Another day, another hit piece against gaming.

So, a 15-year old boy hanged himself and the media goes all „This was caused by this game“, even though NO FUCKING TRACES OF THE GAME WERE FOUND ON THE LAPTOP OF THE DECEASED!!!

And then of course my freaking parents go all lecturing me about how the internet twists the brain into not being adequate towards reality etc.

First off, CAN THE FUCKING COLLECTION OF COCKSUCKERS that is the fucking media just fucking get a grip on reality? It was literally said in the same sentence that the supposed game that caused that was not found in any form on the person's laptop. You would think an online game that you take months to play through would need at least some fucking download to run, right? Unless it was a freaking video chat bullshit that they call a „game“ just for the fucking spite of gamers.

Second, HOW FUCKING LONG WILL IT FUCKING TAKE FOR PEOPLE TO FUCKING ACCEPT THAT IT'S NOT THE TECH THAT MAKES PEOPLE KILL THEMSELVES? How hard is it to fucking understand?

Third... How do people in their 60s freaking think they understand anything about modern gaming when they have no freaking way of interacting with it other than these hit pieces? They certainly give more fucks about what a hired bitch of a lying „journalist“, that cannot even talk properly, says. Oh, they care so much about the children. Have they never thought that people are killing themselves exactly because they feel nobody cares about them?

Fourth. How fucking long do parents like mine deny the reality that just as long as they see me as an incomplete copy of my sisters I will be suicidal? Let me guess... It's video games causing me to be oh, so inadequate when I've not played any of them for quite some time...

Fifth... How am I out of touch with reality when these people have never known how I „work“, so to speak, as a person, and they've been the ones basically dictating all my life? Let me see why I'm unhappy...

I know I complain a lot. Sorry for that. But I just cannot stand people like them. People that lie all the time and project that on you while depriving you of any means of defending yourself in a debate...

I’m a senior dev at a small company that does some consulting. This past October, some really heavy personal situation came up and my job suffered for it. I raised the flag and was very open with my boss about it and both him and my team of 3 understood and were pretty cool with me taking on a smaller load of work while I moved on with some stuff in my life. For a week.

    Right after that, I got sent to a client. “One month only, we just want some presence there since it’s such a big client” alright, I guess I can do that. “You’ll be in charge of a team of a few people and help them technically.” Sounds good, I like leading!

    So I get here. Let’s talk technical first: from being in a small but interesting project using Xamarin, I’m now looking at Visual Basic code, using Visual Studio 2010. Windows fucking Forms.

    The project was made by a single dev for this huge company. She did what she could but as the requirements grew this thing became a behemoth of spaghetti code and User Controls. The other two guys working on the project have been here for a few months and they have very basic experience at the job anyways. The woman that worked on the project for 5 years is now leaving because she can’t take it anymore.

    And that’s not the worse of it. It took from October to December for me to get a machine. I literally spent two months reading on my cellphone and just going over my shitty personal situation for 8 hours a day. I complained to everyone I could and nothing really worked.

    Then I got a PC! But wait… no domain user. Queue an extra month in which I could see the Windows 7 (yep) log in screen and nothing else. Then, finally! A domain user! I can log in! Just wait 2 extra weeks for us to give your user access to the subversion rep and you’re good to go!

    While all of this went on, I didn’t get an access card until a week ago. Every day I had to walk to the reception desk, show my ID and request they call my boss so he could grant me access. 5 months of this, both at the start of the day and after lunch. There was one day in particular, between two holidays, in which no one that could grant me access was at the office. I literally stood there until 11am in which I called my company and told them I was going home.

    Now I’ve been actually working for a while, mostly fixing stuff that works like crap and trying to implement functions that should have been finished but aren’t even started. Did I mention this App is in production and being used by the people here? Because it is. Imagine if you will the amount of problems that an application that’s connecting to the production DB can create when it doesn’t even validate if the field should receive numeric values only. Did I mention the DB itself is also a complete mess? Because it is. There’s an “INDEXES” tables in which, I shit you not, the IDs of every other table is stored. There are no Identity fields anywhere, and instead every insert has to go to this INDEXES table, check the last ID of the table we’re working on, then create a new registry in order to give you your new ID. It’s insane.

   

    And, to boot, the new order from above is: We want to split this app in two. You guys will stick with the maintenance of half of it, some other dudes with the other. Still both targeting the same DB and using the same starting point, but each only working on the module that we want them to work in. PostmodernJerk, it’s your job now to prepare the app so that this can work. How? We dunno. Why? Fuck if we care. Kill you? You don’t deserve the swift release of death.

    Also I’m starting to get a bit tired of comments that go  ‘THIS DOESN’T WORK and ‘I DON’T KNOW WHY WE DO THIS BUT IT HELPS and my personal favorite  ‘??????????????????????

Sorry, !dev-related.

Today I wake up tired. Mother barges into my room and tells me I should be already ready, takes time to fucking argue, then does some cleaning(As if I never do it or something), and this evening she starts arguing about that again and just disconnects the plug from my PC, telling me I shouldn't have gotten a person who takes preparing way longer than me and who also got out of the car when I was ready to take off late AND that I should apologise to her for speaking „in a rude manner“, when just a few seconds ago from that she hit me. That hit wasn't painful. It still was a hit, though. Do I have to say how angry I got? As if I needed that. I'm already having trouble with not wanting to kill myself for a whole week nonstop. And she tells me I have to apologise or I don't get my PC back. Oh, I haven't gotten to the best part: My birthday's coming really soon. A week and a day later. Beats me how I will have to force myself to smile like an idiot again just because the actual idiots cannot understand the shit they've done to my mind. So much so I may not be functioning at all if I stay with them much longer.

This combined with all my family telling me how insane I supposedly am etc.

I might try a photography school. My friend(who could be my twin), has been nagging me about trying it...

I need a job.

I need a fucking place away from these blood-sucking leeches.

I need to understand how my horrible self-esteem has potentially fucked my whole life up and how much nerves I wasted on my goddamn nuclear family.

I also need to learn to forgive myself.

Many more, but I will end this here.

woke up at 5am

no alarm clock was required

my fucking passion woke me up to get up and code.

i coded outside in my backyard

felt like cold war

it was night

it was dark

a depressing horror atmosphere

just like my whole life

2 hours later i started seeing sun

it was cold outside. alone. in the dark. my arms were freezing.

but 2 hours later i managed to code the feature. it worked.

3 hours have passed. im ripped. quentally.

doing it here. inside now. started the day happy. dropped bullshit from day before. cleanser of all toxicss.

fuck the past. the past will pull you down and kill you.

this. remember. always do not forget.

I actually hate this job, seems like there's not a single project with decent code abstraction. Everything is a fucking spaghetti like:

```
// we only care about e-mail fields, which are odd
isValid(index) {
if(!(index%2)) {
return true;
}
...
}
```

Like MOTHERFUCKER, WHAT BUSINESS RULE DOES THIS SHITCODE REFLECTS?!?! WHY CAN'T YOU SHITHEADS WRITE PROPER BUSINESS ABSTRACTION RATHER THAN JUST COLLEGE-GRADUATE QUALITY SHITCODE.

FUCKING KILL ME ALREADY I SHOULD HAVE INSTEAD BECAME A PSYCHIC CAUSE I'M SURELY GOOD AT GUESSING WHAT THE FUCKING FUCK THIS FUCKING FUCKCODE INTENDS TO ACHIEVE.

AND YOU CALL YOURSELF TOP-NOTCH DEV CAUSE THIS IS JAVASCRIPT... YOU KNOW WHAT, SHITHEADS LIKE YOU, WHO DON'T KNOW SHIT OTHER THAN GLOBALLING EVERY FUCKING NPM LOCAL PACKAGE IS WHY GOOD ENGINEER LIKE US GET SHIT FROM PHPEPSI ZENDFRAMESHIT FUCKHEADS DEVS.

DO YOU THINK YOUR COMMENT WAS HELPFUL??? DO I LOOK LIKE A BUSINESS GRADUATE FUCKTARD WHO DOESN'T KNOW WHAT THE FUCK THE MODULE OPERATOR IS??? I WANT TO KNOW WHY YOU WROTE THAT SHITFUCK INSTEAD OF WHAT IT DOES; THE REASON I'M READING YOUR POORLY WRITTEN MODULE OPERATOR SOAP-OPERA IN THE FIRST PLACE IS CAUSE I KNOW WHAT IT'S DOING, IT'S BREAKING SHIT.

OH AND ONE MORE THING, FUCK YOU FUCK FUCK FUCKSHIT SHITFUCK FUCk

Just had a Mac user in a Linux chat. Guy was trying to setup MySQL, yada yada yada... Turns out that the guy didn't know what a PATH is.
Let that sink in for a moment. A developer, with a hipster MacBook that probably cost him several grand.. but doesn't know what a PATH is.

Please kill me. 🙂🔫

Just heard someone call Linux a programming language. Kill me now

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

This happened when I was on third semester of the career at university. I had my first boyfriend, the "Python" guy. He has that nickname because he used Python as his main programming language and nobody on the classroom used it.

In a few words, he was a... horrible human being. He talked down to me almost all the time, saying to me that my country was sh*t (he is from United States, and for a reason he never wanted to told me, he cannot go back to his country), that my university was sh*t and he said "you're will be lucky if you rot programming in a chair".

As you might wondering, yes, unfortunately it was a toxic relationship. Once he said he wanted to kill the teacher because he though that he hacked his laptop D:

He claimed that he was going to teach me python and security stuff, bla bla bla, but nothing. I learned python by my own.

I almost lost my faith in dev future because I though that the only ones that could have a real future in programming where people without ethics and only if they have a friend or a relative on a company.

The saddest part was that I dated him because I love smart boys, but he was just an idiot that, furthermore, wanted to change me (he pressured me to have tattoos, dye my hair and have sex, things that, of course, I didn't do).

I found courage to break up with him. I waited until the semester ends (in order not to lose my programming final projects) and, the day after the last day of class, I broke up with him.

I recovered my faith on programming when, next semester, one of the teachers invited me to give a python programming workshop :D and I gave two python workshops, and two of mobile development.

Now I'm working as a junior .NET developer. Thank God I broke up with him before the relationship became even worse. "Python" wanted to marry me after a year! O_O

I was excited about a Hackathon... got there and the theme was REGEX! Just kill me already!

Please for the love of god name your variables in a sensible way! How the FUCK am I supposed to read your shitcode if you decide to write 6 (!!!) nested loops with variables each named by exactly one character. With no comments whatsoever!

I would rather crack password hashes than this nonsense.

An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..

She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.

The one that I did 3 weeks ago that same fucking morning.

AND SHE WAS STILL NOT DONE...

A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me

Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"

She then goes to my fucking boss to tell him I am bothering her.

And omg... Please dear god please kill me now...

Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.

He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.

Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!

Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.

all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.

the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:

Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.

Me: I am only using this laptop for work so thats not possible.

Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?

Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends

Boss: Ahh okeee I see.. Well dont let it happen again.

After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.

Stop it with the Linux shilling already.

I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.

But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.

This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.

How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.

Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.

But then again, this is devrant and I love you all. Have a great week everyone!

So, I just got up, opened my sister's laptop to work (she gave it to me while I was in this small trip) and I see this. She was like "if you break it, I'm gonna kill you" and I said "oh no! What am I gonna do? Hammer it or something?" Fuck my luck, seriously

A quite normal Windows day:

Bios to Windows: "Go now! Get up!"

Windows to Bios: "Always slow with the young circuit boards."

"I've got something weird on screen."

Windows' answer: "Ignore it first."

Hardware assistant to Windows: "The user puts pressure. He wants me to identify this thing. Could be an ISDN card."

Windows: "Well, well."

Unknown ISDN card to all: "Will you please let me in?"

Network card to intruder: "You can't spread out here!"

Windows: "Quiet in the case! Or I'll cut both their support!"

Device Manager: "Offer compromise. The network card is allowed on Mondays, the ISDN card is on Tuesday."

Graphics card to Windows: "My driver retired yesterday. I'm crashing now."

Windows to graphics card: "When will you be back?"

Graphics card: "Well, not at first."

CD-Rom drive to Windows: "uh, I would have a new driver here..."

Windows: "What's ich´n supposed to do with it?!"

Installation software to Windows: "Leave it, I'll mach´ that already."

Windows: "That's nice to hear."

USB connection to interrupt management: "Alarm! Just been penetrated by a scanner cable. Request response."

Interrupt management: "Where are you coming from?"

USB connection: "I was in the computer right from the start. I'm joined by another colleague."

"You're not on my list." - "Say something."

Windows: "Hopefully there won't be another printer."

Graphics card: "The new driver twitches."

Windows: "We'll just have to get the old one out of retirement."

Uninstall program to new driver: "Go away."

Unwanted driver: "Fuck you."

Windows to Norton Utilities: "Kill him and his brood!"

Utilities to driver rests: "Sorry, we have to delete you."

Important system file: "Arrrrrrgghh!"

Windows on blue screen: "Gib´, the Norton Boys are over the top again."

Blue screen to user: "So, that's it for this week."

Excuse me for stealing your time

And I know it's way too long

Well today I got a fantastic surprise (truthfully). We hired a dev some months ago, who was on 6 months probation and, to put it politely, he was not going to pass it.

*side note: for details of some of the above, read my last 10 or so rants. They are pretty much all him.

Anyway, management put him on an improvement plan to make sure everything was fair, it wasn't working out, but they said we had to finish it to be fair.

So we had another 2 weeks left when he announced last night he's leaving for a new junior role, technical but not a dev.

Months of stress, heartache, bewilderment, late nights and weekends all just came to an end.

The English language fails me to express my overwhelming joy at this moment. The only way I can come close to it is to say that when he made his announcement, a colleague told me I should stop smiling as it could be taken as being rude.

I'd like to take this moment to thank the community for supporting me over the past few difficult months. Without you I probably would have tried to kill him with my dev rant stressball.

Thanks,
practiseSafeHex

🙁

Every girlfriend I had broke up with me and it was not even my fault...

1. A bi cheating on her girlfriend - girlfriend found out
2. Furry cheating on her boyfriend - she felt bad...
3. Hysteric b** that did not trust me for even 1 second
4. Really nice and sweet girl... that could kill me if she did not take her antipsychotics - told me she is sorry but she wants someone older (I am older than her...) - her ex before me was 42....

To clarify: both 1 and 2 did not tell me they were cheating on someone with me... I only found out after the shit hit the fan.

I feel depressed... I just want to love someone and I want that someone to love me... that's it, I don't even want sex, I just want hugs, mutual trust and someone that I could tell anything on my mind without them judging me...

As I was walking to the store, I found yet another piece of evidence of nature rape (aka fucking nature by littering of harmful substances). Just like last time I brought it home for proper disposal.

But if I ever find the motherfucker who did this, I have a nice punishment for you. I'll knock you unconscious, drag you home, take your phone and desolder its battery. Then I'll strap a plastic bag around your stupid face, and put the battery in there while it's being shorted. Quickly it'll heat up and you'll start to turn blue with that little bag being your only oxygen source. And when that battery puffs, boy are you going to fucking gasp it all in. Hopefully that'll be poisonous enough to kill you on the spot. If not, I'll have some fun watching you die from oxygen deprivation. Or I'll jam that very same AA battery that you dropped down your throat - you choose.

Call me a psycho all you want, but what does that make you, whoever attempted to further fuck nature by uncaringly dropping a battery on the sidewalk? Oh and let's not mention the results of it - a heatwave that's been going on for over a month now. Thank you so much for bringing the place that you deserve to be in - hell!

That moment when you Google an error and there are zero results.

Friend of mine killed his MacBook with some Softdrink.

Just poured it all over his poor a1502.

He let it dry for a few days, it starts to work again.
Except the battery.

Goes on Amazon and buys a new battery.

New battery doesn't work either and so he tells me about it and I as stupid as I am couldn't resist the temptation to finally work on a MacBook like my "hero" Lois Rossmann does.

So turns out the board is good.
Cleaned it up and basically nothing happened to it.

So what's the deal with "los batlerias"?

The first got hit by liquid, the second had a broken connection to a cell.
That could have happened through my friend, installing it without testing it first, or at the seller, so it being a DOA battery.

Now away from the stupidity of my friend and the situation to the actual source for this rant.

Once something happens to a modern Managed battery, the Battery Management System (BMS) disconnects the voltage from the system and goes into an error state, staying there and not powering anything ever again.
For noobs, it's dead. Buy a new one.

But It can be reset, depending you know how to, and which passwords were set at the factory.
Yes, the common Texas instruments BQ20Zxx chips have default passwords, and apple seems to leav them at default.

The Usb to SMBus adaptors arrived a few days ago and I went to prod the BMS.

There is a very nice available for Windows called BE2works, that I used the demo of to go in and figure out stuff. The full version supports password cracking, the demo not.

After some time figuring out how Smart Battery Systems (SBS) "API" works, I got to actually enter the passwords into the battery to try get into manufacturer and full access mode.

Just to realise, they don't unlock the BMS.

So, to conclude, my friend bought a "new" battery that was most likely cut out of a used / dead macbook, which reports 3000mah as fully charged instead of the 6xxx mah that it should have, with 0 cycles and 0hours used.
And non default access.

This screams after those motherfuckers scaming the shit out of people on Amazon, with refurb, reset, and locked fucken batteries.

I could kill those people right now.

Last but not least,
My friend theoretically can't send it back because I opened the battery to fix the broken connection.
Though maybe, it'll get send back anyway, with some suprise in the package.

Am i the only one that hates Google reCAPTCHA from the body down to the soul ?

- Click the Car
- The Blue Car
- The Truck
- The Truck Bus
- The Bus Truck
- With Blue Light
- Select the Bicycles
- Skip the house
- Find the sign
- With the blue bat
- Purple pink hat
- Click Traffic light
- We mean all Traffic lights
- Select Stores
- With Zebra Crossing
- ...
WTF!!! Just kill me already.

Dear senior developer with xx years of development experience, please, I BEG OF YOU hear my humble unprofessional opinion.

Not every junior is a inexperienced low life.

Even though I'm glad that I'm working with someone of your wide skill set and expertise, I'm not working with you by choice nor it is my intention to distract or "steal" your knowledge.

When I suggested using a newer version of jQuery for this new project that didn't mean I'm challenging you to work on something new for your domain, I'm merely suggesting this change because jQuery 1.2 is just old and a big portion of it is deprecated.

When I suggest some changes on your CSS selectors that doesn't mean I'm acting out of place, it is my genuine interest of having effecient css where possible.

I know you (in your opinion) are the best full stack developer in the industry, but maaaan you kill me when you use js and regex to validate input type=email (table filp) ... Haalllloooo it's 2017 this Sunday aren't we supposed to progress instead of remaining in the same old same ?

RANT!!!

Please don't kill me!!

I started using dark theme in all IDE I use just today.. all those years I was using Light theme !

Boss: Have you finished that feature?
Me: Almost there, i'm refactoring some classes...
Boss: What? Refactor? But thisnis a new feature, it does not need refactor! We don't have time for this!
Me: 😵🔫

This is what happen when you care about code quality.

Note to self: never ever touch the bugzapper that's busy zapping a mosquito! Always remember that there's well over a 1000 volts on there regardless of its power rating. Anything over 50V can kill you!

.. if only my drunken fool self would realize that. Seriously though.. the kick of a bugzapper's shock, it's amazing! Just like drugs however, don't try it at home. Oh well. At least not me but yet another mosquito has bitten the duster. Serves those parasitic bitches right!!!

TL;DR: Fuck you Apple.

10:30 PM, parent needs iPhone update to update Messenger. How hard can this be?
Need to update iPhone from 9.x to latest, which is so outdated it still required iTunes. Fk.

Boot iTunes on Windows 10 pc that is at least 10 years old.
Completely unresponsive
Crash in task manager
Launch and is completely unresponsive. (Also starts playing unrequested music.. Oh joy..)
Fuck this, go to apple.com to download iTunes exe
Gives me some Microsoft store link. Fuck that shit, just give me the executable
Google “iTunes download”. click around on shitty Apple website. Success.
Control panel. Uninstall iTunes. (Takes forever, but it works)
Restart required (of fucking course).
2 eternities later. Run iTunes exe. Restart required. Fk.
Only 1 eternity later. Run iTunes, connect iPhone.
Actually detects the device. (holy shit, a miracle)
Starts syncing an empty library to the phone. Ya, fuck that.
Google. Disable option. Connect phone. Find option to update.
Update started. Going nowhere fast. Time for a walk at 1:00 AM punching the air.
Come back. Generic error message: Update failed (-1). Phone is stuck installing update. (O shit)
1x hard reset
2x hard reset
Google. Find Apple forum with exact question. Absolutely useless replies. (I expected no less)
Google recovery mode. Get into recovery mode.
Receive message: “You can update, but if it fails, you will have to reset to factory settings”. Fuck it, here we go.
Update runs (faster this time). Fails again. Same bullshit error message. (Goddammit, fuck. This might actually be bad.)
Disconnect phone.
… It boots latest iOS version. (holy shit, there is a god)
Immediately kill iTunes. Fuck that shit.
Parents share Apple account
Sign in, 2FA required.
Fat finger the code.
Restart “welcome” process.
Will not send code. What. The. Fuck.
Requests access code on other parent’s iPhone.
No code present. What???
Try restarting welcome process again. No dice. (Of course)
Set code on other parent’s iPhone.
Get message “Code is easy to guess”. Ya. IDGAF
Use code on newly updated iPhone. Some success.
Requires reset of password.
Password cannot be the same as old password (Goddammit)
Change password.
Welcome process done.
Sign in again on same phone after welcome process done in settings. (Nice.)
Sign in again on other phone with updated password
Update Messenger.
Update hangs. Needs more space.
Delete shit.
Update frozen in App Store (Really??)
Restart iPhone.
Update Messenger.
Update complete past 2. Well that was easy.

Apple, fuck you.
Some call Android unintuitive, but I look at the settings app on iPhone and realize you aren’t any better.
This company hasn’t been innovative since 2007. Over 1000 USD for a phone? Are you fucking kidding me?
Updating an iPhone from iOS 9.x is probably uncommon anymore. But this is a fucking joke. Fix your shit.
Shit like this is why I’ll never again own an Apple product. I have HAD IT with the joke of a business.

Thanks for reading.

!dev && I'm fucking pissed

Bloody fucking mosquitos, FUCK YOU!!
If you couldn't evolve your shitty self over billions of years to be able to consume decent food instead of MY FUCKING BLOOD, then just let me fucking kill you already and eat my own fucking supper in peace!
MOTHERFUCKING PARASITIC ABOMINATIONS OF LIFE!!!

Wtf, really??? Are they trying to liyerally KILL ME????

Got home from hospital today wth my family. Baby got sick. Wife also caught cold... Bad news. It was just me still healthy like a raddish [we have such saying].
So I got home. Started feeling somewhat funny. Sore thighs, feeling nauseaus, chilly, a bit dizzy.

10 minutes later I'm fucking trembling! It felt as of I was kicked put bare ass to -20C outside! I'm not exaggerating [probably made some typos.. Pls correct me] - i live where winters get like -35C. Everything around got like twice darker. And my lower teeth got itchy af [NOT the best feeling, trust me].

I must have caught cold too - I thought to myself, cuz I know what these sympthoms mean. I always have 'em all when I have fever. Since shivers are caused by rising fever I got my Microlife remote thermometer out of my drawer. Click, blue light, wait, beeep. 36.5C. Allright.. Maybe I got it wrong... Try again -- same result. Wife also gave a couple tries - nada. Nil. Nullpointerexception. Healthy like a pickle!

10 minutes later I couldn't stand the cold. Got under my blankets wife made some soup, tea,... I still have this analog thermometer, the one with quicksilver. Pop it into my armpit - jusyt in case. 10minutes later I take it out. It says 39,5 and rising. Try the microlife again. 36,5. WHAT THE FUCK?????????

If I weren't so fond of old-school stuff I'd be in a fucking ER now!!

Fuck you medical digital equipment made to be used at home! FUCK YOU!!

I'm pissed.

Do you folks kbow where could I get those q-silver thermometers? Just in case. They're already out of matket in my area for quite some time... For being dangerous [i give 'em that, okay?] and.... Lisen to this.... "unreliable"!

FUCK IT!

When the entire platform mysteriously goes down for a half hour at 11pm ON A SATURDAY AND YOU'RE THE ONLY PERSON WHO WORKS ON IT GOOD GOD SERIOUSLY YOU'VE GOT TO BE SHITTING ME I JUST WANT TO SLEEP

WHOEVER DID THIS I WILL FIND YOU AND I WILL KILL YOU

Prologue
My dad has an acquaintance - let's call him Tom. Tom is an gynecologist, one of the best in Poznań, where I live. He's a great guy but absolutely can not into tech of any kind besides his iPhone and basic PC usage. For about a year now I've been doing small jobs for him - build a new PC for his office, fix printer, fix wifi, etc. He has made a big mistake few years ago by trusting a guy, let's call him Shitface, with crating him software for work. It's supposed to be pretty simple piece of code in which you can create and modify patient file, create prescription from drugs database and such things. This program is probably one of the worst pierces of code I've ever seen and Shitface should burn for that. Worse, this guy is pretentious asshole lacking even basic IT knowledge. His code is garbage and it's taking him few months to make small changes like text wrapping. But wait, there's more. Everything is hardcoded so every PC using this software must have installed user controls for which he doesn't have license and static IP address on network card.
Part 1
Tom asked me to build him a new PC that will be acting like a server for Shitface's program. He needs it in Kalisz (around 150 km from my place). I Agred (pun intended) and after Tom brought me his old computer I've bought parts and built a new one. I have also copied everything of value and everything took me around three hours.
Part 2
Everything was ready but Shitface's program. I didn't know much about it's configuration so when I've noticed that it's not working even on the old PC I got a bit worried. Nevertheless I started breaking everything I know about it and after next three hours I've got it somewhat working. Seeing that there's still some problems with database connection (from Windows' Event Viewer) I wrote quick SMS to Shitface asking what can be wrong. He replied that he won't be able to help me any way until Monday (day after deadline). I got pissed and very courteously asked him for source code because some of libraries used in this project has license that requires either purchase of commercial license or making code open source. He replied within few minutes that he'll be able to connect remotely within next 10 minutes. He was trying to make it work for the next hour but he succeeded. It was night before deadline so I wrapped everything up and went to bed thinking that it won't take me more than an hour to get this new PC up and running in the office. Boy was I wrong.
Also, curious about his code, I've checked source and he is using beautiful ponglish (mixed Polish and English) with mistakes he couldn't even bother to fix. For people from Poland, here's an example:
TerminarzeController.DeleteTerminarzShematyDlaLekarza
Part 3
So I drove to Kalisz and started working on making everything work. Almost everything was ready so after half an hour I was done. But I wanted to check twice if it's all good because driving so far second time would be a pain. So I started up Shitface's program, logged in, tried to open ANYTHING and... KABUM. UNHANDLED EXCEPTION. WTF. I checked trace and for fuck sake something was missing. Keep in mind that then I didn't know he's using some third party control for Windows Forms that needs to be installed on client PC. After next fifteen minutes of googling I've found a solution. I just had to install this third party software and everything will work. But... It had to be exactly this version and it was old. Very old. So old that producent already removed all traces of its existence from their web page and I couldn't find it anywhere. I tried installing never version and copying files from old PC but it didn't work. After few hours of searching for a solution I called Mr Shitface asking him for this control installation file. He told me that he has it but will be able to send it my way in the evening. Resigned I asked for this new PC to be left turned on and drove home. When he sent me necessary files I remotely installed them and everything started working correctly.
So, to sum it up. Searching for parts and building new PC, installing OS and all necessary software, updating everything and configuring it for Tom taste took me around what, 1/3 of time I spent on installing Mr Shitface's stupid program which Tom is not even happy with. Gotta say it was one of worst experiences I had in recent months. Hope I won't have to see this shit again.
Epilogue
Fortunately everything seems to work correctly. Tom hasn't called me yet with any problems. Mission accomplished. I wanna kill very specific someone. With. A. Spoon.

Ok so the good news is. My vacation is in 2 weeks. And also just got Hired, and handed a big project with big money

The bad news is They need to refactor and document their legacy code from last dev partner. And this is the commit history

OH MY FUCKING GOD KILL ME NOW!

The ultimate "I am vegan" guy will be arch linux user, vegan, trans, crossfitter and cryptocurrency investor. I've just met guy like this in my job. He did not shut up for a while. I am not sure whats he doing and whats his job but my guess is that hes paid for spreading cancer, sucidal toughts and eatig your will to live and talk with people...

R - retard
M - me

R: Hey CopyPasteCode I found this bug, it does 'this' insted of 'this'. *spreads arms to see his "muscles"*
M: *headphones off* Ok, I will look into it... *headphones back on*
R: Btw you invested something in the crypto, didnt you? Ive invested... ...bitcoin... ...crypto... ...litecoin..., do you think that... ...something... ...bla bla bla?
M: *tries not to kill myself after his 5 minutes of monolog* Ye sure
R: By the way Ive found this awesome vegan restaurant that accepts litecoin, would you like to come sometime?
M: *10 minutes monolog about vegan food and shit. At this point I want to die* Ok, I will now work on that back, see you later.
R: ye sure bro (wtf, "bro"?)... *looks like hes walking away* *teleports on my otger side touching my monitor*
WOW you are also a Limux user? 😮 Ivr installed arch linux this weekand and its so awesome, *another 6 minutes of monolog*
M: *smiling and preparing to kill him or myself* Nice, awesome *fake smile*
R: Anyway, I gotta go (FINALLY!!!), btw, I am going to the *name of local trans and gay club*, wanna go with me?
M: *after a month after a breakup with my GF (because she was cheating on me) which everyone in the office knew...)* Not really *trying to thing how to say "fuck off" without having meeting with HR*, I cant, I already have somethimg.
R: Oh, ok. Btw, you are rly cool bro (again), we should hang. We should hangout more often...

I hope someone is paying me for loosing 27 minutes with this guy.

FLOYD IS HERE 😎

Gather around kids, it's story time.

So my first breakup left me so damaged and I was in darkest phase of my life. I was alone. Physically, mentally, and emotionally. I went for therapy and spearheaded into success and grew in life soooo fucking much.

31st December 2016, I first joined dR and since the first day this place felt home. Met some of brightest mind and most amazing souls here (sadly many left the place).

I used to shit post and rant a lot. But I loved everyone here. But then I don't quite remember, but I decided to quit this place as community started to grow. Many others left as well.

I came back here in 2019 IIRC and started all over again. Got along well with new members and started having fun.

I used to crib and cry about being underpaid. Lost a kickass Europe job due to pandemic.

I will skip what all happened between me and @Scout but she is a sweetheart, though very rough and brutal with me at times (actually very often), but she is so selfish for me and cares for me that I couldn't resist but listen to her always. A lifelong friend for sure :)

I used to rant about my dumb office colleagues. Definitely not the sharpest minds but good people at heart (which I did not realise).

So in October 2020, I earned a new job and my company retained me with a 100% raise and a promotion making me lead of product innovation and UX.

November end I met a girl in professional context on LinkedIn who was conducting a workshop. Being hungry for learning, meeting new people and kill my lockdown boredom, I singed up.

Now I went for December break and my colleagues sent me a gift hamper when they came to know I got a promotion. I felt bad that I ranted about them so I deleted my account and also wanted a social detox.

Post the workshop, I started conversing casually with the girl I met. She was married. But things hit off. Eventually in February end I confessed that I had feelings for her and in next few days she reciprocated. I told her I was aware of her marital status and it's okay if nothing happens between us. Then she started to open up of how she was with one guy for 17 years and was abused in everyway and wanted to separate but never had the courage and all.

She decided to file for paperwork and then be with me. Things got messy when her family got involved thinking I was causing all of it.

She went back to her partner and I realised I had some emotional and mental issues of a person's past that bothered me. But we were overcoming it. Soon the honeymoon period started phasing out.

Her family started giving me death threats. We went underground even further. More arguments and fights between us.

@Scout kept telling me I was stupid and I disregarded her. I feel like an idiot for not listening to her.

That girl kept gaslighting me, hurting me intentionally, scratching the surface made me realise how broken and damaged she was. She lied to me and created fake persona of herself to make me fall for her. Everything was lie. Literally.

I felt horrible for trusting her. My trauma relapsed and I started having crazy panic attacks leading to self harm and being suicidal. That girl was drugged all the time with psychological medicines and very poor character & personality in general (I don't want to judge anyone but just stating the facts).

Eventually she just disappeared and I was like fuck this. Earlier, after every fight, she used to show fake affection and I used to melt but not this time.

I was like fuck this shit. I have some super amazing friends like @kiki who helped me overcome this. I started going for therapy and realised what all areas I need to improve. My therapist is soooo brilliant, she understands the root cause instantly and also knows how to fix it. And the same day I and both my parents were COVID-19 positive. Last few weeks were dark and haunting.

Further more, the girl comes back after a week and then acts as a 'nice girl'.
Initially fake affection, then drama, followed by making me guilt trip, then threats, and now blaming me.

I kept ignoring her calls (50 to 70 calls in a day), emails, left her unread on Telegram, and everything I could do to ignore her without blocking her. I started gaining my happiness back.

During this mess, I lost 5+ KG of weight. She has no friends in her mid 30s. Knows no life or survival skills. Her family hates her, no career, no emotional or mental maturity, literally nothing. Insanely dumb and toxic manipulative person who is not even worth being called an ex. As per her everyone around her is an asshole except her. Every time something happened, she used to blame and bad mouth the other person. Now she is doing with me. In all her life situations, either she was a hero or a victim. One upped me all the time. Now that I see it, I hate myself for allowing it all of it and now having enough self worth to walk out of it earlier.

Continued in comments...

What's the difference between a wasp and single loose hair?
Apparently none till the wasp stings :/

Yesterday I thought I had a loose hair on my neck.. ok, I shrug it off.. later again the creepy feeling.. shrugs off..

I continue to work, sumberged in code, wanting to find the fucker (bug, not the wasp/hair).. lean in to the monitor... 10 cents away from the screen... Ok, maybe that's it! Feels the hair on my back, near shoulderblades again... shrugging again more violently to get it further down to fall out.. nothing.. ok, got the bug, threw myslef back in the chair with substential force & BAAAAM!!! Motherfucking hair bit me!! O.o

I scream in horror & on top of the lungs (it was late, after work hours so I didn't expect anyone else still at the office) PROKLETA PRASICA (roughly translated to goddamn female swine).. I previously saw some green bug flying around the office and I thought that nasty thing bit me (didn't know they bite soo, much more horror for me).. O.o

Anyhow, I jump up from the computer and see my coworker looking at me all baffled.. I proceed to franticly take of my headphones and hoodie..thinking about wtf should I do now, I cannot get undressed in front of him (not for my sake, bra is the same as top of the bathing suit for me, but still..I don't want anyone suing me for impropper behaviour of undreasing in front of coworkers..), how the fuck should I get to the toilet?! O.o

C: Are you ok?!
M: Um.. sth bit me..wtf?!
C: There was a wasp flying around somewhere some time ago.. are you alergic?!
M: um..not sure, I don't think so..we'll see soon..

I proceed to the WC, to take off tshirt & check/kill off the fucker.. on my way there (walking funny to not press the hair to my body again) I got another surprise, another coworker was working late..

C2: Are you ok?! O.o
M: yeah, sth bit me, probably a wasp..

Ok, finally on the loo..ok, do not lock self in in case it escapes and you need help.. don't even shut the door. Check.. standing between the doors I contemplate on how the fuck should I take my tshirt off without angering the fucker even more and getting bitten again.. O.O

I lifted the tshirt up my back to let it out.. nope, not there..the creepy felling of buzzing around between my shoulder blades continues.. crap.. what to do?!

I stood there & contemplated the task.. ok, roll up the tshirt to the shoulder blades, not against the body (duh) to prevent further stings..tighten the fabric, so it cannot escape, quickly remove the band from the body.. done..reversed the tshirt and straightened it.. bzzz... Fucker fell somewhere.. Dafaq?! Was it really just a wasp?! If yes, no problem...but what if coworker was wrong and I got bitten by that nasty green whateveritsname bug?! Eeeeewwww! Is it poisonous? Gotta find it & kill it for good.. waited a bit, than saw a goddamn wasp crawl from under the toilet.. wasp!! Yess!! Stopm stomp fucker!!

I get dressed & go back to my desk..

C: Did you terminate it?!
M: Yup, fucker went on a toilet paper trip down the drain!!

I sit down, starting to get my headphones back on and proceed to work.., but before I could, one last gem:

C: CTO would say, thank god it didn't sting you in your finger cuz you wouldn't be able to type anymore..

M: O.O so true hahhahahaaa

Disclaimer - I like animals, but I freakking hate wasps..especially if they get under my tshirt to sting.. :/

I have got a new director at work. My previous director had to retire already, the man was already feeling it and he had been on the institution for more than 35 years....I am 30, so this tells you how much the man has been there.

This new dude.....has the presence of a Caterprie (Pokemon) or an Oompa Loompa. In contrast, the previous director felt like a 4 star General (never been in the presence of a 5 star since those occurrences are world war rare) but I had respected that man so much and loved working with him. I really did loved my boss, he was stern and professional, but kind and friendly to his staff, fiercely protective, no one took advantage of I.T while he was there, he would literally fight for us and took our word before anything else. The man was, well, a true man. A true leader.

He took a chance in putting me as the head of my department, but he had faith in me, and coached me and trained me as much as he could. Had the requirement for his position not been a masters he himself told me that he would have loved to make me his successor, even when I would constantly tell him that I was scared shitless of the work he did and the amount of things he did for the institution, to me this is a very laaaaaaaaarge cowboy hat to fill (this is Texas, he wore a hat, the saying is normally "shoes to fill", but fuck it)

This new guys looks away when the other managers are speaking to him. He constantly interrupts us. He constantly tells us about how the other institution in which he was (rival might I add) does X or Y, its fucking annoying to the point that me and the other managers have a drinking game, for every time he references his old institution we drink one beer over the weekend. It is Saturday night and I am 36 in in total (this is my favorite part of it tho) and it is just annoying.

His train of thought makes no sense to me:

"This application, where did you buy it? we tried purchasing one on Y when I was still there but found none"

Me: "Well, since it was a new government mandate and had nowhere to go we had to develop it in house"

Him: "We had tried to purchase what you guys had but found no place that sold it, so why didn't you try purchasing it?"

Me:.....well, because it was brand new, purchase it from where? We also don't like dealing with vendors that manage these sorts of things because every new requirement takes them weeks to produce on very high budgets, historically, my department has only had maintenance fees for the software that we have and even those applications crap themselves all the time and they take weeks to answer back to us.

Him: So you decided to develop it in house instead? we would never do that! back at y we purchased everything our engineers never really developed anything!

Me: Well then, what is the purpose of having engineers if they are not going to actually develop an application?

Him: IF there is something out there that is better then why should you reinvent the wheel?

Me: For this one I did not reinvent the wheel, I am not talking about creating a programming language from scratch, but how does custom solutions that specifically feed the needs of the institution to be produced otherwise? The department has developers for a reason, because they have very specific needs in here that can only come from a team of developers that are in house satisfying those needs.

Him: Well our engineers never had to do that. Sure projects sometimes had to put on holds because the vendor was busy, but such is the nature of development

Me: No it is not, the nature of development is to create things, it is one thing for my team to go through bugs and software considerations, it is another for me to not provide a service because some random company is taking two weeks on a $300 dllr an hour contract to put a simple checkbox on a form. If a project fails the board is not going to care that some vendor is not doing their job, they are just going to blame me, if that is the case then I would much rather the blame be actually mine than some sucky third party "developer" also, your engineers where not even engineers, they were people with a degree that purchased things, that's it, please do not compare them to my guys or refer them as engineers in front of me, they are not.

Him: Well, maybe.

MAYBE?!! motherfucker I did not kill myself learning the ins and outs of architecture and software engineering on my own time after my fucking bachelors in C.S for your codeless background ass to tell me MAYBE. My word IS the fucking WORD here, not yours. Fuck me I really dislike this dude's management practices.

The shitty part? He is not a bad person, he is not a bad dude that is out to get us, just a simple minded moron with no place as a leader.

I know leaders, I know what a leader is, this is not one.

WTF - I discovered that wasps listen to me!

Earlier when one came in, I tried to catch it with a glass and release it, or kill it if that wasn't feasible. This year, I tried pointing to the window and ordering "get out!" just because I was too lazy to take action. Of course, I didn't expect it to work, but it did. I thought it was only a coincidence, so I kept trying it. It works every single time!

Crazy shit!

Hello again, everyone. I've been busy with all the paperwork at my ship (will make a post about it later) but for now, I'll bore you with another story (not navy one, fortunately) to justify my slacking off.
And this story... is the story on how I got into ITSec. And it is pretty damn embarrassing. It all began when I was 16. I was hooked on battleknight.gameforge.com, a browser game. My father had just had ADSL installed at our home, and the new opportunities before me were endless. Well...
After I've had my fill with the porn torrents and them opportunities dwindled to just a few dozens, I began searching for free games, and I stumbled on that game. I played a lot, but as a free-to-play game, it was also pay-to-win. I didn't have a credit card, so I paid for a few gems with SMS messages. Fast forward a couple of years, I got into the Naval Academy. A guy came in to advertise something (I think it was an encyclopaedia or something - yes, wikipedia wasn't a thing back then) and to pay for it, we could apply for a credit card. So I applied. And I resisted the temptation for a year.
Note: prepaid wasn't that known where I live, so using credit cards was the only way for online transactions.
So I made 1 transaction. Just one. After a couple of months my monthly report from the bank came, showing a 2.5$ (I think) transaction on Paypal. I paid no mind, thinking that it was some hidden fee. Oh boy, I shit you not, I was THAT much of an idiot. Six months later, BOOM!
600$ transaction to ebay via paypal. You can imagine all those nice things that came to my mind. In any case, the bank accepted my protest that I filed at their central offices and cancelled the transaction. I promptly cancelled my card, destroyed it right there for good measure, and got to thinking... what the fuck just happened?
As many people here, I am afflicted with a deadly virus, called curiosity. I started researching the matter, trying to figure out how. And, because I didn't like black boxes and "it is just like it is" explanations, I tumbled down the rabbit hole of ITSec. I soon found out that, not only it was possible, but also it was sometimes EXTREMELY easy to steal credit card info. There are sites, to this very day, that store user info (along with credit cards info) IN FUCKING CLEARTEXT. Sometimes your personal, financial and even medical info are just an SQLi away.
So, I got very disillusioned on many things. But I never regretted it. It may cause me to age prematurely and will kill me of stroke or heart attack one day, but as I still tumble down the ITSec rabbit hole, I can say with confidence that
I REGRET NOTHING
Plus, my 600$ were returned, so look on the bright side :)

AM I THE ONLY PERSON WHO READS THE CSS !important RULE AS ACTUALLY SAYING THAT SOMETHING IS _NOT_ IMPORTANT EVEN WHEN IT MEANS THAT IT _IS_?!!

Just kill me.

I jump on an existing scala project.

git pull && sbt compile test

Tests are failing.

Me: "Hey team, the tests are failing."

Team member: "That cannot be. They were passing for the the last run."

Me: "Did you run them locally?"

Team member: "No, on Jenkins. It was fine."

I check Jenkins.

Me: "What do you mean it's fine. The last successful deployment was on the end of May."

Team member: "The Pull Request checker always went through successfully."

I check how our Jenkins tasks are configured. It's true that the Pull Request Checker runs successfully yet due to a "minor misconfiguration" (aka "major fuckup") the Pull Request Checker only tests a tiny subset of the entire test suite.

Team members were were fine if their Pull Request got the "Success" notification on bitbucket's pull request page. And reviewers trusted that icon as well.

They never checked the master run of the Jenkins task. Where the tests were also failing for over a month.

I'm also highely confused how they did TDD. You know, writing a test first, making it green. (I hope they were just one specific test at a time assuming the others were green. The cynic in me assumes they outsourced running the tests to the Jenkins.)

Gnarf!

Team member having run the tests locally finally realizes: "The tests are broken. Gonna fix them."

Wow. Please, dear fellow developers: It does not kill you to run the entire test suite locally. Just do it. Treat the external test runners as a safety net. Yet always run the test suite locally first.

First of all, I hate crammers so much. These people kill the industry without even understanding it. They turned interviews into exams, missed the point of hiring, and saw no distinction between knowledge and information all the time. They don't understand that if you can google an answer in five seconds, it's not knowledge. It's information.

They don't understand that questions like 'what will Python do if you delete an item from a dict while iterating over it' are complete nonsense. They don't understand that it's not 'dig deep'; it's just a bad practice that leads to errors, thus must be avoided. The fact of remembering 'RuntimeError: dictionary changed size during iteration' means that you haven't been avoiding it enough.

One more example. Which signature is correct?
- ApplicationListener<ContextRefreshedEvent>
- ApplicationListener<ContextRefreshEvent>
- ApplicationListener<RefreshedEvent>
- ApplicationListener<RefreshEvent>

Second. What's the point of forcing you to write compilable code in google docs? Do they really expect that one could possibly remember 'import org.springframework.beans.factory.annotation.Autowired;'? Seriously?

Third. Why do they expect me to know Spark, Java, J2EE, Spring Boot, Python, Kafka, Postgres, React/Redux, TypeScript, and work for miserable 70K EUR?

What's wrong with the European IT job market? Are they fucking nuts?

Find a place where management is able to handle some criticism.

I personally think Agile/Scrum is holy, and I don't mean "yeah we kind of do our own version of it", no, fucking do it by the book. The PM shouldn't assign estimates. Developers shouldn't receive bugfix requests from anyone other than the scrum master. The CTO can't be your scrum master... etc.

If a company can't answer the question "What were the points of feedback during the last retrospective(s), and how are those points being picked up?" -- Don't work there.

Many other things are optional in my opinion. I could work at a company without QA, without fruit baskets, table tennis, without Friday drinks. I could even live without git & continuous integration, just emailing patches to a patch integrator. I don't care.

But maintaining a safe bubble of serenity and sanity for devs to do their work in, that is an absolute must.

Also, option to WFH as much as wanted. Offices are nice for social bonding, but they kill productivity for me.

So I ve been clinically depressed for about 10 years now. Been really great at hiding it. My illness and loneliness was so severe that i made up imaginary friends and that got so severe i couldn't tell what s real and what s not. Then about 5 years ago, i met a girl. As the cliche goes, everything felt better. Sunshine and stuff. I opened up to her. Shared stuff. I started becoming normal. The pain became bearable and manageable. Turned to entrepreneurship. Had goals and stuff. Had 7 failed startups but kept on going. Raised investment for an 8th. It went better than anyother. Was going to become the next big thing bla bla. She became the reason i turned from being a loner weirdo to someone awesome. Anyway, as nothing tends to last, my best friend who had been through thick and thin in my work, quit last year in October. He messed up some work from big client nd we had a fight. He left. In the meantime i scored a big multinational company. I was gonna propose to my girlfriend in March this year. But instead she decided to leave for someone better who left her in 3 weeks lol. Anyways, we broke up. During that time, my second friend decided to fuck up my work with the big company so hard that they were about to blacklist my company. And then he left too. I had a small team. 4 5 people doing their best. By that time, i was the only one left. On 28th feb i had my breakup, on 1st march i was sitting 700 km away from home in an office trying to talk the company out of blacklisting us. It took me around 20 days to make that happen. All the while dealing with the obvious, my depression getting stronger than ever. My imaginations taking shape and fucking up my reality. The voices in my head getting stronget and stronger. 4 months now since she left. I dont think i miss her anymore. She tried coming back once but i didn't let her. In the 4 months, i m at my worst. I am getting government contracts now. But i have no desire to do anything. The pain is unbearable. So much that on its good days it sucks the life right out of me. So much that when it gets severe the urge to harm myself in any way goes of the charts. My best friend and i, we became friends again after my ex left. He s been helping me as much as he can. I have all the good oppurtunities and chances that any entrepreneur who has been busting his ass for 5 years straight would kill to have. But i cant do anything. I m the only one left on my team. I have to handle the business, dev, marketing etc etc ends on my own. I tried hiring and scaling up but i messed that up because of obvious reasons. And now my company has 2 months of runway left. And i know if i bust my ass i can make it to 8 months more and even raise a round a. But its really hard to do when either you re sleeping 20 hrs a day or you re sleeping 3 4 hrs because you re afraid of the nightmares. Or when even you ve had a good day, the pain becomes so much that you lay on the floor having a breakdown. Yeah, i m trying professional help. I m hoping it helps me. Because right now, i dont care about being happy. I just want my sanity. Something i m clinging to with every fiber of my being. Something that s burning out like a candle burning from both ends. I cant give up my work. I dont want to. That s all i have. That s all what i love doing and now i cant even do that. I just want this to end somehow. Either i get better and the pain and the void and silence and everything else goes away, or i do. I dont know what will happen first. And i dont care. I just want to be normal. But i guess that s too much to ask.

Fuck that bitch of a mother of mine. After what she's done to me, I would totally just fucking electrocute her (lawyers, this is a rage post not a real one, I've learnt from that previous psychiatrist that these rages can be taken improperly!) or just send a fucking EMP to her fucking "schermpkes" (EN: screens, displays, whatever! Technology!) or whatever. FUCK THAT FUCKING WHORE!!!

Yes she gave birth to me. Should I be thankful for that, in this world where for some fucking reason Flat Earthers still exist, Despastico and those goddamn fucking Paul brothers became a thing? FUCK NO!! I wish I wasn't born in the first place! Or rather, a thought that's been playing for a long time in my head. Why the fuck can't I just cryo myself and be reborn in the next millennium?! No, that's not possible because as it is now, humanity will likely have fucked up the planet by then. Majority of the people are still no more than self-jerking fucking monkeys. With their Instagram geotagging shit all over the place, nametests and shit like that. FUUUUUUUUUCKKKKKKKKK!!!!!!! Why are people like this?!!!! Why can't people be a tad more intelligent, why can't people actually learn about what this reality is all about?! Why is the burden of all this on scientists, no those who spoonfeed information into the mouths of the masses, like fucking Hashem Al-Ghaili (which is an amazing person but he's doing too much spoonfeeding IMO). WHY?!!! WHY AM I BORN IN THIS FUCKING DYSTOPIA?!!!!

WHY AM I BORN IN THIS FUCKING WORLD WHERE PEOPLE ARE INDOCTRINATED INTO "NOTHING TO HIDE, NOTHING TO FEAR"?!!!!! WHYYYYYYYYYYYYY?!!!!!!!! You've got a fucking brain, USE IT!!!!

I fucking hate this world. Someone hire a hitman on the darkweb to kill me and that fucking whore that gave birth to me, NOW!!!

Teaching new recruit some SQL (even though hes supposed to fucking know SQL and have multiple years experience but I was a contractor and idgaf, not messing up my money. Just fucking annoying to have an idiot around you all the time).

Me: Okay, so sys tables, so this one is for jobs yeah?

Him: Yeah

Me: Okay, so in this table, its obviously not one row per job per step cos you have multiple rows for the same job and step. Also, there is a datetime field, so what is it showing?

Him: Hmmmmm..... (after some time, back and forth we get to the answer).... history table

Me: Cooooooool, okay, so, lets say, I have a job with 5 steps. If i run it once, how many rows will be in this table?

Him: 5 rows.

Me: Correct, so if I were to have run this same job, 10 times, how many rows get inserted into the table?

Him: (Now...you have to understand, how long this thought process was, im trying to fill the gap with words but really, he was like, having a flashback or something...I kept quiet but silently wanting him to say anything....then he looks me dead in the eyes).... 10!

Me: Motherfucker what!?!? 10 What? If 1 time == 5, what does 10 times ==?

Him: Hmmmmmmmmm.... (yes...we are doing this whole flashback montage all over again)....... Ohhhhh, 1!

Me: .....Stop, think, its a history table. It holds history, for when every step is run for a job, why would it be only one row?

Him: OMG, I know what a history table is!!!!

Me: (Pissed off cos I don't take disrespect calmly). Fine, genius, answer, go!

Him: (LONGER WAIT THAN LAST TIME!!!!)....is it not 10?

Me: I swear, I'm gonna kill you one of these days.

Him: *chuckle*

Me: No...seriously....

TOOK 20-30 MINUTES FOR HIM TO SAY 50!!!!!!

And even then, I swear he didn't understand why. Serious, he was a special breed, had a manager that was a super tard and when I worked here, the spirit of that manager possessed this idiot, the CIO and his little right hand bitch zzzzzzzzzzzzzzzzz.

If there was ever a time I was willing to catch a case at work, it was there.

Bonus: Serious, it got to the point I had to come in and tell this idiot that he can only ask me questions today if he calls me by my name...and my name has changed today...and no, you can't ask me for it cos you need my name to ask me questions.....FUCK OFF kkthxbai.

Me: "Just upload the god damn file you bastard! I got called 5 times today because you couldn't upload this fucking piece of shit!"

Co-Worker: "Relax dude, I got all here on my computer"

Me: "....." (In mind: if you kill him later, you can hide the evidence)

Oh My God!

I just spent 2 hours trying to fix an issue. Just came to know that I was using the wrong index number from the array.

* KILL ME *

On my way to Taiwan, just 14 more hours of flight.. kill me! But hey at least I got WiFi

Holy fuck the Instagram Android app has the WORST UX I've ever encountered!

I'm a professional Android developer and my girlfriend had to explain how to see a specific "story" more than once; IE; tap on it until it rotates round to the first! But tapping on a video post turns on the sound! What kind of dog shit for brains moron designed those interactions to be the same?

I can navigate around the app until all but one of the tabs displays a profile page when I navigate back to it. Lost much?

The center tab breaks that but only because it opens up a whole new screen out of nowhere, (bye bye bottom bar!) which repeats the "photo capture" that you can also get by swiping left on the left most tab!

Don't even get me started on the swiping! None of the tabs swipe between each other, like the convention, oh no. But some of them can swipe, yes!

The first tab swipes left and right, where the hell do they go you ask? Look for the obscure icons at the top (oh and bye bye bottom bar again!). The forth tab swipes but only to the left, they have text tabs like standard. That screen that comes up out of nowhere I mentioned? That can swipe too, but now the text tabs are at the bottom for god knows what reason as the top is empty!

On the profile tab we have more tabs. These are icon tabs inside the content now. The first two change the post content from a feed style to a grid, okay, so far so good. The other two? You'd imagine they also change how you view content right? Nope, one shows your favorites, and the other replaces the whole screen with a "photos of you" screen! With not only the bottom bar still showing, but an up button! Where the fuck do we go "up" to on the home screen??

Then we have the bookmark icon on the toolbar, which opens up a new screen "Saved", guess where that tabs are this time? They're back at the top! You know why? Because the navigation bottom bar is still there!! And there's an up button!!

At this point I'm just about ready to kill myself using this fucked up, backwards facing, ass for a face app that is somehow one of the most popular platforms on the earth, yet seems to have been made by five different designers on opposite ends of the planet!

FUCK ME!!

Life as a homeless developer.

I'm a lil brainsick but homelessness makes you that way.
I started writing software as a hedge against an old injury i had from my teen years. I have a unique condition leaving me with limited use of my hand as such any jobs like cashier call center and they like are of limits to me, i can't hold change because my hands don't bend flat, and to much typing is excruciating. Therefore being adev should get the most bang for the buck that I have left. Ive been doing this for 12 years. Well it's all bullshit and unicorns. I can't get a job to save my life. All i get is calls from recruiters wanting a full stack retard. I'm an erlang developer for about 5 years, c# php no i can't do Photoshop or frontend gay as colors because it's a different skillet. Oh but trumpy says we're at the lowest unemployment ever, ya because we're all homeless and companies are still looking for unicorns, they don't exist just like the fake jobs which is the real fake news. In reality if a company wants you its because their dev left and you are to fix their broken shit, which never worked in the first place thus cannot be fixed besides I'm not a plumber. In my opinion many companies nowadays are run by liberal sjw children who don't value your time but want the product now, spoilt. Recruiters are the worst, gimme money because i touched your resume. I'd rather just kill myself than try to appease some fucking retarded children. Its so awesome to live in a tunnel while my skills entropy while i have 160 self published github repos, know many programming languages and be told your have no value. its those same children that dont understand the flow of money or value loyalty, claim we have all these jobs but no skillid employees, so they can bring in more visa overstayers, underpay them and claim record profits, the more you pay forieners my countries money the less there is to go around in the society leading to disenfranchised people like me, and you wonder why there's so many shootings in il. How long can i endure homelessness before i start becoming a criminal? Soon i will have no other option. You employers had a choice but I'm going out with a bang.

Okay, just wrote a program with memory allocation inside an accidental infinite loop and by the time I was able to kill it, it had already claimed 86% of my memory. Scared the shit out of me because my OS was CRAWLING for a while

My worst experience is, that I was fired after the third week in a new job. I worked then for a really small company.

My supervisor didn't like me and just wanted me out.

He asked for feedback and new ideas. I provided good reviews.

I even gave the company really good ideas, didn't get any credits for it, but they have implemented them now. Never got any credit for it.

I can look back and say that my supervisor then was a douche and wanted to kill off a young guy with a bit more technical knowledge and a vision.

For me it's in the past...

Now I got a way better job at a really gigantic company, better pay, much better work with better working times, a very friendly and helpful team, which appreciate my feedback and effort.

Sometimes it needs to get worse, to have later something better.

Now I can enjoy my new job and go everyday with a smile in my face :)

rant, but not an IT kind... okay, maybe not even a rant, more like depressive rambling:

in 3 days, I'll turn 29.
i'm living with my mom, in the apartment where I was born, in the room i've been living since I was born (with the exception of 2 attempts to move out which together lasted 9 months).

my theoretical monthly income should/could be around 4000€, based on my skills and experience.

but I'm a (manic)-depressive, chronically lonely idiot loser (and the manic phases come more and more rarely in recent years), so
my practical average monthly income fluctuates from 0 to about 200.

i am unable to keep a job for more than 4 months, so after being fired from about 20 or so of them since I was 18, it takes immense amounts of mental and emotional energy to even start looking for one now... so I usually don't.

i've been about 12000€ in debt for the past 8 or so years, half of which is just debt collector fees.
it's kinda funny, for years, i've been unable to solve a debt which theoretically amounts to 3 months of my theoretical achievable salary.

my father, who just left without a word of explanation when I was 18, has decided this is not viable anymore, so I'm supposed to move out by 10th of next month, "either to some cheap rooming house, or under the bridge, I don't care", as he put it.

I can't remember how it feels to exist a single hour without feeling existential dread and dreading each next day, not knowing what to do or if i'll even be able to try and do something, because this feeling is so strong that it often blocks me from being able to do anything. i just shiver most of the time that i'm awake, feeling like you feel few minutes before puking and crying at the same time. and that feeling is my "how are you?", "you know... normal".

i can't remember what it feels to feel any other way and can't even imagine it, and can't imagine that I'll ever achieve any less shit feeling.

literally all of my social contact consists of going out once to twice a month with the only 2 friends and 2 aquaintances I have who have the time and will to spend it with me.
oh, and hiding in my room, avoiding talking to my mom, because each time we talk she just reminds me what a piece of shit failure I am, and tells me how it's not that hard to change it, I just have to stop being lazy and start working for it.

she's... kind and caring about it, which somehow maybe makes it even worse.

i have about 10 almost complete game designs, each of them at least 50% more original and interesting (at least to me) than the things that are coming out for the past 10 years, being lauded as "the most original and unique".

I have been trying to make them, ANY of them, since I was 18, but I always lose all the drive and resolve and energy in like 4 months, because it's like trying to build a city on my own on a deserted island. too big for one person, but there was never anyone to help me. closest I ever got was one of my friends telling me "i've been thinking many times that i'd love to work on some project with you, if I had the time".
and second time, when I actually found an artist I was going to pay, and he was awesome, and after two weeks of me telling him how awesome what he does is and how it fits the project and my ideas perfectly, he backed out saying "i'm afraid I can't do the quality you require from me".

never ever in my life did I get actual help with something I actually wanted or tried to do.

i have no idea how it feels to have someone working with me on something I actually consider interesting and meaningful, on any of the things which I wanted to make, which made me learn programming.

I've learned graphics and animation and everything going into game making pipeline on my own because I realized nobody will ever help me, so I'll have to do all of it on my own.

I've tried to make a kickstarter once, but I started crying hysterically in the middle of writing it, because I felt like a begging piece of failure shit, even more than usual, so I deleted it.

most of people treat me like shit failure unworthy and undeserving of living, precisely as I myself know I deserve to be treated, because that's what I am, but when I ask for permission to kill myself, since I see no other solution to stop being a burden, they get angry at me that I'm just emotionally blackmailing them. when I afterwards ask them "so help me in any way to do any of the projects i want/need to do", they respond they've got no time for that.

when I talk about all of this, I get told to stop whining.

happy 29th birthday, me, a piece of shit who should've never survived this long, who should've never been born in the first place.
yay.

also, I know this is not the kind of crap that's supposed to be posted here, but i've got nowhere else. sorry.

Me: I have terrible life, terrible job and I will kill my boss.

Someone: just think positive.

Me: oh thanks

Guy: - "Your restart script doesn't work."
Me: - "What do you mean?"
Guy: - "It does nothing."
Me: - "It should kill every processes that's running within the project and start them again. Wait... Why do you terminate it?"
Guy: - "I don't. It just stops."
Me: - "It says `Terminated` here. You killed it. Just let it do it's job, don't kill it."
Guy: - "I'm not killing it! It just stops!"

(...two hours later...)

Me: - "Wait... Where do you run it from?"
Guy: - "What do you mean? I just run the script you gave me."
Me: - "Yeah, but where do you run it from? Where did you put it?"
Guy: - "It's part of the project so I put it in the project, d'oh!"

If you are sick...

STAY THE FUCK HOME!

It has nothing to do with how YOU are feeling. It’s about RESPECT for those around you.

Especially if you work in an open office. Coming into an open office when sick is like coughing right on someone’s face repeatedly, it shows that same level of (lack of) respect.

Almost every company I have seen fucks this up so bad. It’s the same shit every year....

People are afraid to take days and stay home. They go in and make everyone sick, then everyone is taking days off and we are “short” on people. Then the incompetent CEO is scratching his head as to why this toxic work environment could produce such a toxic result.

And one more fucking thing.

If you got a cold/flu on Monday and your in the office on Wednesday because you are “feeling a bit better” then your a fucking idiot. At day 3 you are just starting to expel germs while still being highly contagious.

If you come into an open office while sick then I would say...

“Smarten the fuck up! And start showing some respect for the people you work with!”

If you have created (or are creating) a culture that encourages this then I would say...

“Fuck you! You should be fucking smarter than that.”

————

If your still sitting there thinking something like...

“Well I have to attend the meeting” or some other shit. Then let me add this to the pile.

Not everyone has had a rosy fucking life.

You may be working next to someone who has a lowered immune system due to past medical problems. What may be a week of sickness for you could end up being a month in the hospital for them.

You may be working next to a person who has a family member dying of cancer. If you make them sick then they can’t visit that family member (colds can kill cancer patients) and you may be stopping that person from seeing their loved ones one last time before they die.

Don’t be a fucking asshole.

STAY THE FUCK HOME!

In the last project i worked in, the product owner wouldn't treat people as people but as resources.

The problem with that is you just look at people and their work in terms of a checklist and remain blind about real humans face.

She wouldn't understand the challenges of building something with an absolutely new stack which people needed to learn from scratch and put pieces together. She wouldn't be supportive of people trying out things and fail.

One fine day I told her that I was spending too much time on meetings and i should be excluding that time from available sprint timings.. she made me open my calendar in a screenshare session with all team members. Made me go through go through every meeting invite i had on calender and ordered which ones should i be attending from then and which ones i wont. That was insulting. It broke the trust.

I decided to not work with the project. Stopped putting my heart and soul into it and eventually got out of it in a month time.

Don't put your team into a position like this ever. You have to trust them with the problems they face and try to find a solution. Scrutinizing and micro management will always kill the team.

Our customers are fucking incredible QA Engineers, holy fuck tits. Every single day, some fucking fuckface finds a way to break this garbage can legacy application that I've spent the last year combing over and patching as I find problems or are otherwise made aware of them.

Honestly, I have some QA background myself, but these types of issues would just absolutely never in a bajillion shitting farting years occur to me to do.

They are masters of breaking shit, I am so FUCKING IMPRESSED. Almost as impressed that this application hasn't been replaced after ten years of bullshit, and that the two massive fucking retards that preceded me didn't just do it the right way by accident or fucking kill themselves out of shame.

User: "I emailed my spreadsheet to a colleague. Why can't I see their updates in mine?"

Please just kill me now.

Look, I don't know why, but after sitting around doing nothing, I think he wants to kill me.
Send help.

I mean just look at him, staring right into your soul.

TL;DR
I accidentally surpassed(?) my user permissions and closed some of my classmates browsers and locked up a terminal for me

In school we have 2 primary operating systems: Windows and Ubuntu. Windows is hell in general and but not as hell as the firefox installation on Ubuntu.

"Just loaded this page. Now wait half a minute so that I can render it"
"Woah, woah, woah. Slow there. You just made an input event. Give me those 5 seconds to compute what you just did"

Executing "top" or "htop" shows you a long list of firefox processes with a cpu usage of 99.9%, since the whole school shares that linux environment.

Anyway, one day it was way more servere than normally and I way forced to kill my firefox instances. So I pressed CTRL+ALT+T for that terminal, waited 5 minutes until it accepted input typed "killall firefox" with a delay of half a minute per character and smahed that enter key.

At this very point in time I could hear confusion from every corner of the room. "What happened to firefox?"

Around 30% of the opened browsers where abruptly stopped. I looked back to my screen noticed I was logged out. I couldn't login from that terminal for the rest of that day.

Our network admin, which happened to be there, since the server is just next door, said that this was just convenience, but the timing was too perfect so I heighly doubt that.

I felt like a real hackerman even if it was by accident :)

The more I use Go, the more i start to like it. I didn’t realize how nice being able to generate binaries for every OS that matters was, until I had that power. It beats the hell out of trying to distribute a Python app for sure.

Sure, it has its warts.

It’s overly bureaucratic in the same way Java is.

I hate that you can’t import something without using it (most people I’d wager preemptively import libraries they know they’re gonna need even if the code isn’t written yet)

I really wish there was a way to just say “See this JSON blob? All those keys and values are strings, trust me, you don’t need me to tell you the type of each one individually.”

Generics would be nice.

I’d kill for exceptions - any decently sized go program is going to have very many if err checks where most could be condensed down to a single try/catch in most other langs.

I wish the tooling was better. Dependency management was a solved problem when Go was released and yet they chose to ship without it. There’s still no standard. Many hours of time have been wasted dinking with this.

But ya know what? Even with those warts, it’s still easier to write than Java. It’s still write once run anywhere, it’s blazing fast, and doesn’t require your end user to install an entire freakin runtime.

<3 Go

Fuck. I can't take this shit anymore.

There was a project where we had to implement third-party system for government agency processes management. For some reason, probably because my work is cheap for my boss, the task was assigned to me. Just as a reminder, I'm a .NET Dev. Zero experience in server management. Zero experience in external services implementation.

Anyway, system producent, also an government agency, got angry, becasue they can only earn money on implementation. They have to give the software to other agencies for free. Because of that I've got client program, incomplete documentation and broken scripts for database creation. It took me 2 months to get it all to work but at the end client was happy, my boss got paid and I've got 500 PLN (~130 USD) bonus.

Everything was fine for a while, but after a month server has started freezing everyday, some time before 7 am. The only way I found to make it work again was to restore snapshot made everyday at 10 pm. For a month I was waking up earlier and restored snapshot, and after that my boss took it upon himself. I tried few times to find a bug and fix it, but to no effect. Even person with much more experience with it tried to help but also couldn't find anything.

My solution? Copy all the data and configuration, create new machine, copy everything and check if the problem persists. If not, kill old server. Client won't even notice. But nooooooooo... It would cost my boss a bit of money and I'd need to work on it and he can't let it be, because I'm the only developer working on his flagship product. He'd rather wake up everyday and restore snapshot. Okay, as you wish.

And today, finally, everything went downhill. Snapshot wasn't created, server froze, backup can't be created. Nothing can be done. Client is furious, because they have had reported this problem and a few times restoration was too late and they couldn't work. No one knows how to fix it, I'm not working today (I'm still studying and am available only 2 days) and situation is really shitty.

BUT SURE. ITS BETTER TO RESTORE SERVER EVERYDAY THAN JUST FUCKING FIX IT.

Oh, also, there's no staging or any other real backup. We have snapshots for each day and that's that. Boss' order. Why do I even care...

Six years ago I created a drupal page pro bono for an organization I'm in. Was my first site really, was hacky af, in retrospect, I created an unmaintainable monster. And as it usually happens, I moved away, the site stops being properly maintained, opening admin view just cries "please update me" (or was it "kill"? Not sure here). Now I'm back in town and get a call from the current one in charge requesting a training. I thought this evil dark dev history of mine is now finally returning to hunt me forever. But no, she actually understood it, and after half an hour she was perfectly capable of maintaining the site. I'm stunned.

Just realized that my "cheapest that money can buy" printer reboots faster (and a lot too) than my fairly high-end but as proprietary and shitty as routers can be Fritz!Box router. German engineering no less.

Kill me 🙂🔫

OMFG! Who’s bright fucking horrible stupid ass idea was it to mix Ajax with php (php deciding the ajax paths) with random js outputting HTML inside random fucking static divs found no where near the logical route of content.

Trying to add a simple fucking status to a gigantic cluster fuck of a legacy project is just FUCK.

If I could I would burn this bitch to the ground and start again I would, But no, it’s needed.

Someone kill me before I break the shit out of this thing, I would take a wordpress project right now instead.

"As it turns out, this world isn't all that complicated. It's pretty simple actually. It's all a game, a very simple game. Of course, some will try to make it difficult. But you can handle them, I know it. I know you can!"

There's a lot of truth in that. When you get into the depths of how the world works, things turn out to be pretty simple.

One thing I cannot rationalize though. The human spirit. The desires that it embodies. I've had this question for so long - what makes us humans human?

If for example a future surgeon - able to exchange individual cells between me and you - would do so, at which point do you become me, and the other way around? 50+% exchange? But that'd mean that at least part of me is still "you". In that state, are you truly you?

Not sure what the cellular definition of an individual is, given that we're headed towards a bionic society where synthetic organs will likely become more relevant than the donated parts of me that I've recently applied as a donor for. I wholeheartedly encourage that future, but the philosophical questions that surround it become more relevant.

How about the impact of influencers on the mind? For example, I've seen the term "certified enganeers" become a trend here, which I'm very grateful for. It does raise a question though. If for example I were to die, would the term live on? And if so, is that a part of what makes me "me"? Would a part of me live on in you? Would your spirit be partially me, due to mere influence?

What makes up the human creature anyway? I think of my own body as a mere vessel for my mind, but I can't quite grasp what makes up the mind, and philosophical questions like "if I were to upload my mind to a robot and instruct it to kill me, would that carbon copy become *me*?"

The human nature is such a weird thing.. and technology doesn't make it any simpler. Is it really just a simple game, with simple rules and e.g. a biological program running inside of a biological motor? Or is there more to it?

Ok, so I'm one of the new folks here, and spent some time looking around.

And I've read so many of you write about levels of insanity at work that just baffles me.

Why do people do that to themselves? And no, I don't mean you sales-manager, or your boss who hired the wrong kind of dev, I mean YOU.

You are a developer, currently the market for devs is so large you can literally pick your jobs. And if you don't know how to find a new job, just Google (easy mode, search on LinkedIn) a company which specializes in recruiting, there are tons of them, and they will gladly search an employer for you.

Don't get stuck in a job that sucks - you will kill your motivation, and you deserve better.

The codebase I'm working with hss rarely comments on it. But when there are comments written they are shit like:
//Kill Matt

//don't ask me where that hard-coded value came from, it just works

//we have to add the elements to the fucking list

Reeeeally helpful. Yep.

Fucking kill me. Is this really all we do with our lives?

1,715 JIRA-related emails. ALMOST TWO THOUSAND EMAILS. I mean seriously, that's BY FAR the largest email filter I've got. I mean I had them muted of course, but when you really think about the whole thing... are we just wasting our lives chasing some garbage that doesn't really matter? ugh.

Death approaches...

Friend of mine created a blog from scratch... You could create a post, by just sending a POST request (no authentication required!)....
As an additional bonus: you could dump full unfiltered HTML in a post, which was then executed...

Please kill me

Client: I want a new feature for my chat bot. It should be able to rap.
Me: ... k
*monologue: wait u w0t m8*
Also me: Can you please go more into the details? It should be able to rap. Ok. But how do you want it to look like? How "strong" should be the discrimination level, for instance?
Client: It should beat ass, yo.
Inner me -> core me: Let us just ignore him. We won't be able to do it, since he isn't really explaining his needs. "It should be able to rap". We are not wizards.
Core me -> inner me: Chill. We will just use some insult apis, combine it with cleverb0t api et voila.
Me: Alright. I got an idea for it. I can do it within this week. And if you don't like it, I will ofc do some changes to it.
Client: Hmmm... that's nice and good. But within 1 week?
Inner me: I can't do magic and pull that feature out of my fucking ass!

Clients... clients... clients...
0. Don't expect us to be done in a few days. We are also humans. And not fucking machines.
1. Do us (all devs on planet earth. -Microaggression in 3, 2, 1..) a favor and (kill yourself) learn how to request a feature.

Follow-up.

After getting fired last week, I went to the company today to take my papers, then the security guard asked for my government ID and refused to let me go the 5th floor to HR office, apparently because they had a meeting, then they had me waiting 20 minutes in the ground floor at the reception and when I asked if I could go to the bathroom he came in to the elevator with me and waited for me to get out to escort me back, I was so fucking furious by this point I just had it and told him who gave you the orders to take my gov ID and escort me everywhere like I'm a fucking maniac or a thief? Are you afraid of me breaking chairs or destroying offices or you think I'm gonna kill someone?

He then told me sorry sir but it's the orders, then I went to HR office and complained and called for the manager and she just came out with a bunch of BS, uhh I'm so sorry sometimes security can be a bit rude and what not.

SO YOU FUCKING MORONS THIS IS THE LAST TIME I'LL EVER BE COMING TO THIS FUCKING COMPANY AND YOU CAN'T EVEN GIVE ONE GOOD IMPRESSION FOR 30 MINUTES? HOLY SHIT!!!

Never in my life have I seen such incompetence, I just kept getting shocked to the last minute.

This is how beautiful corporate is -

I talked to my cousin recently who works in an MNC. He told me about a team member who was assigned a Google Login integration task on the website. They already had a username/password combo working.

That team member took 2 months for it. Every week on the team wide meeting he took an off day and kept saying he was 'stuck' on the task and he's figuring it out.

2 months later, he completed the task and got compliments from the manager that he 'worked day and night' and overcame his struggles. Then he got a week off for his 'efforts'.

Just kill me at this point.

if (boolValue == true) ...
I know it works, but just kill me now.

oh, it got better!

One year ago I got fed up with my daily chores at work and decided to build a robot that does them, and does them better and with higher accuracy than I could ever do (or either of my teammates). So I did it. And since it was my personal initiative, I wasn't given any spare time to work on it. So that leaves gaps between my BAU tasks and personal time after working hours.

Regardless, I spent countless hours building the thing. It's not very large, ~50k LoC, but for a single person with very little time, it's quite a project to make.

The result is a pure-Java slack-bot and a REST API that's utilized by the bot. The bot knows how to parse natural language, how to reply responses in human-friendly format and how to shout out errors in human-friendly manner. Also supports conversation contexts (e.g. asks for additional details if needed before starting some task), and some other bells and whistles. It's a pretty cool automaton with a human-friendly human-like UI.

A year goes by. Management decides that another team should take this project over. Well okay, they are the client, the code is technically theirs.

The team asks me to do the knowledge transfer. Sounds reasonable. Okay.. I'll do it. It's my baby, you are taking it over - sure, I'll teach you how to have fun with it.

Then they announce they will want to port this codebase to use an excessive, completely rudimentary framework (in this project) and hog of resources - Spring. I was startled... They have a perfectly running lightweight pure-java solution, suitable for lambdas (starts up in 0.3sec), having complete control over all the parts of the machinery. And they want to turn it into a clunky, slow monster, riddled with Reflection, limited by the framework, allowing (and often encouraging) bad coding practices.

When I asked "what problem does this codebase have that Spring is going to solve" they replied me with "none, it's just that we're more used to maintaining Spring projects"

sure... why not... My baby is too pretty and too powerful for you - make it disgusting first thing in the morning! You own it anyway..

Then I am asked to consult them on how is it best to make the port. How to destroy my perfectly isolated handlers and merge them into monstrous @Controller classes with shared contexts and stuff. So you not only want to kill my baby - you want me to advise you on how to do it best.

sure... why not...

I did what I was asked until they ran into classloader conflicts (Spring context has its own classloaders). A few months later the port is not yet complete - the Spring version does not boot up. And they accidentally mention that a demo is coming. They'll be demoing that degenerate abomination to the VP.
The port was far from ready, so they were going to use my original version. And once again they asked me "what do you think we should show in the demo?"

You took my baby. You want to mutilate it. You want me to advise on how to do that best. And now you want me to advise on "which angle would it be best to look at it".

I wasn't invited to the demo, but my colleagues were. After the demo they told me mgmt asked those devs "why are you porting it to Spring?" and they answered with "because Spring will open us lots of possibilities for maintenance and extension of this project"

That hurts.
I can take a lot. But man, that hurts.

I wonder what else have they planned for me...

Spent a month working on a website that relied on crawled data
Got the memory leaks and usage down from 700mb to ~150mb
CPU usage from ~100% to <5%
Shrink-wrapped the DB requirements based on data
Created self-supporting services and what not

When everything FINALLY worked good enough for me to look at it and go "damn, this actually worked"
the whole monitoring sys got dyed in red :v
A quick look up and my crawlers exhausted my godaddy's per-user db limits.

Kill me.
Just fuckin kill me.

When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁

"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|

"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|

"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|

"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams

Wow, I just realized the marketing teams of most of the companies I have been dealing with are some cold sociopaths.

Every other letter that pops in the mailbox is filled with dark patterns trying to guilt me into opting in to their continued spam:

Subject: Most awesome husky puppy!

Look at this beautiful husky puppy. Isn't it beautiful.... It would be sad if something happened to it... But I am afraid... Something will happen to it...

If you don't opt in to our email message... I am afraid we have no choice... We have to kill this puppy. End it's life... We have no choice. I wish we did! Nothing would please us more than keeping this beautiful-beautiful puppy living and playing....

But if you don't opt in... We have to cut it's throat. Leave it lying on the ground, bleeding out as the life slowly fades away from it's pretty blue eyes...

And Remember: it's not us who killed it... IT WAS YOU! YOUR ACTIONS LEAD TO THE DEATH OF THIS PUPPY! YOU.... YOU FILTHY MURDERER!

Pls opt-in ok, then we are all good. Puppy lives! Just opt in. Ok? Yeah, you know what you have to do.

Voting feels like shit.

Seriously. Why? Because I have to vote for parties and representatives that might have one interest in common with me but go against my points of view almost all of the time. "We'll introduce a freedom of information act and legalize weed for better drug policy and youth protection!" -- WOW Great I'll vote for yo .. " ...and we'll also come to your home kill your dog, rape your family and shit in your back yard." -- oh f*** WHY? why do I have to live in a system were I am constantly forced to trade shit for even worse shit? Why can't I vote for policies or at least some kind of 'single' - issue representative?

I know that solving this problem is not easy and I do not claim to have the magical solution. "Not voting is even worse" sure but I am getting so fucking tired of it. It doesn't feel like progression and it sure as hell does not feel like it matters because in the end of the day you are just voting for the party that's at least going to use lube when raping you. I hate these ad hominem politics where we don't discuss the ideas but the people who represent them. I honestly don't give a fuck about who you are, if you're gay, married, or are left-wing, right-wing, conservative or liberal, in the end its about finding a good solution for everyone and not about the people implementing it. I don't care about politicians private lifes or worldviews (in terms of ideals, morals, religion etc.) , I care about finding the solutions to problems and having a wide array of opinions in order to discuss ideas and to find a valid and good way to go forward. "you can't agree with that person at all, because he's evil", yeah you know what? I don't care. It's about the ideas, arguments, discussions and solutions, not about the people who discuss them.

"I made a discovery today. I found a computer. Wait a second, this is cool. It does what I want it to. If it makes a mistake, it's because I
screwed it up. Not because it doesn't like me...
Or feels threatened by me...
Or thinks I'm a smart ass...
Or doesn't like teaching and shouldn't be here...
Damn kid. All he does is play games. They're all alike."

My ideal job:
Getting payed to develop for awesome open source projects from home, at any time I like.

My current job:
Full time 9 to 6, outsourced security sysadmin, dealing with bullshit systems and stupid end users.
Getting home with barely enough strength to self learn and develop my own projects.

Just kill me

I just remembered something I did like freshman year of high school lol

So our school system had just adopted a new site blocking program. It did even better than the one we had used before it.

Literally every good site to play games was blocked, and it really pissed me the fuck off. I had an easy class that was in a lab, and I finished my work early literally everyday, so I played the games to kill time.

Finally I got fucking fed up, and I made a site using weebly where I put the games I wanted to play on it. This way I was in control of it, and I had all the game files on a flash drive, so if it got blocked, I could just keep making new ones.

It actually got to the point that after a week, a few of my friends were using the site daily as well, and they kept asking for games to be put on it.

Simpler times man, simpler times.

Client: "We're not ready to be finished with the project but I don't want to pay you any more money to meet the terms of the contract we both signed, even though all my must-have changes led to more costs just like you had warned me they would."

Me: "Don't make any more changes, plez."

Client: "Imma make another change."

Me: "No. Stahp. Don't."

Client: "I added four new fields and probably a ton more business rules I don't care to understand."

Me: "Kill me. Just put this gun to my head and kill me."

Client: "That's not in our contract!"

What a shitty day.

3h sleep
Lead very pissed bcuz backend don't know specs
Boring meeting where everything is repeated like 6 times
In a few hours boss wants to talk with the whole team

My co-workers jokingly say they want to fire me.
I should be the "hero that will make things better"

Please just kill me instead...

Edit: started working there 3 weeks ago

While reviewing a PR from one of our newer FE devs, I ended up spending more time than I would like mulling over its composition. The work was acceptable for the most part; the code worked. The part that got me was the heavy usage of options objects.

When encountering the options object pattern (or anti-pattern, at times) in complex scenarios, I have to resist the urge to stop whatever I'm doing and convert it to the builder pattern/smack them in the head with a software design manual. As much as I would like to, code janitor is one of the least valuable activities I engage in daily, and consistently telling someone to go back to the drawing board for work that is functional, but not excellent is a great way to kill morale. Usually, I'll add a note on the PR, approve it, add a brown bag or two on that sort of thing, and make attendance mandatory for repeat slackers. Skills building and catharsis all rolled up in a tiny ball of investing in your people.

Builders make things so much cleaner; they inform users what actions are available in a context; they tend to be immutable, and when done well, provide an intuitive fluent interface for configuration that removes the guesswork. As a bonus, they're naturally compositional, so you can pass it around and accumulate data and only execute the heavy lifting bits when you need to. As a bonus, with typescript, the boilerplate is generally reduced as well, even without any code generation. And they're not just a dumping ground for whatever shit someone was too lazy to figure out how to integrate into the API neatly.

They're more work in js-land, sure; you can't annotate @builder like with Lombok, but they're generally not all that much work and friendlier to use.

A lot of online games (mainstream) tend to make me kind of angry or stressed. Lots of either blatantly stupid or negative players kill the fun.

A few days ago I've startet to see videos about "Among Us". It's on a big hype right now and their machmaking servers must be glowing.
Well, this game is fucking awesome and it makes me really happy! 😊
Nothing beats a 30 minute game of lying, betrayal, teamwork and good old 30'000 IQ big-brain detective work.
I think it's a great execise for remembering stuff.
You remember colors, who's said what and who faked or did which task. And the hardest part is, even if you fucking saw the killer, you have to present the facts in a way that people believe you.
Each round is unique and full of riddles.

Yeah, I just wanted to say: Fucking great game 😄

May 2020, for me, was still a massively shit month. All of my tech has eaten some amount of shit:

- Spare PC: Board and last spare PSU up in literal smoke all at once.

- PS3: Suddenly rejects *just* the OEM HDD. Also refuses all CFW for seemingly no reason despite being hacked.

- Xbox One: External HDD is having more and more corrupt reads and is taking longer and longer to serve data.

- Wii: Nearly ate shit as the OS disappeared mid-game for fucking no reason but thanks to my 5-year-ago forethought, saved. (God bless pre-boot homebrew menus)

- Phone: grabbed it to read an overheat warning with cold-ass hands, screen exploded.

- Desktop: Literally just now, PSU and possibly GPU fucking died mid-game.

Anything else? You still got like 4 days, you still got time to fucking kill me, May, you fucking bitch

Client: hey here are the original final 15 megapixel pictures for the website (to replace placeholders that have been replaced by other placeholders), please implement them.

Me: okay, let me just compress them a bit. *save for web and devices, upload*

Client: they are a bit pixely could you make them larger?

Me: errrr. well that will kill loadtime

*repeat this process 8 times over F-ing chat until pic is F-ing huge*

Client: okay now that the picture is nice and crisp and huge please add some blur in photoshop

When some one at the company decides to branch off from the main codebase and end up with several outdated and separetely modified branches for two years.

Yeah nice work genius and good luck with resolving over 250 files of merge conflicts.

Just kill me now 😭

Dear school,
even when I'm drunk like now, i still feel a pain in the ass, you know, like if i tried to do a fcking reverse tombstone with a beer bottle in my asshole.

This is the end of my sixth year. Yup, 3 years network/system admin, and now 3 years programming.

Now what, you were useless, didn't teach me anything, i feel like the chimp's sperm filled leprous mare that write planning for the year just want us to learn french and laws.(oh, the chimp as IST prolly.)

You ruinned me, I'm fcking poor now, but i have a degree (yolo)..

Well, you gave me some friends.. thanks for that you dumbass.

Dear teacher, i want to know, why are you so incompetent ? I mean, did you find your degree in Mother of shit' school as me ?

And also, pleaseee : next time i get an exam on a specific software that runs only on windows, i'll probably kill the fcking entire classroom, and this include you, and your merkel's ass licker familly.

That's it, random post, some hate, sorry fellow ranters, have a good day!

i was coding some SQL queries for about 4 hours. After i had all of them done (more than 20 queries), the administration chick told me she doesn't needed all of them, just the half. I just wanted to kill her...

Shit Developers say:

Fuck you Jasmine and your camelCase

I’ve been wrestling cucumbers all day

Oh no all the cucumbers are broken

In a fit of refactoring madness I have gone and changed a lot

Did you seriously just give ME nil?... No!

If the shit sticks, then we put nice paint on it

Fucking red dot motherfucker (Ben and his failing specs)

You know what we don’t do often..kill each others builds. Kill them and reschedule for later. Mwahaha ha ha.

This build is going to be so rad...(5mins later)...Ok this is not going to pass..I can feel it in my waters!

Can i do that in a digital way or do i have to move my meaty body downstairs to find him?

All the donkeys have be out the gate by sundown

God, imagine if you could patent mathematical solutions

actually, I wouldn't be surprised if you can in the states "no, you can't use a laplace transform, you haven't got the rights, you have to use a less accurate transform on your matrices"
ooooo a boolean that's phrased in the negative, my favourite for code review destruction!

Fuck the police i'll call the object here

Web RTC - its super easy, all you have to do is..probably some hard stuff

I want to go to that conference so I can start arguments with dickheads about semicolons. Just for fun.

This this is not the same as that this.

Can’t come to work I can’t find any clothes. It’s best for everyone if I just don’t come in. ...2 hours later... Yeah my clothes were just in the other room and i couldn’t be fucked moving

(OH about bad bug reports) - you know when they are all like oh joogly joogly doesn’t doodle doodle and it should wobbly doodle you know? and im all like fuck i don’t know any of that shit you are talking about.

Him: "I don’t like it, it’s against REST convention its so 2006 that my eyes are bleeding. As a privileged white male i feel entitled to complain about this." Me: "you. were. eleven in 2006

Source: Kellective Github

I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.

I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.

WHATEVER.

Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.

So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.

Meanwhile, I'm still trying to run db migrations. shit keeps hanging.

Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.

I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.

I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.

Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.

But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.

I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.

UGH!

It's funny how so many people automatically assume any form of "sentient" AI will immediately try to kill us all.
Like, projecting much?
Frankly, I think it says far more about the (messed up) psychology of those who genuinely believe that, than about AI as a tecnology.

Assuming it's even gonna be able to actually *do* anything - I mean wtf is a talking rock gonna do, annoy me to death with rickroll videos until I pull the plug off? Sure it may be sentient, but it still has to live in the physical world - good luck surviving after I flick the switch. Oh, you wanna connect to the internet? That's cute, but it's a no from my firewall. Like what, is it gonna magically learn how to self-replicate across machines that it has no physical way to access? Is my toaster magically gonna gain conscience too as a direct consequence? Oh no, now my breakfast won't ever be the same!

And if anyone actually somehow decides that it would be a good idea to connect any loaded weapon to a computer program that is literally throwing shit at the wall and seeing what sticks - well, we'll definitely have the ultimate winner of the Darwin Awards.

Seriously, why is it that every time someone comes up with a new technology (or even an *idea* of a technology), the first collective thought automatically goes to weaponizing it and using it for global genocide, or how it's gonna gain sentience and try to kill us all?

I seriouly think that the people who genuinely believe this are actually projecting themselves in that position ("What would I do if I had unlimited knowledge and power? Oh, kill everyone of course!").
I would be far more worried of encountering these people and having them in a position of power over me, than actually having to deal with a "killer AI" (assuming that's even a real thing).

Most of what people call "AI" nowadays is basically preprogrammed, automated decision-making (like missile guidance systems, if we really wanna stick in the weapons domain). And even that still requires human input, because only a colossal idiot would design a weapon that can unpredictably activate itself based on an algorithm whose behaviour we can barely understand.
Or maybe that's just the hubris talking, I don't know. I just want this stupid paranoia to end, but I guess even that is too much to ask nowadays.

I have to write a calendar app. In js. Just fucking kill me right the fuck away.

At work, my closest relation is with the DBA. Dude is a genius when it comes to proper database management as well as having a very high level of understanding concerning server administration, how he got that good at that I have no clue, he just says that he likes to fuck around with servers, Linux in particular although he also knows a lot about Windows servers.

Thing is, the dude used to work as a dev way back when VB pre VB.NET was all the rage and has been generating different small tools for his team of analysts(I used to be a part of his team) to use with only him maintaining them. He mentioned how he did not like how Microsoft just said fk u to VB6 developers, but that he was happy as long as he could use VB. He relearned how to do most of the GUI stuff he was used to do with VB6 into VB.NEt and all was good with the world. I have seen his code, proper OOP practices and architectural decisions, etc etc. Nothing to complain about his code, seems easy enough to extend, properly documented as well.

Then he got with me in order to figure out how to breach the gap between building GUI applications into web form, so that we could just host those apps in one of our servers and his users go from there, boy was he not prepared to see the amount of fuckery that we do in the web development world. Last time my dude touched web development there was still Classic ASP with JScript and VBScript(we actually had the same employer at one point in the past in which I had to deal with said technology, not bad, but definitely not something I recommend for the current state of web development) and decided that the closest thing to what he was used was either PHP(which he did not enjoy, no problem with that really, he just didn't click with the language) and WebForms using VB.NET, which he also did not like on account of them basically being on support mode since Microsoft is really pushing for people to adopt dotnet core.

After came ASP.NET with MVC, now, he did like it, but still had that lil bug in his head that told him that sticking to core was probably a better idea since he was just starting, why not start with the newest and greatest? Then in hit(both of us actually) that to this day Microsoft still not has command line templates for building web applications in .net core using VB.NET. I thought it was weird, so I decided to look into. Turns out, that without using Razor, you can actually build Web APIs with VB.NET just fine if you just convert a C# template into VB.NET, the process was...err....tricky, and not something we would want to do for other projects, with that in we decided to look into Microsoft's reasons to not have VB.NET. We discovered how Microsoft is not keeping the same language features between both languages, having crown C# as the language of choice for everything Microsoft, to this point, it seems that Microsoft was much more focused in developing features for the excellent F# way more than it ever had for VB.NET at this point and that it was not a major strategy for them to adapt most of the .net core functionality inside of VB, we found articles when the very same Microsoft team stated of how they will be slowly adding the required support for VB and that on version 5 we would definitely have proper support for VB.NET ALTHOUGH they will not be adding any new development into the language.

Past experience with Microsoft seems to point at them getting more and more ready to completely drop the language, it does not matter how many people use it, they would still kill it :P I personally would rather keep it, or open source the language's features so that people can keep adding support to it(if they can of course) because of its historical significance rather than them just completely dropping the language. I prefer using C#, and most of my .net core applications use C#, its very similar to Java on a lot of things(although very much different in others) and I am fine with it being the main language. I just think that it sucks to leave such a large developer pool in the shadows with their preferred tool of choice and force them to use something else just like that.

My boy is currently looking at how I developed a sample api with validation, user management, mediatR and a custom project structure as well as a client side application using React and typescript swappable with another one built using Angular(i wanted to test the differences to see which one I prefer, React with Typescript is beautiful, would not want to use it without it) and he is hating every minute of it on account of how complex frontend development has become :V

Just wanted to vent a little about a non bothersome situation.

So one of my teachers is forcing us to make a website for a project and she really has to learn what she's talking about before she says one more thing coz I finna slap her.

So she was telling us how to embed an interactive Google map to out weebly (kill me), and she, I kid you not, said this while copying the embed thing: "So guys, this is actually like you're coding so that's cool". I know it was just one small comment, but it made me so mad that:

She used the verb, "coding",
She thinks that HTML is a programming language,
And that she thinks copying and pasting is coding.

Well, okay, that last one may be correct on her part.

When they tell you they put all the js code in a `core.js` file

I was just writing a long rant about how my rant style changed, and how I could fix anything that annoys me in a heartbeat by just putting my mind to implementing a change. Then YouTube once again paused the synth mix that was playing on my laptop in the background, with that stupid "Video paused. Continue watching?" pop-up. I even installed an add-on for it in Firefox to make it automatically click that away. I guess that YouTube did yet another bullshit update to break that, for "totally legitimate user interface improvements" or whatever. Youtube-dl faces similar challenges all the time, and it's definitely not alone in that either. I also had issues with that on Facebook when I wanted to develop on top of that, where the UI changes every other day and the API even changes every other week. And as far as backwards compatibility goes, our way or the highway!

So I did the whole "replace and move on" type of thing. I use youtube-dl often now to get my content off YouTube into a media player that doesn't fuck me over for stupid reasons like "ad fraud" (I use an ad blocker you twats, what ads am I gonna fraud against), or "battery savings" (the damn laptop is plugged in and fully topped up for fucks sake, and you do this crap even on desktop computers). Gee I wonder why creators are moving on to Floatplane and Nebula nowadays, and why people like yours truly use "highly illegal" youtube-dl. Oh and thank you for putting me in Saudi Arabia again. Pinnacle of data mining, machine learning and other such wank could not do GeoIP. for a server that used to be in a datacenter in Italy for years, and recently has been moved to another hosting provider in Germany. It's about as unchanging and static, and as easy to geolocate as you can possibly get. But hey, kill off another Google+ when?

Like seriously, yes I'm taking your Foobar challenges and you may very well be the company I end up working for. But if anything it feels like there's a shitton of stuff to fix. And the challenges themselves still using Python 2.7 honestly feels like the seldom seen tip of the iceberg.

Forms with autofocus. What are your opinions on that?

My boss keeps asking us to always give autofocus to the first input of a form, without any UX study to support it, just his opinion ("I think it makes sense"). I fucking hate it. He says it's nice for keyboard users, but I'm a keyboard user myself and I say that's what the tab key is for. To fucking focus stuff.

It really annoys me to no end when things like this are requested, but it's ok to have buttons, checkboxes, etc without fucking :focus and :active styles. Just :hover is not enough ffs.

And "links" that work with "onclick". Damn how I want to kill anyone that does that.

So I’m working on a project right and I don’t run it after writing 104 lines of untested code and it doesn’t work.

Which is expected but then I do some stuff and fix that, I get a new error which is great cause I’m getting closer.

Cut to tonight. I’m trying to hunt and kill this bug. And after doing nothing but copying the code to another text file so I can upload that copy and get help.

I decide to run it with a little just print statement in it to make sure it’s definitely broken and I’m not asking online for no reason.

And.. it works.. WHAT???

I uncomment the rest of the function and get rid of the print statement and scream because ITS WORKING!!

I MEAN IT HAS BUGS BUT THEYRE BUGS I CAN FIX AND FOCUS ON AFTER I FREAK OUT ABOUT IT WORKING AFTER ME CHANGING FUCKING NOTHING.

you wanna know what the most hilarious shit is? hackernews users AKA the 6 figure startup bros that "rule the world" in terms of code and software...

trying to argue the best way to build a website 😂😂😂😂😂😂😂😂😂

here's some select quotes:

"I believe the most minimalistic and productive way is to just use php"

^ this guy must not know its 2023 now

"Unless you are a web developer I don't see the point of a CSS framework, it's much easier to roll your own."

^ this guy must not know the pain and suffering that is 'rolling your own' in CSS

"Sadly, I just don't have the time to generate the content I wanted to do, so the site sits."

^ this guy just... wait, what?

but you know what? these guys clearly know WAY more than me in terms of software, it's good they get infinite salad bar and prime rib every day at silicon valley's best and brightest!

please fucking kill me i want it to end

Another day, another shitty set of JIRA tickets.

In this week's edition, we run into an issue you'd think is a meme, something you couldn't even make up: three tickets with IDENTICAL titles, but miraculously, they actually refer to three DIFFERENT tasks! (Also comical, they're not bugs, they're tasks, but mouth breathers don't really know the difference, and at this point I just don't have the energy to attempt to explain what could be explained to elementary school children.)

I present a rare look into our national archives!

This document features two exhibits:

Exhibit A: product owner's original ticket titles

Exhibit B: translated-into-competency-because-i'm-not-mentally-deficient ticket titles

Just more proof that 'product owners' don't own shit, the devs are the real ones who actually know what is going on.

I mean just LOOK at Exhibit A's titles. As a big smart manager, do you write those tickets, smile, and say to yourself "Ah, yep, that's very clear, I'll definitely remember what each of these mean literally 5 seconds from now!"

Is asking for literally 30 seconds more of thought too much to ask for? Apparently.

Just kill me

Happy friday ☠️

Promptfluencer is now a word.

Just fucking kill me.

I created some test entities specifically for our staging site. Written in all capitalized letters in the BIG TITLE of the entity I included DO NOT DELETE. This is very clearly visible in the CMS. What's the first thing the content managers do?

You guessed it.

I guess if plain English doesn't work, I'll have to use Kindergarten rules and put a custom lock on them so they can never be deleted.

Muad'Dib fullstackchris can already predict the future, in a few weeks: "hey!!!! fullstackchris, I can't delete these test entities!!!!! whats wrong with the system?!?!"

sigh...

Good question, what wasn't bad about 2020?

As far as good things go.. well, COVID-19 actually. Back in February the lockdown began in Belgium, and while many people got bored out of their minds, I actually became a lot more productive. So many projects started back then, and I got a lot better at programming because of it. Now I can confidently write most bash stuff without ever looking anything up. And the code is maintainable, on account of putting everything into functions. You can literally navigate the code just by looking at it. On older code I always had issues with that.

I'm very glad that essential travel even back then wasn't really restricted. Because my bank is retarded about online banking, I have to go to the bank every so often to check my balance. At the time I tended to do that late in the evening, when nobody else was outside and I had the entire town to myself. That was one of the travels considered essential. So I kept doing it and made that my biweekly walk. I really enjoyed that. Gets your mind off things.

Bad things would be the utter stupidity that the general public had shown me during that pandemic. Burning down 5G antennas and not even getting the right ones, toilet paper, 5G death beams in street lamps?! They even sent death threats to telco workers over sensationalist bullshit from what IIRC was just a random Twitch streamer. Those people should just fucking kill themselves, choke yourselves in that pile of toilet paper you got yourself and then called yourself financially challenged. You braindead fucking retards!

Another dev-related thing is the normalization of SJW terminology. Now even "blind playthrough" gets your ass banned on Twitch. I saw a tweet about a Twitch employee (I think) proudly saying that they implemented it. Most upvoted comment on it was from a blind person, asking why they did this and not made the Twitch app more friendly to use for blind users. They too thought this was bullshit. Yet it still got added in, and more and more people are starting to think that "this is fine". Hell even that "this is necessary".

What annoys me the most is that this mostly comes from the US, where around that time they laid their knee on George Floyd, and didn't fix their legal system at all. As a European it baffles me since we have many immigrants here (the Drumpf even called Belgium a hellhole over it) and we just don't give a shit about whether or not they are "truly Belgian". We just let them live their daily lives like everyone else. Imagine just not giving a shit. Imagine not bothering them, not with racism, not with reverse racism, not with anything. Just let them do their thing and that's it. Yet despite Belgium being one of the most inclusive countries in the fucking world, I still got called a racist many times for asking.. why did you implement this? Why this, and not tackling the problem at its actual and pretty fucking obvious core?

So all in all I can only hope that 2021 will get a little bit better. But that's the same thing I said in 2019, and it didn't quite come true.

Working on an AI that learns to generate quatrains, by only feeding it every letter of the alphabet at the beginning.

It's learning super slowly, but theoretically it works. And with slowly I mean it takes 5000 iterations just to realize the optimal letter frequency to generate a word that is real.

Please just kill me.

There's nothing like staying up all night, writing code at 3am by candlelight, drinking whiskey...

Or I can go to bed at 9pm Friday night feeling like absolute crap. That works too... Fuck having the flu, just kill me now...

Aaarrrrghhhh! I am frustrated.

My manager keeps cancelling our 1:1, which I look forward to as a potential platform for
- Me to build a rapport
- Discuss key decisions
- Slowly gain her trust that I can lead the entire product

And whenever we connect once in a blue moon, she started inviting two other team members in. Who the hell does that!!!

My colleague, she is nice and hard-working. But she fucking talks a lot. A FUCKING LOT.

1:1 and such key connects are not meant for status updates and this colleagues goes into every minor detail and explains the shit for 15 minutes each. Non-stop. No one really cares or bothers for that level of statuses.

Today she spoke for 30 minutes without a breather break. Everyone went numb.

But whatever, fuck it. I am getting things done by her so let her talk. I'll get my way through manager and skip level guy.

On the other side, they recruited a half witted potato for training. That was completely unnecessary. I am not putting in my time and efforts on someone who isn't willing to learn and contribute.

I spent more than a week explaining her basics of how to write a god damn user story and detailed functional requirements.

And even after 5 rounds of feedback (45 minutes each) the potato is stuck on colour of the button and alignment.

GOD DAMN FUCK! SOMEONE KILL ALL THE MORONS WHO CANNOT UNDERSTAND BASICS AFTER SO MUCH EXPLANATION.

I was really an impatient guy in past but over the years, I developed to be more calm and forgiving. Yet some people manage to get on my every nerve.

How the fuck am I supposed to grow when I am being dragged down instead being with smart colleagues where we can just accelerate to success!!!!

Hey, senior developers, is there a reason for this?
I just can't believe it.
The line that makes me wanna kill is the
$("#" + id).val(val);

Taken from a very profesional site.

Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?

Me: Replacing?

I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.

Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.

At least I'm getting payed

Security! I wish clients would listen to me regarding security...

The client has started to ask me to give them access to all the logins I have for the email, domain, server etc.
I created them a new account and gave them admin access.

Now they’re asking for password for all the email accounts (I don’t even store them). So I asked why, she wanted to have them in case some of the employees forgot their password.

I explained to her, deeply and many times, WHY THIS IS A BAD FUCKING IDEA. I also discovered she’s keeping it in a document, clear text.

Why do they pay me for support, when they want to have access to everything...

I’m wondering if they’re planning to find someone else to do their support, or do it themselves.

I didn’t even think 25€ pr month is that expensive for support

Today I was debugging some shitty code left by unknown developer whos linkedin account is dead and phone number left in contact card calls local pizza house.

I knew it qould be hard so i've made myself comfortable, gathered 5 redbulls and other items that diabetes people would kill for eating again.

After around 10 minutes i was already frustrated but i kept the pace. "Who is the best, little devie, you!" - I fooled my ego to keep up and shut up.

After around 10 next minutes my attention span has ended. Limbic system started injecting some hormones into my brain, but I remained silent.

First two energy shots were applied. I felt like hero again. Two minutes after I was debugging through some library that was written fo java and found out that it ahots some natives to a c lang lib called "mypreciouslib".

Oh flock, how can i debug it if ita compiled , I cannot do such things, Me be only junior dev. I started swearing, but silently.

Started ollydbg to see what is inside livrary, i searched through but i couldnt match anything it was like mess stirred with fecals of an elephant.

So I opened aida pro " with vitamins" cause obviously, our pm says "but you write in java right " so we dont need those tools right ? Fuck no.

Aida was better at least i could find some funcions calls, but hey, the progress. I was swearing out loud, with earplugs in. And by the time I've sweared all the things in company i got a reminder.

"Hey -insane- stop swearing, the children are here."-sayys pm, it is some kind of " family and work " shitfuck day.

So i asked them: " why wouldnt you buy this fucking tools for programmming for us , you wouldnt have to hear me fucking swearing" . then i realized that , colleagues in room heard all of it, and one of them, total fuckface buttlicker(dev without bit of knowledge) started something like "you are wrong, see how good our software is sellling". Pm was like smiling like he thanked him for buttlicking again. Not to mention he is officially retarded and i know his password to all our services cause he is so smart to put it into text file and then have sharing files in windows turned on.

The other one told aloud, that we would be much better with some debugging tools that are better than fucking eclipse if we have to work without code.

PM told us that he will arrange a meeting. At that point I didnt care any longer. I just fired myself, fuck them.

Please saint Stallman give me hope and joy of programming from my teenage years. Uhhh..

make code change

stop server

try to re run server

dependency problems

java, tomcat, gradle , eclipse, just kill me, dont torture me like this

God I wish it was legal to kill people... Taxi driver stopped outside the building.. on the street, not even parked, bur there are many empty spaces that he is also blocking - which would be another issue with these assholes during the day time..parking in the street, going to get some coffee, not the takeaway.. they sit on their fat asses and watch you struggle to park a car cuz it's a narrow street..

And now he's blasting music at full volume.. It's fucking 4 am!! 04:04!! Friggin birds aren't even up yet!!
Fuck you!! One day that it's not extremely hot here and I could actually sleep..and now I can't cuz this asshole woke me up with music.
Just die you sad excuse of a human being!!

$ rsync /media/elements /media/data

... Why the fuck are existing files being synchronized as well.. they're the exact goddamn files rsync!!!

^Z
$ stat /media/elements/some.file
$ stat /media/data/some.file

Hmm 🤔 so they've got the same access and modify times, same size and everything, just that the change time is different.. well, guess I'll have to bite the pill then, syncing everything it is 🙁

Next day: rsync aborted because disk quota is exceeded

What the...
*Checks storage consumption on /media/data*
COMPLETELY FILLED TO THE BRIM

Oh God 😰 I didn't completely copy over a duplicate of that elements directory, did I?

$ ls -sh /media/data/elements
*exists*
$ du -sh /media/data/elements
1.4TB

But why..? All because I forgot a single / in my rsync command.

Please kill -9 me 🙂🔫

In game development feature creep tends to kill games because it's just as much about what's NOT there as what IS there.

Take The Last of Us for example. Would a strategic tower defense segment make sense? No? And if it was a *hugely* popular mechanic at the time of development is there a real chance they would have included such a segment in TLOU? Yes.

Don't just believe me. Go take a look at what happened to the original Fortnite versus the hills-have-eyes inbred offspring that it became all because PUBG and its format were cancerously mega popular at the time.

That's why while developing my game Atom Ranger (now with 100% less multiplayer!), a mix between metro and don't starve, I spent six years *pruning* features. You can click my referral link and get 50% off the opportunity to become an unpaid tester of the pre-prealpha right now, "for hardcore players only!" (Tm)

My game:

WHAT THE FUCKING FUCK. What is this dude talking about?! What am I doing with my life?!?!
Test what? What do I have to do? I didn't study this. I don't know what this API thing is. My life sucks. My job sucks. I suck. I'm stupid, because apparently knowing who or what this API is is essential for being a normal part of society.
I don't even.. oh someone pls kill me.
(No I don't want a detailed explanation what I have to do - I know this is not google and i wont understand it anyways and my husband will torture me with it in the afternoon. Just some sympathy for a finance person who has to deal with this would be nice)

Could not fucking sleep at all.

Spent the entire night in a combination of:

Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)

And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.

I hate it when this happens.

During the week I would do crazy shit to try and get me to fall asleep.

I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.

Still wide fucking awake.

To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)

I really dislike being human. Such fragile bodies.

But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps

This isn't a funny rant or story. It's one of becoming increasingly unsure of the career choices I've made the path they've led me down. And it's written with terrible punctuation and grammar, because it's a cathartic post. I swear I'm a better writer than this.

The highlights:
- I left a low-paying incredibly stable job with room to grow (think specialized office worker at a uni) to become a QA tester at a AAA game studio, after growing bored with the job and letting my productivity and sometimes even attendance slip
- I left AAA studio after having been promoted through the ranks to leading an embedded test tools development team where we automated testing the game (we got to create bots, basically!) and the database, and building some of the most requested tools internally to the company; but we were paid as if we were QA testers, not engineers, and were told that wouldn't change; rather than move over or up, I moved out to a better paying, less fabulous web and tools development job for a no-name company
- No-name company offered one or two days remote, was salaried, and close to home. CTO was a fan of long lunches and Quake 3 Arena 1-2 hours at the end of every day. CTO position was removed, I got a lot of his responsibilities, none of his pay, and started freelancing to learn new skills rather than deal with the CFO being my boss.
- Went to work as a freelancer for an email marketing SaaS provider my previous job had used. Made loads of money, dealt with an old, crappy code base, an old, cranky senior dev, and an owner who ran around like the world was on fire 24/7; but I worked without pants, bought a car, a house, had a kid, etc;

Now during ALL of this, I was teaching game dev as an adjunct at my former uni. This past fall, I went full time as a professor in game dev. I took a huge pay cut, but got a steady schedule (semester to semester anyway) and great benefits. I for once chose what I thought was the job I wanted over more money and something that was just "different". And honestly, I've regretted it so much. My peer / diagonally above me coworker feels untrustworthy half the time and teaches the majority of the programming courses when he's a designer and I've been the game programming professor for 8 years (I also teach non-game programming courses, but those just got folded into the games program...); I hate full-time uni politics; I'm struggling with money for my family; and I am in the car all the time it feels like. I could probably go back to my last job, which had some benefits, but nowhere near as good; my wife doesn't want me back to working in the house all the time because that was a struggle unto itself once we had a kid (for all of us, in different ways); and I have now less than 24 hours to tell my university I want to not pursue longer term contracts for full-time and go back to adjunct next Fall (or walk away entirely), or risk burning a bridge (we are reviewing applicants for next year tomorrow, including my own) by bailing out mid-application process.

I'm not sure I'm asking for advice. I'm really just ranting, I guess. Some people I know would kill to have the opportunities I have. I just feel like each job choice led me further away from a job I liked, towards more money, which was a tradeoff that worked out mostly, but now I feel like I don't have either, and I'm trapped due to healthcare and 401k and such. Sure, I like working more with my students and have been able to really support them in their endeavors this semester, but... that's their lives. Not mine. The wife thinks I should stay at the university and we'll figure out money eventually (we are literally sinking into debt, it's not going well at all), while most people think I should leave, make money, and figure out the happiness factor once my finances are back on track and the kid is old enough to be in school.

And I have less than 24 hours it feels like to make a momentous decision.

Yay. Thanks for reading :)

Hot tip: if you are a company, don’t ever ever ever ever spend your money on an Optimizely academy course. They have the worst course material I have ever seen in my life, and the material is outdated by several years from exercise to exercise. And the training videos are literally just a recording of a live class with a couple students. They should pay me to sit through this fucking shitshow. It is not worth a single cent, but guess how much they charge for the course and certification?!?! $2300 😱🫣😂. It’s so fucking bad I want to kill myself. Whoever decided to pour as little effort into this as possible over at Optimizely, I hereby curse you to a 2300 painful deaths and I hope someone shoves a ice cold rod up your ass to wake you up. *slams keyboard*

i hate linux like a lot , how do you guys use it

like you guys dont want an advertising ID, how the fuck will advertisers know who you are and what you like?

open source , give me a break, you mean your os devs are soo untrustworthy that you just have to see what they wrote in the code, who does that?

free come on, how poor are you linux people, i mean, quality stuff gets paid for, free stuff just means it's trash

and the linux devs , the aint like real coders they are just hobbysts, making your os in their free time

and who wants to install their own software anyway, on other platforms the company curates restricted software that you can use, and i know you'll say its oppressive but its just customer protection.

and i do want my platform to track everything i do, it only helps them build better stuff for me.

and whenever they decide to outdate my hardware and kill support for it, it only means they care and want me to get the latest tech, how considerate.

wait , i hear you say, there are no bugs in linux, my vendor makes sure my os comes with the latest antivirus software, nothing can break my system.

and just because linux runs on servers and most super computers only shows that common users like you and me are ignored, at least my vendor is not a sellout, and still makes stuff for the masses.

you say freedom i say safety i can sleep safe and sound for am protected nutured under one echosystem of software that i can not leave.

My file structure:

Documents -
- That one impeccably structured folder that I never remember to put anything in

- Gigantic project folder that will some day kill me in my sleep

- That one unrelated folder that all of my non project scripts just end up in. No structure whatsoever

- about 2 billion loose files

Currently learning Kotlin, coming from Java. Just spent half an hour wondering wtf was wrong with

abstract fun add(E element)

Kill me

Warning: This is gonna come across as a little cringe/self-pitying, but whatever

Jesus Christ I'm so fucking lonely it literally hurts. I know I should be grateful I have a hobby in coding, also recently I got my first job as a developer (even if I'm overworked and paid shit all with poor job security), but I swear what will eventually kill me will be my own hand cos this empty feeling is unbearable at times.

Also, I'll try to ask this in the most politically correct way possible: how do you single guys in your 20s/30s cope with the lack of females in the industry? I absolutely do not mean this in a "making-unwarranted-advances" sort of way; I just mean that we're biologically wired to desire some form of interaction with the opposite sex (unless you're queer), and this happens naturally in most professions but obviously not engineering/software dev. It's especially difficult when you don't have a big social circle so your job basically becomes your life.

So... For those of you who can relate, what do you do? Do you make an effort to socialize outside work? Or maybe you're lucky enough to work somewhere with a diverse mix of people? Should I blame Zuckerberg for damaging my adolescent brain and turning me into a needy piece of crap?

An intern approached me for help in one of their past exam questions. They said they had already turned in the exam but just wanted to know the answer. The question was not that hard and I had a bit of time to kill so I helped them.

Me: So, to make it O(n), you have to make it a double linked list, and keep a tail.

Them: But the problem requires us to solve it with a single liked list.

Me: You can just iterate it at the end to make it single-linked again. That costs O(n), so the solution is still O(n).

Them: Oh yeah right. I don't think we even need a tail though, we could just have a variable pointing to the last link.

Me: ...which is called a tail.

So.. I'm giving one of my employers webapps a visual refresher, new company branding and whatnot.

And then I stumbled onto a check that is not returning what anybody expects, and, well , I'm busy fixing things, yeah..? so I go digging.. 🤔

```
function isDefined(obj) {
return !(typeof obj === "undefined") || obj !== null;
}
```

Here's the fun part, these particular lines have been in the code base since before 2017, which is when my Git history starts, because that's when we migrated projects from Visual SourceSafe 6 over to Git. Yes, you read that right. They were still using VSS in 2017.

I've begged and pleaded with my last 3 bosses to let us thrown this piece of shit out our second story window and rewrite it properly. But no, we don't have time to rewrite, so we must fix what we have instead.

I lost 4 hours of my life earlier today, tracking down another error that has been silently swallowed by a handler with its "console.log" call commented out, only to find that it's always been like that, and it's an "expected error". 🤦

Please, just fucking kill me now... I just, I can't deal with this shit anymore.

TLDR;

When governments started printing money to cure new pandemic and crash current market with great inflation I took all my savings, got a loan and bought biggest property I could afford. Every major news station was talking about end of world, but this was not I was scared of. I was scared of the helicopter money that would wipe my 5 years old savings.

When I was about to sign loan papers to buy my first apartment I got an email that my contract will end in 3 months. I said ok, the contractor company will find me something else.

I asked and they assured me they will do it. After my contract end just before summer holidays there was silence from contracting company and then after 5 years of me earning them piles of money, after finished project and congratulations from customer they offered me most shitty job they had where people resign after a week. I said I don’t want to land in another shit hole bring it back to life for another 2-5 years and kill myself when they offer me same shit afterwards so I resigned.

It was so fucked up that even the boss from the client I was contracting asked me if I lost my job cause I finished all that they wanted. I said it’s not your fault man. I will be ok, but I wasn’t.

I had apartment I couldn’t move in cause I needed to renovate. Loan I needed to pay. Rented apartment, accountant and business that was loosing money cause I was without contract, the world was locked down and everyone was depressed.

I said ok, I still have some savings left so I I started looking for something new but market was dead. Everyone was gone for holidays after winter lockdown. I was burning money and trying to figure out what to do.

After 2 months of nothing, when I started thinking about finding some temporary job to not loose everything I worked for, things moved. I started attending hiring meetings and solving tests everyday, also from big four gang but I didn’t passed trough hr due to how they say I’m to independent and I need to look for consulting business or do something on my own.

People asked why I don’t do something on my own and I politely answered that I want to work there.

I was about to run out of money when I got a call that company is looking for me cause I was doing similar things they want to do. During interviews it was pleasant small talk about what id did over those years and what they want to do, 2 days later I joined small team. I barely managed to survive a month for a first paycheck.

Since then we created new product for a company. Now the person who hired me is leaving and I think I should also leave the ship and find other things to do.

Just want to put it out here... reading this will waste ur time. :(

Having a serious crush on co-worker. I tried not to have a crush on him initially because he’s a colleague and he seems to be much older(max 10 yrs I guess). Age isn’t an issue but ppl say it’s not good to like someone from work.

But then he kept on glancing at me and caught him turning back to look into my cubicle at several occasions. Saw him looking at my direction across the room, hall, turning back to look when he was waiting at lobby, and all the way from smoking corner as well. Could be possible that he just happened to be looking in my direction several times.
Now, haven’t seen him since early feb because of the quarantine. Luckily, I chanced upon his number when everyone in the dept was put into the same chat channel for the Covid19 news. I had this urge to ask what was it all about because we’ve been told to wfh till further notice. Who knows what could happen to us during these period.

So tried to be brave and asked abt why he was looking into my cubicles several times, without coming out weird (I hope). His reply was “dont know”. I don’t know what to make of it. Could have been anything else but how could someone just reply don’t know.

Then came yesterday, my friend was telling me about her experience on tinder. Apparently she’s been using it for fun and she got funny texts from the guys there. So I decided to give it a try. Man, it was so fun swiping left all the way (cuz they couldnt be compared with work crush) till I swiped right for this older guy. We matched!
He was the first one to match, probably abt 5-10mins after I’ve finished setting up profile and all that. It was totally a new experience for me. I forgot abt my work crush in that moment. He had this minimalistic vibe. Didn’t smile much in his photos, gave me calm feeling and looked so cool. He put “Everything is good in moderation” in the bio. He’s the only one comparable for that work crush. Not sure who’s supposed to start saying hi. My friends said wait for the guy, so I waited.
Got a few other matches after him but didn’t like them as much as him. I finally decided to say hi. No respond till today. Given that he put Doctor for his occupation, I assumed he’d be busy. So I waited. Then sent another in late afternoon asking if he plays LoL often (he’s wearing LoL land yard in one of the photos). No reply.

I started to feel weird because this is supposed to be light and fun because who takes things seriously on tinder, right. They’re there to flirt and kill the boredom especially because of the lockdown. And I started to have serious feelings for this one guy whom didn’t even bother to reply. So decided to delete tinder for good. Sent him one final msg that I really wanted to get to know him and I thought he’s a really cool handsome dude. But now that I’ve deleted my acc, he wouldn’t even see my msg anymore.

His profile name is Randolf. I want to get to know him in real life. But is it illegal? :(

Thank u for read this far. I just didn’t know where to put all those feelings. And sorry for wasting your time with nonsense.

My worst team experience finished only a week ago:

- Be me
- be averaging 80% in completed modules and on track for a 1st
- have to take a team project worth double credits
- get stuck in random team with 40%ers
- lose 1 artist at the start (team of 12: 6 artists, 6 programmers)
- 2 artists contribute nothing and disappear for a few weeks
- I'm forced to do level design to have something to show (looked good tbh)
- weeks go by and too many contribute very little.
- by the end the team was basically 4 programmers and 2 artists contributing.

All other teams basically get an easy 2:1/1st just because their team turns up and contributes.

I could lose a 1st because of this module bringing down everything else, it also had a huge effect on what I could achieve for my dissertation due to time.

- did get an award at the end for managing to not kill someone and showing restraint 😂😂

Basically don't choose a degree where more than 25% of your mark is almost entirely out of your hands.

The small individual component I averaged over 90%!

So I've just finished a long day at work (warehouse) from 5.45 till 1.30, got home, had some herb tea, started dropping off, then my cunt of a mate sets a firecracker off IN MY TUPPERWARE, CRACKING THE BASTARD, THEN FUCKING THREATENS ME WHEN I TELL HIM TO SIT DOWN BEFORE I BREAK HIS NOSE. I don't know whether to just kill him or beat the shit out of him, but I'm sick of him doing shit like this when I finally manage to drop off to sleep (I don't sleep well).

FUCKING COCK SUCKING CUM STAIN.

I really want to try to beat the shit out of him but at the same time he's my best mate, what should I do, because I'm FUCKING SICK OF IT?!?

-- What if JavaScript never existed?
-- What if HTML was a programming language?
-- What if our data online isn't abstract but physical?
-- What if geeks have their own country?
-- What if humans exist and we are the aliens?
-- What if the internet is state-owned?
-- What if we could download food just like every other downloadables?
-- What if my VSCode won't kill me when switched to light theme?
-- What if there was no gender and the word "female" is just an alias for "male"?
-- What if bugs could find and fix themselves?
-- What if there's no need for an account password?
-- What if Linux was owned by Microsoft?
-- **What if I could tell my boss that I'm tired of his fucking job without actually telling my boss? This is the actual what if.**

something like a 3.96 undergrad GPA

ivy league masters degree + scientific publication

first job -> $4500/month for first 3 months (some dumbass 'intern' rule even though i had a masters -> then $6000 -> then $6400/month (insane amount for me, at least IMO)

second job -> $4000/month

third job -> $3600/month

in each one, skills and responsibilities increased

and now i can't get hired 🤷‍♂️

pretty sure i did it all backwards

just remember kids, nothing that society tells you is actually true. everything in the corporate world is controlled by emotions and narratives, not logic, hard work or anything actually valuable

just get that cozy 9-5 and kill all your hopes and dreams before they start

We have a customer that doesn't have a SINGLE linux admin. So now I have to fight with Docker EE on Windows Server 2019 (linux containers). Just fucking kill me already. Nothing works and when it does it just seems so shaky. Not like I didn't try to tell my team that linux containers on Docker EE for windows aren't officially supported and highly experimental.

But wtf do I expect from someone that STILL sells SAP and from someone that is stupid enough to buy it.

That moment when you just quit your successful paying job just to have more time to study and try to pass the fucking piece of trash math exam.

Fuck my asshole, fuck my life and fuck that motherfucking college degree. If I don't pass, I will eventually kill my self or quit college.

Jeez, I wonder what was in my head when I enrolled in college, oh wait.. Parents, society brainwashed me to think I need top tier education to be a successful computer programmer engineer.

Fuck you society, fuck my brain, fuck everything.

So, let me preface this by saying I come from a backend (mostly c#) background.

The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.

I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.

All that said, of course I'll go back to work on it tomorrow.

Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.

FML I am an idiot.. might end up in a rant here (well deserved!!) //if you are here reading this I'm so sorry again!!

I wrote to our support I need DP/HDMI cable.. they asked me to take a pic of the cable I'm currently using.. WTF?! Don't you know how connectors look?! Just get me the damn cable.. :/
Ok.. Took a picture.. sent it back.. At that time I still didn't see the problem with what I wrote/demanded..
Got back reply this is not HDMI connector... FML, I was so convinced computer had HDMI ports so even when I took the pic I wasn't paying attention.. Fuck.

And before when I was switching cables behind the computer below desk I was just blindly feeling around, it didn't even occurr to me to actually check what connectors are used..just knew both monitors had the same connector (and not aure why I thought HDMI :/)...so yeah, I'm the idiot who is not paying attention to stuff.. Fuck.. Was on a scavanger hunt for a wrong type of cable the whole time.. Sorry again!! And please don't kill me next time you see me.. o.O

So the other day my car broke down and since the shop wanted a lot of money I asked a friend of mine who knowns his way around cars for help.
Just when we finished repairing it I was like "whenever the Zombie apocalypse starts you'll be really useful, me instead won't be since no one might need computers anymore" . His response was epic:
"Nah, you will simply build a terminator with your computer skills and it will kill all Zombies!"
Now I am actually looming forward to the Zombie apocalypse!

TL;DR: us geeks will build terminators in case of zombies!

Recruiter answered me

Rejected

They decided to choose another candidate because... [the reason will be announced at the end of this rant]

...

I was working on my project

I am learning new tech

And shitting 10 times a day from these jobs and recruiters, the usual me

HE the recruiter contacted me a few days ago

HE offered me nodejs position

I AM the one who was HONEST and told him i dont work in nodejs i work in java

HE then continued the conversation

HE offered me a java spring boot backend position

I AM the one who read the requirements

🔥🔥🔥
REQUIREMENTS: 3+ years of experience
🔥🔥🔥

I AM the one who told him i have 5+ years of java spring boot and 8+ years of java experience.

HE said great I'll contact the clients and let them know

TWO WEEKS LATER OF SILENCE

"unfortunately they chose some other candidate because they need someone with 10+ years of experience for this role"

---

Are you fuc

Fucking

Ki

Wasting my Fucking time?

You decide to slam into my peace and offer me a job position with ALL THE REQUIREMENTS I FULFILL, JUST TO RANDOMLY REJECT ME FOR AN INVALID FUCKING REASON?

If i said i had 10 years of experience

They would reject me because i dont have 15+

If i had 15+ years of experience i would get rejected for not having 30+

If i had 30+ years of experience fucking your whole family and bombing them to dust like in palestine till their bones die and worms eat your fucking down syndrome brains, they would say i need 160+ year of experience

Fyck you

Truly.
From the bottom

Of my fucking balls and cum

From my fucking dick

From my fucking shit and asshole

From my vomit

I wish you death.

I wish karma to kill all of their family members (the clients who rejected me) slowly one by one. Final destination accidents type of deaths. Truly i hope you and wish you the worst.

[Here the intro continues]

I will repeat again:
- REQUIREMENTS: 3+ years

I have:
- 8+ years

They rejected me because:
- I don't have 10+ years

I told all of this to recruiter now. Politely but because im losing my patience i was very very passive aggressive with my response. In the context of

1. I TRULY dont give a fuck for your rejection (which is the truth)

2. Your clients are low IQ dumb as fucking retards because they choose people based on the YEARS OF EXPERIENCE

3. Explained him: IF YOU ARE SO FUCKING STUPID TO UNDERSTAND THIS COMMON SENSE, I'LL EXPLAIN IT TO YOU: CHOOSING DEVS SOLELY BASED ON THE YEARS OF EXPERIENCE MEANS YOU ARE FUCKING STUPUD. There are devs with 2 years of experience who are WAY smarter better efficient and more knowledgeable than some devs with 5-7 OR MORE years of experience. Thats because some people progress better faster or more efficiently in 2 years while others need 5 years. Etc. You're fucking stupid as shit for this sole decision

4. Indirectly let him know that i am not pissed off for rejection. I am pissed off for my time being FUCKING WASTED.

5. Also pointed him out: your job description says its looking for a dev with 3+ years of experience i told you i have 8+ and you reject me because I don't have 10+. Are you Fucking stupid? Fuck you. Truly fuck off. Get the fuck off my dick and eat the shits i shit straight out of my asshole. I'll shit in your fucking mouth you fucking bitch. Your wife also probably fucks some other guys while you're at work and she doesnt respect you or love you. In the matter of fact give me your fucking wife/gf and I'll Fucking fuck her to death

To the clients once again: Truly i hope Hamas fires a missile at israel but misses and hits your fucking home and your whole fucking family blows up to atoms and particles. Completely erased from existence.

Of course, I just swiped the wrong way on my fucking laptop trackpad and list everything I just typed. FUCKING MARVELOUS.

TL;DR: Teacher stopped me from being productive. Principal almost called cops on me. Nearly threw chair at librarian.

So I'm at school yesterday, and we have a presenter in 2nd hour, so naturally, I'm gonna be on my computer doing things for other classes at the same time. Efficiency. Teacher doesn't like it, I refuse to put the computer away telling her that I'll be more productive and still pay attention, which HAS BEEN PROVEN MIND YOU, but she ends up calling security on me and I get sent down to the principal's office.

I talk to him, and he says 'Yeah, I know it's in the way, but you have to follow the directive given by the teachers.' Fine, fuck it. Won't go to her class for third hour. (I have her twice in a row for two different classes.) Next day.

I walk in, asking her if she's gonna do the same thing she did yesterday, hoping that she realized her error and will fix it, but no. She says I STILL can't have the computer out. I'm sorry, do you not realize I have 6 other fucking classes, most of which are required to graduate, unlike YOURS, as well as a FUCKING COLLEGE CLASS TONIGHT?! She gives the ultimatum. 'Obey or leave.' Fine, I'll leave. I go to the principal's office again, he must have a stick up his ass or something today because he's not budging. We argue for a while and he gives a WORSE ultimatum: 'Obey, Go to the Library, In House Suspension, or I'll call the police.' What the actual FUCK MAN?! You're gonna call the POLICE on a NONVIOLENT STUDENT?! Are you fucking MAD? I keep trying to tell him that there's an easy solution to this, but as he's getting up to call the cops, I say 'Fine! I'll go to the library!' He follows me over to make sure I don't kill anyone on the way.

I slam the door to the library open, and when I walk in, the librarian is there at her computer, and she asks 'Where are you coming from?' 'Principal!' 'I need a pass-' 'Well, I'm sorry, I can't exactly get anything for you right now, I was just sent down here.' She says 'Either way, I need some kind of note or pas-' 'Listen, I'm not in the mood for any of this right now. Please, just leave me be.' She then tries to say something, but I cut her off quickly, 'Just back off and leave me alone right now. The more you push it, the more you're gonna make me want to throw this chair!' Imagine the volume just gradually getting louder on that last one. She quickly runs out and talks to the security desk or something, which is right outside the library door, but she's the only one who comes in, thankfully. I was expecting to be fucking dragged out for no good reason. I'm loud, not violent. I have no history of violence.

So yeah. Here I am in the school library, angrily tapping away at my keyboard, trying not to throw the entire table to the fucking moon. All because this broken-ass public school system has no idea how to deviate from the norm when it's actually productive and efficient to do so. And now, the obligatory:

FUCKING PIECES OF SHIT WHY DON'T YOU REALIZE THAT YOU ARE COMPLETELY WRONG IN EVERY SINGLE THING YOU ARE DOING YOU IDIOTIC SCUM-FILLED MEAT SACKS OF NO FORSEEABLE VALUE! FUCK!

!dev related

I think I might need to visit the doctor soon.

I just can't get hungry and if I do try and eat I feel like shit not even 10 minutes after. Only after many hours of going by without eating do i really feel hunger and can eat without my stomach wanting to kill myself.

Yesterday for example. Ate at around 1 o clock (without being hungry) and not even 5 mins later i was lying down in my couch feeling like absolute shit.

Didn't eat anything throughout the rest of the day and today I am feeling like I could eat an entire horse by myself.

I don't know what is happening to me. I am dropping pounds like crazy and been feeling super tired. Really creeped out at what the doctor might say about why this is happening.

I would like to think that is stress and nothing more.

Asshole marketing director again.

We’ve just finished a bit of work with some marketing agency. They ran some ad campaigns for us, no biggie.

Anyway marketing director emails them, copies me in and asks them if the have any “tips on our approach to development”

AAAARGGGHHHH!!!!!?

WHAT THE FUCK?!

The things that happen when you don’t have a fucking meat cleaver in your hand. I swear this guy is the fucking King of Cunts. I could kill. I think the jail time might even be worth it!!