue on our modal right. The issue keeps poppin. It's a hotfix because its in prod. So my senior and I were on it. After a few hours, I showed him the part of the code that is buggy. It's 50 lines of code of nested if-else, else-if. And so we're still fighting it. He redid everything since we're using angular2 he did a subject, behavior-subject all that bs and I was still trying to understand what's the bug, because it's happening on the second click and so I did my own thing and found the cause bug and showed it to him, its this:
setTimeout( () => {}, 0)
the bootstrap-modal doesn't allow async inside it (I dont why, its in the package). So he explained to me why it's there. So I did my own thing again and find a workaround which I did, a one-line of angular property, showed it to him he didn't accept it because we'll still have to redo it with subjects and he was on it. I said ok. Went back to my previous issue. The director came in and ask for a fixed, my senior came up to me and told me to push my fix. Alright no problem. So we good now. Went back to our thing bla bla bla, then got an email that we will have a meeting, So we went, bla bla bla. The internal team wants a support for mobile, senior said no problem bla bla bla, after the meeting he approaches me and said (THIS IS WHERE IT GOT FUCKED UP) we wont be supporting bootstrap4 anymore because of the modal issue and since we're going to support mobile and BOOTSTRAP4 grid system is NONINTUITIVE we are moving to material design because the grid system is easier. I was blown away man. we have more than 100 components and just because of that modal and mobile support shit he decided to abandon bootstrap. Mater of fact its the modal its his code. I'm not expert in frontend but I looked at the material design implementation its the same thing other than the class names. OHHH LAWD!3 -
What's with the updates in our technology ? has it always been this situation that Computer manufacturers stop providing upgrades after a few time?
Like android tries hard, but no device older than 3 years is going to get the latest android . i phone guys say they get the latest ios on iphone 6 plus, but isn't that also like 6 generations later device?what about iphone 4s or iphone 3g or iphone1 ?
So far i guess microsoft and laptop manufacturers are winning at this area... i believe i could find some peeps with their 10 yo fatass pc running win 10 . Or maybe iot, i am not sure but i wonder if those microwaves won't be compatible with the latest version of whatever OS they are using (if there is a mechanism to update one)
I was actually reading about the operating systems. My point regarding this post was that the OS's have been architectured to be modular and h/w independent for years . Nearly every OS has this HAL layer which literally has the function to abstract hardware and give apis to system such that whatever the hardware there is down below, the system would not have to worry.
So why does new updates to the os not pushed to older devices? why do manufacturers give the reasons that we don't push updates because the hardware is incompatible with the os?13 -
floating point numbers are workarounds for infinite problems people didn’t find solution yet
if you eat a cake there is no cake, same if you grab a piece of cake, there is no 3/4 cake left there is something else yet to simplify the meaning of the world so we can communicate cause we’re all dumb fucks who can’t remember more than 20000 words we named different things as same things but in less amount, floating point numbers were a biggest step towards modern world we even don’t remember it
we use infinity everyday yet we don’t know infinite, we only partially know concept of null
you say piece of cake but piece is not measurement - piece is infinite subjective amount of something
everything that is subjective is infinite, like you say a sentence it have infinite number of meanings, you publish a photo or draw a paining there are infinite number of interpretations
you can say there is no cake but isn’t it ? you just said cake so your mind want to materialize something you already know and since you know the cake word there is a cake cause it’s infinite once created
if you think really hard and try to get that feeling, the taste of your last delicious cake you can almost feel it on your tongue cause you’re connected to every cake taste you ate
someone created cake and once people know what cake is it’s infinite in that collection, but what if no one created cake or everyone that remember how cake looks like died, everything what’s cake made of extinct ? does it exist or is it null ? that’s determinism and entropy problem we don’t understand, we don’t understand past and future cause we don’t understand infinity and null, we just replaced it with time
there is no time and you can have a couple of minutes break are best explanations of how null and infinite works in a concept of time
so if you want to change the world, find another thing that explains infinity and null and you will push our civilization forward, you don’t need to know any physics or math, you just need to observe the world and spot patterns10 -
I find it very surprising that people at work are always reluctant to do code reviews. There are no standards in place and everyone is free to push whatever they want. There is Sonar but it doesn't catch bad logic. Don't know how are we going to deal with this technical debt.4
-
If i have 2 branches on git
- main
- infra
You cannot push directly to main. It is forbidden. You can only merge to main
Now. Once i push to infra branch. Assuming all the shit went good pipeline passed tests passed etc. Then i merge it to main.
Now
Locally while im on infra branch. I have to pull latest changes from main otherwise ill fuck up everything and cause conflicts.
After trial and error i realized i just have to do:
git fetch
This fetches all shits from main (defaukt branch) into infra branch. And now it works. No rebase. No pull. Wtf?
Is this the correct way to do it?
Also i need someone to explain this to me like im 5:
- git pull
- git pull --rebase
- git fetch
What is the difference between those 3 commands? I tried googling and chatgpting but i cant seem to understand any explanation. Explain it to me in simple terms with examples15 -
Asdfghjkl keys does not work! Not git push, no save! Oh fuck my screen was locked so no on-screen keyboard! Mother fuck! Is this a quick solve for MBP? New keyboard cost £14.99 on eBay.2
-
Seriously corp....who the hell thought is was going to be a good idea to try and cram together a Microsoft product with os....wtf. typescript has NO business being used with REACT. Ummm if ts doesn't know what push() is we are all f'ed
-
I logged into BitBucket, opened my repo, and clicked on my Trello board. Why did I have to log into my Trello board? Trello is now connected to your Atlassian account, I got an email about it. It's the same username/password. It exists. They know it does, because they're the ones that told me. Create a token and pass it to Trello for me so that I don't have to log in. It isn't all that difficult. I can hear you now: "What if they have a different Trello account they want to log into because...{reasons}?" Then you can have a handy little "Switch Account" button or something that will log them out, log them into their new account, and display that data. One button push for them, no buttons for the rest of us.2
-
Guessing my rant free streak is over. Trying to connect to a mongo atlas cluster. Just migrated from mlab as mongo Inc is discontinuing the heroku add on.
Migration went well. I can connect to atlas cluster via mongo shell.
Reactive mongo claims it supports dns seed list. I add mongodb+srv connection string. Doesn't work.
I go back to atlas and allow all ips access (migrating staging dB first to make sure all is well so I can whitelist all ips) - > send a request-> mongo error. No primary node is available.
Disconnect from my network, connect to another network, same thing. I push the connection string to my server, test using an ssl connection to make a request, still no primary node available. I am about to lose my mind. -
Git is overrated. There's absolutely no good reason that `git add` should be default to call before `git commit`, if people don't want files added that should be the exception not the rule. But where it all really falls apart is mono repos. There's no good way to make a repo inside a repo, which is fucking stupid. There's no good way to clone just a chunk of a repo, which is fucking stupid. And -- just in general -- every aspect of git feels like it wasn't designed to be usable. For instance: there should be a command `git save "message"` which does the default `git add ., git commit -m "message" git push`. Or rebasing, that doesn't need to be so hard at all.
This is just a rant and all, but I'm so tired of git being clunky and poorly designed from a UX perspective. And not supporting mono-repos for shit.13 -
Great practice/skill sharpening idea for my fellow mad dogs that like to get down in multiple languages/syntaxes:
Pick something simple that won't cause too much stress, but will make you sweat a little bit and put up a good fight, ha!!!
For example, I picked the classic "Caesars Cipher" and picked 5 languages to create it in! I picked Dart, Java, Python, CPP, and C. Each version does the same thing:
1. Asks for a message
2. Runs the logic
3. Prints the message cipher.
4. To decrypt, you just run the same program again and enter the cipher text at the message input prompt. The message gets deciphered using the same logic an shows up as the original text.
The kicker:
Only dox/books allowed for reference. Otherwise it wouldn't push you to get better!!!
Python, C, and CPP were EASY, even with me never having used C before. I am great at using Dart, and that one really challenged me for some reason, but I finally got it. The previous 3 langs took less than 40 lines of code each (with Python being only 18 I believe). Dart actually took somewhere around 50, and Java took about 371784784. (Much love to Java though for real!)
Kinda boring as shit, but I gotta tell you it felt fuckin GREAT to look at all 5 of those programs after completing them, no matter how barbaric... especially when you complete 1 or 2 in a language you've never used or maybe felt really challenged by. Simple exercises that hold a lot of important, relatable logic no matter the subject is our lifeblood!!!9 -
So here is a mini rant from an amateur/hobbyist developer (me).
Over the past week, I've taken on a project that is much larger than any other projects i've attempted to handle (steam trading bot). This meant that there would be logic flaws, weird bugs due to unexpected behavior from shitty web apis (and their poor documentation hmmmm).
Anyhow, fast forward a few days and the code is complete. It's mostly functional, apart from a few glitches and unexpected behavior here and there...or so i thought. Apparently if someone trades and item to me that isnt in my pricegrid, the bot freaks out and kills itself, relaunches, and repeats this cycle (pm2). And i only found out about this on my way to school
So in desperation to fix such a critical flaw in my code (if my bot breaks a lot and doesnt accept trades, i can get banned from backpack.tf), i bust out my only device which is my phone, and start editing away (JuiceSSH and turbo client is godsend ty). 30 minutes later, after toiling through code with no indentation or syntax highlights (mobile pls), ive fixed it. So i push to live and alls well.
Then I arrive at school, pull out my laptop and decided to check up on my code to see if anything needs fixing.
Oh look in one line i used '||' instead of '&&'.
ok lets fix it.
ok lets push to live again.
I launched WinSCP to move the files onto the server, and just as the loading bar finishes and the file is overwritten, i realized; FUCK the code i had on my laptop wasnt the latest version i just worked on on my phone.
So that's that. 30 minutes of typing code without indentation and syntax highlighting on a 5 inch screen and it's all gone.
TLDR:
Version control is a must. -
I have push notification feature on my Android, iOS app.
When I send notification to apps, it was working normally but once no of users exceeded 1000.
I got following error:
Number of messages on bulk exceeds maximum allowed (1000) #48
I am using FCM to send this push notification.5 -
Contributing to big repositories on git be like,
and here goes my push,
Wait, I need to rebase
Ok, done, now push
Oh fuck, I need to rebase again.
The cycle goes on 😓 -
No matter how hard I try within a certain time window only certain options are available and unless I practically kill myself
Its difficult to push hard and far enough to get blessedly out of sync with the slave machine -
How do you deal with multiple git identities?
Im working fulltime + freelancing + working on my own projects and all of them are on different gitlab emails. It was very annoying to keep remembering to set my git email to a proper one each time I switch to work on another project.
Right now I came up with something easier:
I started using just 1 gitlab profile (personal one) and added my both company e-mails as secondary emails to my personal gitlab profile.
This way I can keep my git identity the same (personal e-mail address) and if I push to company1 repo or company2 repo the commit author e-mail addres is shown email@company1.com and email@company2.com as these emails are given access to private repos and they are added to my personal gitlab account.
Just wondering if these companies will see my commits to other repos by viewing my personal gitlab profile or no? Or if there is an easier way to handle multiple git identities without having to switch between them each time I open another project and want to push some commits.7 -
Remember, marketing does not want a better product. They just want dumber customers. So no need to push more features.1
-
When just push to github 2 hours before and u only change the views then theres this " the head of your current commit is different from the repo. Either push and pull to avoid conflicts" u tried pulling and its not working and you only change the views. No branch no other contributer. 😩
-
So I'm the only tester at my company, and I've had to adapt a lot of my skills to fit in with our in house expectations. So everything was fine when I focused on trying one component (manual and automation).
Slowly over time I've had more components to test with exact same resource of me.
Eventually my automatic breaks as I could no longer maintain that and all the other manual tests and all the other jobs I do ( light level internal it support, jira ticket rangerling, rollbar (error messages) basic investigation).
My boss keeps saying why is x,y,z not tested / missed while I can point to time periods where was focused on v instead so didn't get to others.
I keep wanting to just hit them with a keyboard until they realise 10± devs to one qa in our environment just isn't going to work.
I keep getting promised some dev time to help with qa so I can play catch up but never seems to arrive.
Don't get me wrong I'm not the best I used to be at testing(before joining I was proud of my abilities, maybe all stick and not enough carrot wears you down)
We keep taking on new work flows that make no sense (create a bug ticket, then a task ticket if bug take more than hour to do, then I'm stuck chasing developers to update their task ticket so I cam update the bug ticket (if its a bug then log sodding log time against it).
I've gotten to point now where I'm stopping my suggestions, explaining why something didn't get dome and will see if they can answer their own stupid questions
At what point do you stop ignoring the voices in your head (metaphorically).
Do other people go through this cycle where feel like pushing a boulder up the hill, for them to either push your boulder down the hill, replace it with a bigger boulder, move to a bigger hill, get you to move more rocks at once or all the above.
I know QA has its quite and busy phases but for me it seems to be constantly busy with no respite4 -
Just how the hell did we get here!? The culture war has no place in our community. People push their code under anon pseudonyms. When even.the normies are getting scared, you know we're in a very dark place.
https://youtu.be/v5VvJiNUCIA -
Fuck off. I cant push to github from 8 minutes ago because they fucked up. No one can push. I knew i shouldve used gitlab. Fuck github. Microsoft is fucking it in the ass just as expected3