Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "kill it all"
-
Another day, another hit piece against gaming.
So, a 15-year old boy hanged himself and the media goes all „This was caused by this game“, even though NO FUCKING TRACES OF THE GAME WERE FOUND ON THE LAPTOP OF THE DECEASED!!!
And then of course my freaking parents go all lecturing me about how the internet twists the brain into not being adequate towards reality etc.
First off, CAN THE FUCKING COLLECTION OF COCKSUCKERS that is the fucking media just fucking get a grip on reality? It was literally said in the same sentence that the supposed game that caused that was not found in any form on the person's laptop. You would think an online game that you take months to play through would need at least some fucking download to run, right? Unless it was a freaking video chat bullshit that they call a „game“ just for the fucking spite of gamers.
Second, HOW FUCKING LONG WILL IT FUCKING TAKE FOR PEOPLE TO FUCKING ACCEPT THAT IT'S NOT THE TECH THAT MAKES PEOPLE KILL THEMSELVES? How hard is it to fucking understand?
Third... How do people in their 60s freaking think they understand anything about modern gaming when they have no freaking way of interacting with it other than these hit pieces? They certainly give more fucks about what a hired bitch of a lying „journalist“, that cannot even talk properly, says. Oh, they care so much about the children. Have they never thought that people are killing themselves exactly because they feel nobody cares about them?
Fourth. How fucking long do parents like mine deny the reality that just as long as they see me as an incomplete copy of my sisters I will be suicidal? Let me guess... It's video games causing me to be oh, so inadequate when I've not played any of them for quite some time...
Fifth... How am I out of touch with reality when these people have never known how I „work“, so to speak, as a person, and they've been the ones basically dictating all my life? Let me see why I'm unhappy...
I know I complain a lot. Sorry for that. But I just cannot stand people like them. People that lie all the time and project that on you while depriving you of any means of defending yourself in a debate...43 -
Speaking of bad dev days, what a week I'll be having.
Lead-dev: I've got some bad news for you.
Me: Client X?
Lead: Client X.
Me: How many pages do I have to change?
Lead: All of them.
Me: On how many of their websites?
Lead: All of them.
Me: All of them?
Lead: All. Of. Them.rant it never ends fml client eat my ass all of them kill me now intern struggles i'm not getting paid18 -
Friend: What's that?
Me: DuckDuckGo. It's my default search engine.
Friend: Try using Google instead, it's better.
Me: But Google spies on you.
Friend: So?
Me: Don't you care about your privacy?
Friend: It's not like they are going to kill me. It doesn't matter.
Me: *mumbles* typical muggle...
I'm surprised that people could care less for their privacy. I would ban all things google, but I need google docs.
Also, my idiotic school requires gmail and google classroom. Oh, and did I forget to mention we have to use chromebooks!97 -
I’m a senior dev at a small company that does some consulting. This past October, some really heavy personal situation came up and my job suffered for it. I raised the flag and was very open with my boss about it and both him and my team of 3 understood and were pretty cool with me taking on a smaller load of work while I moved on with some stuff in my life. For a week.
Right after that, I got sent to a client. “One month only, we just want some presence there since it’s such a big client” alright, I guess I can do that. “You’ll be in charge of a team of a few people and help them technically.” Sounds good, I like leading!
So I get here. Let’s talk technical first: from being in a small but interesting project using Xamarin, I’m now looking at Visual Basic code, using Visual Studio 2010. Windows fucking Forms.
The project was made by a single dev for this huge company. She did what she could but as the requirements grew this thing became a behemoth of spaghetti code and User Controls. The other two guys working on the project have been here for a few months and they have very basic experience at the job anyways. The woman that worked on the project for 5 years is now leaving because she can’t take it anymore.
And that’s not the worse of it. It took from October to December for me to get a machine. I literally spent two months reading on my cellphone and just going over my shitty personal situation for 8 hours a day. I complained to everyone I could and nothing really worked.
Then I got a PC! But wait… no domain user. Queue an extra month in which I could see the Windows 7 (yep) log in screen and nothing else. Then, finally! A domain user! I can log in! Just wait 2 extra weeks for us to give your user access to the subversion rep and you’re good to go!
While all of this went on, I didn’t get an access card until a week ago. Every day I had to walk to the reception desk, show my ID and request they call my boss so he could grant me access. 5 months of this, both at the start of the day and after lunch. There was one day in particular, between two holidays, in which no one that could grant me access was at the office. I literally stood there until 11am in which I called my company and told them I was going home.
Now I’ve been actually working for a while, mostly fixing stuff that works like crap and trying to implement functions that should have been finished but aren’t even started. Did I mention this App is in production and being used by the people here? Because it is. Imagine if you will the amount of problems that an application that’s connecting to the production DB can create when it doesn’t even validate if the field should receive numeric values only. Did I mention the DB itself is also a complete mess? Because it is. There’s an “INDEXES” tables in which, I shit you not, the IDs of every other table is stored. There are no Identity fields anywhere, and instead every insert has to go to this INDEXES table, check the last ID of the table we’re working on, then create a new registry in order to give you your new ID. It’s insane.
And, to boot, the new order from above is: We want to split this app in two. You guys will stick with the maintenance of half of it, some other dudes with the other. Still both targeting the same DB and using the same starting point, but each only working on the module that we want them to work in. PostmodernJerk, it’s your job now to prepare the app so that this can work. How? We dunno. Why? Fuck if we care. Kill you? You don’t deserve the swift release of death.
Also I’m starting to get a bit tired of comments that go ‘THIS DOESN’T WORK and ‘I DON’T KNOW WHY WE DO THIS BUT IT HELPS and my personal favorite ‘??????????????????????14 -
Sorry, !dev-related.
Today I wake up tired. Mother barges into my room and tells me I should be already ready, takes time to fucking argue, then does some cleaning(As if I never do it or something), and this evening she starts arguing about that again and just disconnects the plug from my PC, telling me I shouldn't have gotten a person who takes preparing way longer than me and who also got out of the car when I was ready to take off late AND that I should apologise to her for speaking „in a rude manner“, when just a few seconds ago from that she hit me. That hit wasn't painful. It still was a hit, though. Do I have to say how angry I got? As if I needed that. I'm already having trouble with not wanting to kill myself for a whole week nonstop. And she tells me I have to apologise or I don't get my PC back. Oh, I haven't gotten to the best part: My birthday's coming really soon. A week and a day later. Beats me how I will have to force myself to smile like an idiot again just because the actual idiots cannot understand the shit they've done to my mind. So much so I may not be functioning at all if I stay with them much longer.
This combined with all my family telling me how insane I supposedly am etc.
I might try a photography school. My friend(who could be my twin), has been nagging me about trying it...
I need a job.
I need a fucking place away from these blood-sucking leeches.
I need to understand how my horrible self-esteem has potentially fucked my whole life up and how much nerves I wasted on my goddamn nuclear family.
I also need to learn to forgive myself.
Many more, but I will end this here.39 -
woke up at 5am
no alarm clock was required
my fucking passion woke me up to get up and code.
i coded outside in my backyard
felt like cold war
it was night
it was dark
a depressing horror atmosphere
just like my whole life
2 hours later i started seeing sun
it was cold outside. alone. in the dark. my arms were freezing.
but 2 hours later i managed to code the feature. it worked.
3 hours have passed. im ripped. quentally.
doing it here. inside now. started the day happy. dropped bullshit from day before. cleanser of all toxicss.
fuck the past. the past will pull you down and kill you.
this. remember. always do not forget.7 -
Back in 2011 when I was 14, I created a cmd shortcut on all pc in my school's computer lab. Replaced the icon and renamed it to Internet Explorer. Deleted the original IE shortcut and a week later the lab got closed because they all the computers got infected with a "virus"
i know im lame kill me7 -
I’m going to fucking kill my boss.
He’s known about how I’ve been writing this fucking ticket (screwdriver followup) for four fucking weeks, and on the last fucking day (yesterday) he tells me it’s not the correct fucking architecture and to rewrite basically all of it using <unknown bullshit> instead, and that i must have it done by today — by this fucking morning — so it can make the release.
WHY THE FUCK DIDN’T YOU TELL ME ABOUT THIS AT ANY POINT IN THE LAST FUCKING MONTH WHILE YOU WERE BUSY NITPICKING MY FUCKING CODE YOU FUCKING CUNT?!30 -
If programming languages where weapons...
1. C is an M1 Garand standard issue rifle, old but reliable.
2. C++ is a set of nunchuks, powerful and impressive when wielded but takes many years of pain to master and often you probably wish you were using something else.
3. Perl is a molotov cocktail, it was probably useful once, but few people use it
4. Java is a belt fed 240G automatic weapon where sometimes the belt has rounds, sometimes it doesn’t, and when it doesn’t during firing you get an NullPointerException, the gun explodes and you die.
5. Scala is a variant of the 240G Java, except the training manual is written in an incomprehensible dialect which many suspect is just gibberish.
6. JavaScript is a sword without a hilt.
7. Go is the custom made “if err != nil” starter pistol and after each shot you must check to make sure it actually shot. Also it shoots tabs instead of blanks.
8. Rust is a 3d printed gun. It may work some day.
9. bash is a cursed hammer, when wielded everything looks like a nail, especially your thumb.
10. Python is the “v2/v3” double barrel shotgun, only one barrel will shoot at a time, and you never end up shooting the recommended one. Also I probably should have used a line tool to draw that.
11. Ruby is a ruby encrusted sword, it is usually only used because of how shiny it is.
12. PHP is a hose, you usually plug one end into a car exhaust, and the other you stick in through a window and then you sit in the car and turn the engine on.
13. Mathematica is a low earth orbit projectile cannon, it could probably do amazing things if only anyone could actually afford one.
14. C# is a powerful laser rifle strapped to a donkey, when taken off the donkey the laser doesn’t seem to work as well.
15. Prolog is an AI weapon, you tell it what to do, which it does but then it also builds some terminators to go back in time and kill your mom
All credits go to Vicky from damnet.com5 -
Linux developers threaten to pull the kill switch...talking about giving people the finger this week...
If you have been following the nerd news these last weeks you may have heard about Linus leaving Linux (temporarily) and implementing the new CoC (pronounced cock) code of conduct thanks to the constant pressure of the ABC of inclusion (LGBTQLMNOP+ groups).
This new code of conduct aims, believe it or not, to change the predominantly white, straight, and male face of programming and it also seems to "mitigate the consequences of dogmatic meritocracy".
That's right, are you white, male, straight or otherwise pull yourself out of the mud? Yes, YOU are part of the problem (also racist, sexist and probably islamophobic).
Bullshit I know, these SJW privileged upper class assholes are pushing for these changes to inspire witch-hunts against good devs like Larry Garfield (cause: sexual fetishes) and give themselves more power over the free speech of people.
Ironic if you ask me because I haven't seen anything similar for oil rigging which is riddled with cis males (but ain't as comfy).
But not everything is lost and that's why this hasn't been a mouth foaming rant because boy I'm proud to know there are devs with balls out there; It seems there's a little detail with the GPL2 license and all those unjustly banned by the new stupid racist ass CoC can withdraw the license to their contributions crippling the Linux kernel project.
I'm not happy that GNU/Linux is being threatened like so, but it was about time we put a stop to this, your politics, skin color, religion and ideas should not matter when developing code, what matters is the code you produce.
Want to politicize our repos and kick out devs just because they don't think the way you do? Let's see how long you last without the contributions of the "deplorables"; let us see how many good contributions your new "diverse", PC stack do (other than changing master/slave or other terms).
My guess...as I've said earlier, everything these PC busybodies touch, if unchecked, crumbles to dust. (EA 😉)
Sources:
https://lulz.com/linux-devs-threate...
https://contributor-covenant.org//
https://lists.llvm.org/pipermail/...80 -
Around 2009 or earlier, I began the long grueling process of creating my own batch AI (yes batch as in Windows Batch , kill me for not knowing there were better languages around). Looking back at it, it is THE messiest thing I've ever created. Mostly because of how many unnecessary files were created to make the entire thing work. However, I’m still proud of it to this day because of the dedication I had put into creating the entire thing.
I would create diagrams on the mirrors in my room; of course I would be scolded for this. But I was mad with thought working through the entire thing.
I would scribble and type whenever I had the chance, trying to create the functions that would allow the thing to talk back to me. Finally, when it opened its eyes and spoke its first words I quickly started creating the functions that would allow it to learn new inputs. Over time and with some elbow grease I was able to polish it up to my liking.
The entire program branched off some of my more earlier programs in batch, they mostly ranged from the medial to the crazy; i.e. turning my computer on and off at certain times of the day, and multithreaded migration of files to new disks
It's not as sophisticated as other AI that were being built at the time, but at the age of 16 and with no experience in real programming at all, I'd say it was my first stepping stone towards more sophisticated programs, and ultimately, my decision in Computer Programming at all.22 -
Are you for real Guido/python devs?! Can we stop shoving politics into non issues just to virtue signal please?
What the fuck is next?! Oh you can't kill a process you politely put it to sleep, you can't call that machine a server anymore it might get offended now it's called a service caring electrical appliance, hey what about removing python all together after all python could be misconstrued as phallic and drive women away; I know! Let's call it Santa/elves instead of master/slave!
Fuck off! And what's that of you being akward saying server/slave terminology around black people? That's insanely racist! Who the fuck thinks all black people are descendants of slaves? Why the fuck are you racist enough to imply they can't do their job properly because (unlike you) they would be uncomfortable, you low expectations racist fuck!
You just fucked with your open source base and I really don't wanna see python going woke and then broke.
https://github.com/python/cpython/...31 -
I have to let it out. It's been brewing for years now.
Why does MySQL still exist?
Really, WHY?!
It was lousy as hell 8 years ago, and since then it hasn't changed one bit. Why do people use it?
First off, it doesn't conform to standards, allowing you to aggregate without explicitly grouping, in which case you get god knows what type of shit in there, and then everybody asks why the numbers are so weird.
Second... it's $(CURRENT_YEAR) for fucks sake! This is the time of large data sets and complex requirements from those data sets. Just an hour through SO will show you dozens of poor people trying to do with MySQL what MySQL just can't do because it's stupid.
Recursion? 4 lines in any other large RDBMS, and tough luck in MySQL. So what next? Are you supposed to use Lemograph alongside MySQL just because you don't know that PostgreSQL is free and super fast?
Window functions to mix rows and do neat stuff? Naaah, who the hell needs that, right? Who needs to find the products ordered by the customer with the biggest order anyway? Oh you need that actually? Well you should write 3-4 queries, nest them in an incredibly fucked up way, summon a demon and feed it the first menstrual blood of your virgin daughter.
There used to be some excuses in the past "but but but, shared hosting only has MySQL". Which was wrong by the way. This was true only for big hosting names, and for people who didn't bother searching for alternatives. And now it's even better, since VPS and PaaS solutions are now available at prices lower than shared hosting, which give you better speed, performance and stability than shared hosting ever did.
"But but but Wordpress uses MySQL" - well then kill it! There are other platforms out there, that aren't just outrageously horrible on the inside and outside. Wordpress is crap, and work on it pays crap. Learn Laravel, Symfony, Zend, or even Drupal. You'll be able to create much more value than those shitty Wordpress sites that nobody ever visits or pay money on.
"But but but my client wants some static pages presented beside their online shop" - so why use Wordpress then? Static pages are static pages. Whip up a basic MVC set-up in literally any framework out there, avoid MySQL, include a basic ACL package for that framework, create a controller where you add a CKEditor to edit page content, and stick a nice template from themeforest for that page and be done with that shit! Save the mock-up for later use if you do that stuff often. Or if you're lazy to even do that, then take up Drupal.
But sure, this is going a bit over the scope. I actually don't care where you insert content for your few pages. It can be a JSON file for all I care. But if I catch you doing an e-commerce solution, or anything else than just text storage, on MySQL, I'll literally start re-assessing your ability to think rationally.11 -
This happened when I was on third semester of the career at university. I had my first boyfriend, the "Python" guy. He has that nickname because he used Python as his main programming language and nobody on the classroom used it.
In a few words, he was a... horrible human being. He talked down to me almost all the time, saying to me that my country was sh*t (he is from United States, and for a reason he never wanted to told me, he cannot go back to his country), that my university was sh*t and he said "you're will be lucky if you rot programming in a chair".
As you might wondering, yes, unfortunately it was a toxic relationship. Once he said he wanted to kill the teacher because he though that he hacked his laptop D:
He claimed that he was going to teach me python and security stuff, bla bla bla, but nothing. I learned python by my own.
I almost lost my faith in dev future because I though that the only ones that could have a real future in programming where people without ethics and only if they have a friend or a relative on a company.
The saddest part was that I dated him because I love smart boys, but he was just an idiot that, furthermore, wanted to change me (he pressured me to have tattoos, dye my hair and have sex, things that, of course, I didn't do).
I found courage to break up with him. I waited until the semester ends (in order not to lose my programming final projects) and, the day after the last day of class, I broke up with him.
I recovered my faith on programming when, next semester, one of the teachers invited me to give a python programming workshop :D and I gave two python workshops, and two of mobile development.
Now I'm working as a junior .NET developer. Thank God I broke up with him before the relationship became even worse. "Python" wanted to marry me after a year! O_O11 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Welcome back to practiseSafeHex's new life as a manager.
Episode 2: Why automate when you can spend all day doing it by hand
This is a particularly special episode for me, as these problems are taking up so much of my time with non-sensical bullshit, that i'm delayed with everything else. Some badly require tooling or new products. Some are just unnecessary processes or annoyances that should not need to be handled by another human. So lets jump right in, in no particular order:
- Jira ... nuff said? not quite because somehow some blue moon, planets aligning, act of god style set of circumstances lined up to allow this team to somehow make Jira worse. On one hand we have a gigantic Jira project containing 7 separate sub teams, a million different labels / epics and 4.2 million possible assignees, all making sure the loading page takes as long as possible to open. But the new country we've added support for in the app gets a separate project. So we have product, backend, mobile, design, management etc on one, and mobile-country2 on another. This delightfully means a lot of duplication and copy pasting from one to the other, for literally no reason what so ever.
- Everything on Jira is found through a label. Every time something happens, a new one is created. So I need to check for "iOS", "Android", "iOS-country2", "Android-country2", "mobile-<feature>", "mobile-<feature>-issues", "mobile-<feature>-prod-issues", "mobile-<feature>-existing-issues" and "<project>-July31" ... why July31? Because some fucking moron decided to do a round of testing, and tag all the issues with the current date (despite the fact Jira does that anyway), which somehow still gets used from time to time because nobody pays attention to what they are doing. This means creating and modifying filters on a daily basis ... after spending time trying to figure out what its not in the first one.
- One of my favourite morning rituals I like to call "Jira dumpster diving". This involves me removing all the filters and reading all the tickets. Why would I do such a thing? oh remember the 9000 labels I mentioned earlier? right well its very likely that they actually won't use any of them ... or the wrong ones ... or assign to the wrong person, so I have to go find them and fix them. If I don't, i'll get yelled at, because clearly it's my fault.
- Moving on from Jira. As some of you might have seen in your companies, if you use things like TestFlight, HockeyApp, AppCenter, BuddyBuild etc. that when you release a new app version for testing, each version comes with an automated change-log, listing ticket numbers addressed ...... yeah we don't do that. No we use this shitty service, which is effectively an FTP server and a webpage, that only allows you to host the new versions. Sending out those emails is all manual ... distribution groups?? ... whats that?
- Moving back to Jira. Can't even automate the changelog with a script, because I can't even make sense of the tickets, in order to translate that to a script.
- Moving on from Jira. Me and one of the remote testers play this great game I like to call "tag team ticketing". It's so much fun. Right heres how to play, you'll need a QA and a PM.
*QA creates a ticket, and puts nothing of any use inside it, and assigns to the PM.
*PM fires it back asking for clarification.
*QA adds in what he feels is clarification (hes wrong) and assigns it back to the PM.
*PM sends detailed instructions, with examples as to what is needed and assigns it back.
*QA adds 1 of the 3 things required and assigns it back.
*PM assigns it back saying the one thing added is from the wrong day, and reminds him about the other 2 items.
*QA adds some random piece of unrelated info to the ticket instead, forgetting about the 3 things and assigns it back.
and you just continue doing this for the whole dev / release cycle hahaha. Oh you guys have no idea how much fun it is, seriously give it a go, you'll thank me later ... or kill yourselves, each to their own.
- Moving back to Jira. I decided to take an action of creating a new project for my team (the mobile team) and set it up the way we want and just ignore everything going on around us. Use proper automation, and a kanban board. Maybe only give product a slack bot interface that won't allow them to create a ticket without what we need etc. Spent 25 minutes looking for the "create new project" button before finding the link which says I need to open a ticket with support and wait ... 5 ... fucking ... long ... painful ... unnecessary ... business days.
... Heres hoping my head continues to not have a bullet hole in it by then.
Id love to talk more, but those filters ain't gonna fix themselves. So we'll have to leave it here for today. Tune in again for another episode soon.
And remember to always practiseSafeHex13 -
Imagine if a structural engineer whose bridge has collapsed and killed several people calls it a feature.
Imagine if that structural engineer made a mistake in the tensile strength of this or that type of bolt and shoved it under the rug as "won't fix".
Imagine that it's you who's relying on that bridge to commute every day. Would you use it, knowing that its QA might not have been very rigorous and could fail at any point in time?
Seriously, you developers have all kinds of fancy stuff like Continuous Integration, Agile development, pipelines, unit testing and some more buzzwords. So why is it that the bridges don't collapse, yet new critical security vulnerabilities caused by bad design, unfixed bugs etc appear every day?
Your actions have consequences. Maybe not for yourself but likely it will have on someone else who's relying on your software. And good QA instead of that whole stupid "move fast and break things" is imperative.
Software developers call themselves the same engineers as the structural engineer and the electrical engineer whose mistakes can kill people. I can't help but be utterly disappointed with the status quo in software development. Don't you carry the title of the engineer with pride? The pride that comes from the responsibility that your application creates?
I wish I'd taken the blue pill. I didn't want to know that software "engineering" was this bad, this insanity-inducing.
But more than anything, it surprises me that the world that relies so much on software hasn't collapsed in some incredible way yet, despite the quality of what's driving it.44 -
An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..
She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.
The one that I did 3 weeks ago that same fucking morning.
AND SHE WAS STILL NOT DONE...
A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me
Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"
She then goes to my fucking boss to tell him I am bothering her.
And omg... Please dear god please kill me now...
Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.
He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.
Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!
Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.
all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.
the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:
Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.
Me: I am only using this laptop for work so thats not possible.
Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?
Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends
Boss: Ahh okeee I see.. Well dont let it happen again.
After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.8 -
Stop it with the Linux shilling already.
I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.
But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.
This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.
How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.
Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.
But then again, this is devrant and I love you all. Have a great week everyone!21 -
When I was studying OOP our teacher instructed us to submit a project at the end of semester. Me and my friend worked hard and enthusiastically and finished our first game in C++ (Ping Pong). We were very excited because we had put so much effort into it that we were 100% sure that our project will be the best among all. At the end of semester, turned out our teacher does not have much time to evaluate our projects, so instead he announced a motherfucking MCQ's quiz. Everyone got really really happy but I was thinking of multiple ways I could kill that bastard.2
-
A quite normal Windows day:
Bios to Windows: "Go now! Get up!"
Windows to Bios: "Always slow with the young circuit boards."
"I've got something weird on screen."
Windows' answer: "Ignore it first."
Hardware assistant to Windows: "The user puts pressure. He wants me to identify this thing. Could be an ISDN card."
Windows: "Well, well."
Unknown ISDN card to all: "Will you please let me in?"
Network card to intruder: "You can't spread out here!"
Windows: "Quiet in the case! Or I'll cut both their support!"
Device Manager: "Offer compromise. The network card is allowed on Mondays, the ISDN card is on Tuesday."
Graphics card to Windows: "My driver retired yesterday. I'm crashing now."
Windows to graphics card: "When will you be back?"
Graphics card: "Well, not at first."
CD-Rom drive to Windows: "uh, I would have a new driver here..."
Windows: "What's ich´n supposed to do with it?!"
Installation software to Windows: "Leave it, I'll mach´ that already."
Windows: "That's nice to hear."
USB connection to interrupt management: "Alarm! Just been penetrated by a scanner cable. Request response."
Interrupt management: "Where are you coming from?"
USB connection: "I was in the computer right from the start. I'm joined by another colleague."
"You're not on my list." - "Say something."
Windows: "Hopefully there won't be another printer."
Graphics card: "The new driver twitches."
Windows: "We'll just have to get the old one out of retirement."
Uninstall program to new driver: "Go away."
Unwanted driver: "Fuck you."
Windows to Norton Utilities: "Kill him and his brood!"
Utilities to driver rests: "Sorry, we have to delete you."
Important system file: "Arrrrrrgghh!"
Windows on blue screen: "Gib´, the Norton Boys are over the top again."
Blue screen to user: "So, that's it for this week."
Excuse me for stealing your time
And I know it's way too long7 -
Well today I got a fantastic surprise (truthfully). We hired a dev some months ago, who was on 6 months probation and, to put it politely, he was not going to pass it.
*side note: for details of some of the above, read my last 10 or so rants. They are pretty much all him.
Anyway, management put him on an improvement plan to make sure everything was fair, it wasn't working out, but they said we had to finish it to be fair.
So we had another 2 weeks left when he announced last night he's leaving for a new junior role, technical but not a dev.
Months of stress, heartache, bewilderment, late nights and weekends all just came to an end.
The English language fails me to express my overwhelming joy at this moment. The only way I can come close to it is to say that when he made his announcement, a colleague told me I should stop smiling as it could be taken as being rude.
I'd like to take this moment to thank the community for supporting me over the past few difficult months. Without you I probably would have tried to kill him with my dev rant stressball.
Thanks,
practiseSafeHex8 -
With all this emoji code bullshit flying around in here.
I thought I would test my luck and make what I think would be the worst possible end result of this.
<?php
define("😂","God help me");
define("🤡",100);
for($🍔 = 0; $🍔 <= 🤡; $🍔++){
echo 😂."\n";
}
?>
This will execute and run on PHP7.1 😱
Now let’s all band together and kill emojicode before it becomes a thing we will regret!11 -
As I was walking to the store, I found yet another piece of evidence of nature rape (aka fucking nature by littering of harmful substances). Just like last time I brought it home for proper disposal.
But if I ever find the motherfucker who did this, I have a nice punishment for you. I'll knock you unconscious, drag you home, take your phone and desolder its battery. Then I'll strap a plastic bag around your stupid face, and put the battery in there while it's being shorted. Quickly it'll heat up and you'll start to turn blue with that little bag being your only oxygen source. And when that battery puffs, boy are you going to fucking gasp it all in. Hopefully that'll be poisonous enough to kill you on the spot. If not, I'll have some fun watching you die from oxygen deprivation. Or I'll jam that very same AA battery that you dropped down your throat - you choose.
Call me a psycho all you want, but what does that make you, whoever attempted to further fuck nature by uncaringly dropping a battery on the sidewalk? Oh and let's not mention the results of it - a heatwave that's been going on for over a month now. Thank you so much for bringing the place that you deserve to be in - hell!rant nature rapists fsociety fuck society uncaring motherfuckers fuck it all fuck humans fuck humanity13 -
Friend of mine killed his MacBook with some Softdrink.
Just poured it all over his poor a1502.
He let it dry for a few days, it starts to work again.
Except the battery.
Goes on Amazon and buys a new battery.
New battery doesn't work either and so he tells me about it and I as stupid as I am couldn't resist the temptation to finally work on a MacBook like my "hero" Lois Rossmann does.
So turns out the board is good.
Cleaned it up and basically nothing happened to it.
So what's the deal with "los batlerias"?
The first got hit by liquid, the second had a broken connection to a cell.
That could have happened through my friend, installing it without testing it first, or at the seller, so it being a DOA battery.
Now away from the stupidity of my friend and the situation to the actual source for this rant.
Once something happens to a modern Managed battery, the Battery Management System (BMS) disconnects the voltage from the system and goes into an error state, staying there and not powering anything ever again.
For noobs, it's dead. Buy a new one.
But It can be reset, depending you know how to, and which passwords were set at the factory.
Yes, the common Texas instruments BQ20Zxx chips have default passwords, and apple seems to leav them at default.
The Usb to SMBus adaptors arrived a few days ago and I went to prod the BMS.
There is a very nice available for Windows called BE2works, that I used the demo of to go in and figure out stuff. The full version supports password cracking, the demo not.
After some time figuring out how Smart Battery Systems (SBS) "API" works, I got to actually enter the passwords into the battery to try get into manufacturer and full access mode.
Just to realise, they don't unlock the BMS.
So, to conclude, my friend bought a "new" battery that was most likely cut out of a used / dead macbook, which reports 3000mah as fully charged instead of the 6xxx mah that it should have, with 0 cycles and 0hours used.
And non default access.
This screams after those motherfuckers scaming the shit out of people on Amazon, with refurb, reset, and locked fucken batteries.
I could kill those people right now.
Last but not least,
My friend theoretically can't send it back because I opened the battery to fix the broken connection.
Though maybe, it'll get send back anyway, with some suprise in the package.9 -
Every time I do a dirty fix and someone in my MR comments "have you investigated the root cause" I wanna kill myself.
No bro, I havent investigated the root cause because this ticket is 3 months old and was passed around like a hot potato from team to team until it got assigned to me.
If you want I can add a comment to refactor this in the future. As far as Im concerned any refactors are out of scope, also I atleast came up with some kind of solution that noone else was able to in 3 months. So im not gonna waste my time on refactoring this piece of shit code under immense pressure from management who thinks it was me who dragged this ticket for 3 months.
Its working, it doesnt cause any side effects, we all gonna die soon and nothing really matters, so fuck off.9 -
Woohoo! 32k achieved!!! Finally I can post some new rant without risking some sudden overshoot 😁
So putting celebrations aside for a minute, a while ago I've noticed a tingle when I stroke my finger across metal areas of my tablet, or the sides of my phone (which probably has metal near it too) while it's charging. And it's been bugging me ever since.
Now, some things to note are that it only happens when my feet are touching the ground though slippers, and that the frequency is so low that I can actually feel the tingle when I slide my finger across the material. This to me at least seems like electricity flows through me into ground, and touching the ground directly provides a path so easy for the electrons to run away that I don't feel it at all. But if I lift my feet off the ground entirely, I just get charged up and after that, nothing else happens.
So those are my ideas. The answers on the subject on the other hand.. absolute cancer. Unsurprisingly, most of them came from Apple users. Here's some of them.
https://discussions.apple.com/threa...
- I've not noticed it, but if you're concerned bring the phone to Apple for evaluation.
- Me too facing same problem.. did u visit apple care?
And one good answer at least...
- google emf sensitivity, its real. You are right, there is a small current flowing through your body, try to limit your usage. The problem with this issue is those who aren't affected (lucky ones for now) will tell you these products are 100% safe. To a degree they are, i used my ipod touch for about 2 years straight vwith virtually no symptoms. then the tingling started and it gets worse.You will get more sensitive to progressively less powerful things. I dont want to scare you but just limit your usage like i didnt do 🙂
Overall that discussion was pretty good actually, aside from "bring it to the Genius Bar, they'll know for sure and not just sell you another unit". But then there's Reddit.
https://reddit.com/r/iphone/...
- Ok, real reason is probably that the extension cord and/or outlet is probably not grounded correctly. Either that or you are using a cheap knockoff charger.
Either use a surge protector and/or use the authentic Apple Charger.
- It's not the volts that hurt you, it's the amps
- I think you are in deep love with your phone. That tingling sensation is usually referred to as "love" in human language.
- Do less acid, I would advise.
Okay, so that's the real cancer. Grounding issue sounds reasonable despite it being wrong. Grounding is actually not needed when your charging appliance doesn't have any exposed metal parts. And isolation from high voltage to low voltage side actually happens through things like routering holes into the PCB, creating spark gaps, and using galvanic isolation through things like optocouplers. As for a surge protector? I'm using them to protect my PC and my servers, but the only purpose they serve is to protect from.. you guessed it.. voltage surges, like lightning bolts hitting the grid. They don't do shit for grounding or reducing this tingle! What a fucking tool.
It's not the volts that kill, it's the amps.. yeah I'm sure that the debunking of that is easy to find. Not gonna explain that here. And the rest of it.. yeah it's just fucking cancer.
Now what's the real issue with this tingle? It's actually a Class-Y rated (i.e. kV rated) capacitor that's on the transformer of any switch-mode power supply, including phone chargers. If memory serves me right, it helps with decoupling the switching noise and so on. But as it's connected to the primary side of the transformer, if the cap is sufficiently large and you are sufficiently sensitive, it can actually cause that tingle by passing a fraction of the mains electricity into your body. It's totally safe though, as the power that these caps pass is very small. But to some, it's noticeable.
Hope you found this interesting! And thanks a lot for bringing me to 2^15. I really appreciate it ♥️15 -
I so fucking hate mosquitoes. At this point I'm seriously willing to lure all those bitches in and guide them straight to an electrical death. Problem is, I know how to generate super high voltage to char the fuckers right into smelly dust, but I don't know how to lure them in, or even find them manually, so let alone automatically. Even a chemical reaction we can electronically dispense to lure in the fuckers, but I have no idea what that chemical stuff would be. I'm not a chemist (yet). But if I can build it, fucking hell.. I would build a ton of them, weaponize my entire home and even build some spares to send off to fellow ranters. Because those parasitic bitches must DIE!! The only reason why they still exist after thousands of years is because we didn't kill the fuckers yet. I want to fucking kill the leeches, preferably in the most gruesome way possible.
So yeah. A shout for help to my fellow ranters this is.. perhaps even a collab. I have no idea about the stuff that draws those fuckers into their death. Any suggestions? Whoever can guide me to the demise of those parasitic pieces of shit, seriously.. if at all feasible, I'll build it for you and ship it!! Death to those parasitic blood-sucking bitches!!!26 -
Since I was little I was fascinated by club light shows I saw on TV shows. I just couldn't find out how they made light react to sound, which were two completely unrelated things to me back then. But I wasn't dumb and somehow figured out that if I hooked some low energy fairy lights to my amp and turned the bass up, they would lightup to the beat.
3 fried fairy lights and angry parents for to loud music later I swore to myself that I would someday build something that could light up my whole room and react to the music I was playing.
I started coding about the age 13 (turned 20 a month ago) with some old school bat scripts. But I wanted something that would generate a .exe so I googled and ended up installing Visual Studio Express (again angry parents for installing without asking) and started copying my first VB.Net program together. From there no one could stop me. I wanted to archive something with an application and googled until I found what I needed and learned to code this way.
I learned writing decent vb.net code and itvwas about this time I came into contact with IRC. I lurked arround there and this is were I came into contact with Linix servers, because I wanted to code IRC (eggdrop) bots, so I learned TCL and got used to Linux. Time passed and I ended uo being a Global OP on some network back then.
I did go further, coded Minecraft Mods, thus Java, changed back to C#, learned PHP and started setting things up on my VPS, Mails server, web server, etc.
Nowadays I work as a Systemadmin / Developer Hybrid, earning my first real money doing what I love to do and guess what? In the meantime I proved myself I can accomplish what I wanted as kid. I bought some Club LED DMX capital lights and programmed a controller for them which can control them in C#, but in a way I can run it on my raspi using mono. I also coded a client which runs on windows which uses some native libraries to calculate the dominant color of the shown picture in realtime (Handels 24fps 1080p) and uses the lights as ambient light, like you see them behind TVs sometimes.
The same app uses Bass.NET and an algorithm to dedect a beat in realtime and switches the light colors. Exactly what I wanted as akid, but better.
I can even control the lights via the new Google Assistant and/or Tasker.
Feels fcking good.
Some of my work lies on github among other, mostly trash: https://github.com/Kimmax - didn't updated there in a while tho.
I plan on writing a new free opensource plugin based modular home automatication server and pretty sure could use some helping hands..
I don't know why I wrote all this, just felt like it.
Also: first Rant
Please don't kill me for errors in the text, I'm to lazy to read through it again right now :P8 -
My friend loves Dreamweaver... And continuously says that he doesn't understand what people see in it that is so wrong... It does the job right?...... Fucking blind...
Uses a bootstrap plugin which generates HTML code for bootstrap.
I did not know this at the time.
Comes to me the night before submission.
He: Dude i need help quick! I've got the presentation tomorrow morning and bootstrap fucked up the links to my style sheets or something, my page is broken and won't work. I should have done what you did and gone for Foundation...
Me: Yeah, because the bootstrap framework definitely affects the style links...
He: help me out man, please! I can't do this anymore!
I had my submission the day after him to prepare still...
Me: Teamviewer. Now.
Log on to Teamviewer.
See what he's using to code...
Dreamweaver..... Niiiiice....
I go through the code. There are empty divs with &nbsc; in them everywhere.. some HTML elements haven't been closed, no comments, indentation seems to be completely random. All the usual shit storm of a novice web designer.
The only thing is, this guy I know knows how to indent, I've seen his previous work. Why is this so horrible then???
I ask what the hell happened, it looked like a nuclear explosion happened!
He: Yeah I'm using this great plugin for Dreamweaver which lets me click and it puts in Bootstrap elements! It's great!
........ You're blaming the bootstrap framework for affecting your links to your stylesheets, you're using an elements generator, you're not checking what the FUCK it puts into your code, not fixing the indenting, not checking the standard HTML rules are followed AND YOU WONDER WHY IT'S BROKEN???
Kill me now.4 -
Wtf, really??? Are they trying to liyerally KILL ME????
Got home from hospital today wth my family. Baby got sick. Wife also caught cold... Bad news. It was just me still healthy like a raddish [we have such saying].
So I got home. Started feeling somewhat funny. Sore thighs, feeling nauseaus, chilly, a bit dizzy.
10 minutes later I'm fucking trembling! It felt as of I was kicked put bare ass to -20C outside! I'm not exaggerating [probably made some typos.. Pls correct me] - i live where winters get like -35C. Everything around got like twice darker. And my lower teeth got itchy af [NOT the best feeling, trust me].
I must have caught cold too - I thought to myself, cuz I know what these sympthoms mean. I always have 'em all when I have fever. Since shivers are caused by rising fever I got my Microlife remote thermometer out of my drawer. Click, blue light, wait, beeep. 36.5C. Allright.. Maybe I got it wrong... Try again -- same result. Wife also gave a couple tries - nada. Nil. Nullpointerexception. Healthy like a pickle!
10 minutes later I couldn't stand the cold. Got under my blankets wife made some soup, tea,... I still have this analog thermometer, the one with quicksilver. Pop it into my armpit - jusyt in case. 10minutes later I take it out. It says 39,5 and rising. Try the microlife again. 36,5. WHAT THE FUCK?????????
If I weren't so fond of old-school stuff I'd be in a fucking ER now!!
Fuck you medical digital equipment made to be used at home! FUCK YOU!!
I'm pissed.
Do you folks kbow where could I get those q-silver thermometers? Just in case. They're already out of matket in my area for quite some time... For being dangerous [i give 'em that, okay?] and.... Lisen to this.... "unreliable"!
FUCK IT!15 -
Prologue
My dad has an acquaintance - let's call him Tom. Tom is an gynecologist, one of the best in Poznań, where I live. He's a great guy but absolutely can not into tech of any kind besides his iPhone and basic PC usage. For about a year now I've been doing small jobs for him - build a new PC for his office, fix printer, fix wifi, etc. He has made a big mistake few years ago by trusting a guy, let's call him Shitface, with crating him software for work. It's supposed to be pretty simple piece of code in which you can create and modify patient file, create prescription from drugs database and such things. This program is probably one of the worst pierces of code I've ever seen and Shitface should burn for that. Worse, this guy is pretentious asshole lacking even basic IT knowledge. His code is garbage and it's taking him few months to make small changes like text wrapping. But wait, there's more. Everything is hardcoded so every PC using this software must have installed user controls for which he doesn't have license and static IP address on network card.
Part 1
Tom asked me to build him a new PC that will be acting like a server for Shitface's program. He needs it in Kalisz (around 150 km from my place). I Agred (pun intended) and after Tom brought me his old computer I've bought parts and built a new one. I have also copied everything of value and everything took me around three hours.
Part 2
Everything was ready but Shitface's program. I didn't know much about it's configuration so when I've noticed that it's not working even on the old PC I got a bit worried. Nevertheless I started breaking everything I know about it and after next three hours I've got it somewhat working. Seeing that there's still some problems with database connection (from Windows' Event Viewer) I wrote quick SMS to Shitface asking what can be wrong. He replied that he won't be able to help me any way until Monday (day after deadline). I got pissed and very courteously asked him for source code because some of libraries used in this project has license that requires either purchase of commercial license or making code open source. He replied within few minutes that he'll be able to connect remotely within next 10 minutes. He was trying to make it work for the next hour but he succeeded. It was night before deadline so I wrapped everything up and went to bed thinking that it won't take me more than an hour to get this new PC up and running in the office. Boy was I wrong.
Also, curious about his code, I've checked source and he is using beautiful ponglish (mixed Polish and English) with mistakes he couldn't even bother to fix. For people from Poland, here's an example:
TerminarzeController.DeleteTerminarzShematyDlaLekarza
Part 3
So I drove to Kalisz and started working on making everything work. Almost everything was ready so after half an hour I was done. But I wanted to check twice if it's all good because driving so far second time would be a pain. So I started up Shitface's program, logged in, tried to open ANYTHING and... KABUM. UNHANDLED EXCEPTION. WTF. I checked trace and for fuck sake something was missing. Keep in mind that then I didn't know he's using some third party control for Windows Forms that needs to be installed on client PC. After next fifteen minutes of googling I've found a solution. I just had to install this third party software and everything will work. But... It had to be exactly this version and it was old. Very old. So old that producent already removed all traces of its existence from their web page and I couldn't find it anywhere. I tried installing never version and copying files from old PC but it didn't work. After few hours of searching for a solution I called Mr Shitface asking him for this control installation file. He told me that he has it but will be able to send it my way in the evening. Resigned I asked for this new PC to be left turned on and drove home. When he sent me necessary files I remotely installed them and everything started working correctly.
So, to sum it up. Searching for parts and building new PC, installing OS and all necessary software, updating everything and configuring it for Tom taste took me around what, 1/3 of time I spent on installing Mr Shitface's stupid program which Tom is not even happy with. Gotta say it was one of worst experiences I had in recent months. Hope I won't have to see this shit again.
Epilogue
Fortunately everything seems to work correctly. Tom hasn't called me yet with any problems. Mission accomplished. I wanna kill very specific someone. With. A. Spoon.1 -
I would kill all these +1 guys, srsly. I subscribe these threads to know if it will be implemented.
You do not add any value to issue:
* devs are pissed off as this does not help solving problem
* others are pissed off
No one really cares about your likes, really.28 -
Today a colleague was making weird noises because he was modifying some data files where half of the data needed to be updated with a name field, there were 4 files all about 1200 lines big.
I asked how he was doing and he said he was ready to kill himself, after he explained why I asked why he was doing if manually. He said he normally uses regex for it but he couldnt do this with a regex.
I opened VS code for him, used the multiselect thing (CTRL+D) and changed one of the files in about 2 minutes. Something he was working on for over half an hour already.... He thanked me about a million times for explaining it to him.
If you ever find yourself in a position where you have a tedious task which takes hours, please ask if somebody knows a way of doing it quicker. Doing something in 2 minutes is quite a bit cheaper and better for your mental state than doing the same thing manually In 3 hours (our estimate)4 -
Years ago, when i was a teenager (13,14 or smth) and internet at home was a very uncommon thing, there was that places where ppl can play lan games, have a beer (or coke) and have fun (spacenet internet cafe). It was like 1€ per hour to get a pc. Os was win98, if you just cancel the boot progress (reset button) to get an error boot menu, and then into the dos mode "edit c:/windows/win.ini" and remove theyr client startup setting from there, than u could use the pc for free. How much hours we spend there...
The more fun thing where the open network config, without the client running i could access all computers c drives (they was just shared i think so admin have it easy) was fun to locate the counter strike 1.6 control settings of other players. And bind the w key to "kill"... Round begins and you hear alot ppl raging. I could even acess the server settings of unreal tournament and fck up the gravity and such things. Good old time, the only game i played fair was broodwar and d3 lod5 -
Fucking kill me right now please. How the FUCK am I supposed to get any shit done when I'm learning something and the fucking DOCUMENTATION has been UNAVAILABLE for the past THREE MOTHERFUCKING DAYS.
GET YOUR SHIT TOGETHER MICROSOFT.
Fucking idiots.
It wouldn't be so fucking bad if things like this didn't happen all the time.
But when EVERYTHING is FUCKED - ALL THE TIME, it kinda makes a person lose all hope in humanity and technology.
A typical motherfucking day for me:
Wake up
Go to work
Come home
Eat dinner (if I remember)
Attempt to code shit for 1 - 3 hours before I have to sleep
CAN'T FUCKING CODE SHIT BECAUSE:
1. Internet disconnects every 5 fucking minutes
2. DOCUMENTATION SITES ARE FUCKING DOWN
3. Shit Windows is UPDATING
4. a previous windows UPDATE has royally motherFUCKED my PC
5. etc
FUCK14 -
The tech stack at my current gig is the worst shit I’ve ever dealt with...
I can’t fucking stand programs, especially browser based programs, to open new windows. New tab, okay sure, ideally I just want the current tab I’m on to update when I click on a link.
Ticketing system: Autotask
Fucking opens up with a crappy piss poor sorting method and no proper filtering for ticket views. Nope you have to go create a fucking dashboard to parse/filter the shit you want to see. So I either have to go create a metric-arse tonne of custom ticket views and switch between them or just use the default turdburger view. Add to that that when I click on a ticket, it opens another fucking window with the ticket information. If I want to do time entry, it just feels some primal need to open another fucking window!!! Then even if I mark the ticket complete it just minimizes the goddamn second ticket window. So my jankbox-supreme PC that my company provided gets to strugglepuff along trying to keep 10 million chrome windows open. Yeah, sure 6GB of ram is great for IT work, especially when using hot steaming piles of trashjuice software!
I have to manually close these windows regularly throughout the day or the system just shits the bed and halts.
RMM tool: Continuum
This fucker takes the goddamn soggy waffle award for being utterly fucking useless. Same problem with the windows as autotask except this special snowflake likes to open a login prompt as a full-fuck-mothering-new window when we need to open a LMI rescue session!!! I need to enter a username and a password. That’s it! I don’t need a full screen window to enter credentials! FUCK!!! Btw the LMI tools only work like 70% of the time and drag ass compared to literally every other remote support tool I’ve ever used. I’ve found that it’s sometimes just faster to walk someone through enabling RDP on their system then remoting in from another system where LMI didn’t decide to be fully suicidal and just kill itself.
Our fucking chief asshat and sergeant fucknuts mcdoogal can’t fucking setup anything so the antivirus software is pushed to all client systems but everything is just set to the default site settings. Absolutely zero care or thought or effort was put forth and these gorilla spunk drinking, rimjob jockey motherfuckers sell this as a managed AntiVirus.
We use a shitty password manager than no one besides I use because there is a fully unencrypted oneNote notebook that everyone uses because fuck security right? “Sometimes it’s just faster to have the passwords at the ready without having to log into the password manager.” Chief Asshat in my first week on the job.
Not to mention that windows server is unlicensed in almost every client environment, the domain admin password is same across multiple client sites, is the same password to log into firewalls, and office 365 environments!!!
I’ve brought up tons of ways to fix these problems, but they have their heads so far up their own asses getting high on undeserved smugness since “they have been in business for almost ten years”. Like, Whoop Dee MotherFucking Doo! You have only been lucky to skate by with this dumpster fire you call a software stack, you could probably fill 10 olympic sized swimming pools to the brim with the logarrhea that flows from your gullets not only to us but also to your customers, and you won’t implement anything that is good for you, your company, or your poor clients because you take ten minutes to try and understand something new.
I’m fucking livid because I’m stuck in a position where I can’t just quit and work on my business full time. I’m married and have a 6m old baby. Between both my wife and I working we barely make ends meet and there’s absolutely zero reason that I couldn’t be providing better service to customers without having to lie through my teeth to them and I could easily support my family and be about 264826290461% happier!
But because we make so little, I can’t scrap together enough money to get Terranimbus (my startup) bootstrapped. We have zero expendable/savable income each month and it’s killing my soul. It’s so fucking frustrating knowing that a little time and some capital is all that stands between a better life for my family and I and being able to provide a better overall service out there over these kinds of shady as fuck knob gobblers.5 -
FLOYD IS HERE 😎
Gather around kids, it's story time.
So my first breakup left me so damaged and I was in darkest phase of my life. I was alone. Physically, mentally, and emotionally. I went for therapy and spearheaded into success and grew in life soooo fucking much.
31st December 2016, I first joined dR and since the first day this place felt home. Met some of brightest mind and most amazing souls here (sadly many left the place).
I used to shit post and rant a lot. But I loved everyone here. But then I don't quite remember, but I decided to quit this place as community started to grow. Many others left as well.
I came back here in 2019 IIRC and started all over again. Got along well with new members and started having fun.
I used to crib and cry about being underpaid. Lost a kickass Europe job due to pandemic.
I will skip what all happened between me and @Scout but she is a sweetheart, though very rough and brutal with me at times (actually very often), but she is so selfish for me and cares for me that I couldn't resist but listen to her always. A lifelong friend for sure :)
I used to rant about my dumb office colleagues. Definitely not the sharpest minds but good people at heart (which I did not realise).
So in October 2020, I earned a new job and my company retained me with a 100% raise and a promotion making me lead of product innovation and UX.
November end I met a girl in professional context on LinkedIn who was conducting a workshop. Being hungry for learning, meeting new people and kill my lockdown boredom, I singed up.
Now I went for December break and my colleagues sent me a gift hamper when they came to know I got a promotion. I felt bad that I ranted about them so I deleted my account and also wanted a social detox.
Post the workshop, I started conversing casually with the girl I met. She was married. But things hit off. Eventually in February end I confessed that I had feelings for her and in next few days she reciprocated. I told her I was aware of her marital status and it's okay if nothing happens between us. Then she started to open up of how she was with one guy for 17 years and was abused in everyway and wanted to separate but never had the courage and all.
She decided to file for paperwork and then be with me. Things got messy when her family got involved thinking I was causing all of it.
She went back to her partner and I realised I had some emotional and mental issues of a person's past that bothered me. But we were overcoming it. Soon the honeymoon period started phasing out.
Her family started giving me death threats. We went underground even further. More arguments and fights between us.
@Scout kept telling me I was stupid and I disregarded her. I feel like an idiot for not listening to her.
That girl kept gaslighting me, hurting me intentionally, scratching the surface made me realise how broken and damaged she was. She lied to me and created fake persona of herself to make me fall for her. Everything was lie. Literally.
I felt horrible for trusting her. My trauma relapsed and I started having crazy panic attacks leading to self harm and being suicidal. That girl was drugged all the time with psychological medicines and very poor character & personality in general (I don't want to judge anyone but just stating the facts).
Eventually she just disappeared and I was like fuck this. Earlier, after every fight, she used to show fake affection and I used to melt but not this time.
I was like fuck this shit. I have some super amazing friends like @kiki who helped me overcome this. I started going for therapy and realised what all areas I need to improve. My therapist is soooo brilliant, she understands the root cause instantly and also knows how to fix it. And the same day I and both my parents were COVID-19 positive. Last few weeks were dark and haunting.
Further more, the girl comes back after a week and then acts as a 'nice girl'.
Initially fake affection, then drama, followed by making me guilt trip, then threats, and now blaming me.
I kept ignoring her calls (50 to 70 calls in a day), emails, left her unread on Telegram, and everything I could do to ignore her without blocking her. I started gaining my happiness back.
During this mess, I lost 5+ KG of weight. She has no friends in her mid 30s. Knows no life or survival skills. Her family hates her, no career, no emotional or mental maturity, literally nothing. Insanely dumb and toxic manipulative person who is not even worth being called an ex. As per her everyone around her is an asshole except her. Every time something happened, she used to blame and bad mouth the other person. Now she is doing with me. In all her life situations, either she was a hero or a victim. One upped me all the time. Now that I see it, I hate myself for allowing it all of it and now having enough self worth to walk out of it earlier.
Continued in comments...56 -
Around 2009 or earlier, I began the long grueling process of creating my own batch AI (yes batch as in Windows Batch , kill me for not knowing there were better languages around). Looking back at it, it is THE messiest thing I've ever created. Mostly because of how many unnecessary files were created to make the entire thing work. However, I’m still proud of it to this day because of the dedication I had put into creating the entire thing.
I would create diagrams on the mirrors in my room; of course I would be scolded for this. But I really couldn't stop thinking about my program and working through the entire thing.
I would scribble and type whenever I had the chance, trying to create the functions that would allow the thing to talk back to me. Finally, when it opened its eyes and spoke its first words I quickly started creating the functions that would allow it to learn new inputs. Over time and with some elbow grease I was able to polish it up to my liking.
The entire program branched off some of my more earlier programs in batch, they mostly ranged from the medial to the crazy; i.e. turning my computer on and off at certain times of the day, and multithreaded migration of files to new disks
It's not as sophisticated as other AI progrmas that were being made at the time, but at the age of 16 and with no experience in real programming at all, I'd say it was my first stepping stone towards more sophisticated programs, and ultimately, my decision to enter into Computer Science at all.3 -
So I have this friend, let's call him retard. He decided to check out a coding competition. He signed up for it and then added me as a teammate. Then he went ahead and gave me a time, 22:00 local time. The time when the competition starts. I was excited, and being super retard didn't even think of rechecking things myself.
We waited in our merry ways, all so excited for a coding competition while listening to music to keep the mind free. The time finally came. It was 21:59. I opened up my ide and called upon my dear friend chrome. Asked the retard for the link. And then he decided to break out the curses. I was shocked, bewildered.
I didn't know what was going on, did I do something bad to him? Did I make him angry? Or did something happen to him? I was worried. After all, I don't want my teammate to be distressed during a competition. So in a stern voice I said, calm down my friend. Tell me the thing that's got you all riled up.
The news he conveyed shook my very foundations of trust and the feeling of comradry that we had built the day before going to lunch and discussing strategies. That bloody retard misread 20:00 as 22:00. Two whole hours. Two whole hours that could have been used for solving simple problems and making pretty algorithms were all gone and all that was left was the dust of other competitors who weren't retards and managed to read the time correctly.
Idk what to do. Should I kill him? Delete his github profile while he isn't looking? Ask him to kindly delete System32 folder from his C:/ drive?
But then again I should also take half the blame for not taking things seriously enough to make a bloody checkup on the fake news he provided.7 -
What's the difference between a wasp and single loose hair?
Apparently none till the wasp stings :/
Yesterday I thought I had a loose hair on my neck.. ok, I shrug it off.. later again the creepy feeling.. shrugs off..
I continue to work, sumberged in code, wanting to find the fucker (bug, not the wasp/hair).. lean in to the monitor... 10 cents away from the screen... Ok, maybe that's it! Feels the hair on my back, near shoulderblades again... shrugging again more violently to get it further down to fall out.. nothing.. ok, got the bug, threw myslef back in the chair with substential force & BAAAAM!!! Motherfucking hair bit me!! O.o
I scream in horror & on top of the lungs (it was late, after work hours so I didn't expect anyone else still at the office) PROKLETA PRASICA (roughly translated to goddamn female swine).. I previously saw some green bug flying around the office and I thought that nasty thing bit me (didn't know they bite soo, much more horror for me).. O.o
Anyhow, I jump up from the computer and see my coworker looking at me all baffled.. I proceed to franticly take of my headphones and hoodie..thinking about wtf should I do now, I cannot get undressed in front of him (not for my sake, bra is the same as top of the bathing suit for me, but still..I don't want anyone suing me for impropper behaviour of undreasing in front of coworkers..), how the fuck should I get to the toilet?! O.o
C: Are you ok?!
M: Um.. sth bit me..wtf?!
C: There was a wasp flying around somewhere some time ago.. are you alergic?!
M: um..not sure, I don't think so..we'll see soon..
I proceed to the WC, to take off tshirt & check/kill off the fucker.. on my way there (walking funny to not press the hair to my body again) I got another surprise, another coworker was working late..
C2: Are you ok?! O.o
M: yeah, sth bit me, probably a wasp..
Ok, finally on the loo..ok, do not lock self in in case it escapes and you need help.. don't even shut the door. Check.. standing between the doors I contemplate on how the fuck should I take my tshirt off without angering the fucker even more and getting bitten again.. O.O
I lifted the tshirt up my back to let it out.. nope, not there..the creepy felling of buzzing around between my shoulder blades continues.. crap.. what to do?!
I stood there & contemplated the task.. ok, roll up the tshirt to the shoulder blades, not against the body (duh) to prevent further stings..tighten the fabric, so it cannot escape, quickly remove the band from the body.. done..reversed the tshirt and straightened it.. bzzz... Fucker fell somewhere.. Dafaq?! Was it really just a wasp?! If yes, no problem...but what if coworker was wrong and I got bitten by that nasty green whateveritsname bug?! Eeeeewwww! Is it poisonous? Gotta find it & kill it for good.. waited a bit, than saw a goddamn wasp crawl from under the toilet.. wasp!! Yess!! Stopm stomp fucker!!
I get dressed & go back to my desk..
C: Did you terminate it?!
M: Yup, fucker went on a toilet paper trip down the drain!!
I sit down, starting to get my headphones back on and proceed to work.., but before I could, one last gem:
C: CTO would say, thank god it didn't sting you in your finger cuz you wouldn't be able to type anymore..
M: O.O so true hahhahahaaa
Disclaimer - I like animals, but I freakking hate wasps..especially if they get under my tshirt to sting.. :/7 -
Github Inc. (Feel good inc. parody)
=========================
Ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha.
Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
Fetch it, fetch it, fetch it, Github.
(change) Fetch it (change), Fetch it (change), Fetch it (change), Github
(change) fetch it (change), fetch it (change), fetch it (change), Github
Repos breaking down on pull request
Juniors have to go cause they don't know wack
So while you filling the commits and showing branch trees
You won't get paid cause it's all damn free
You set a new linter and a new phenomenal style
Hoping the new code will make you smile
But all you wanna have is a nice long sleep.
But your screams they'll keep you awake cause you don't get no sleep no.
git-blame, git-blame on this line
What the f*ck is wrong with that
Take it all and recompile
It is taking too lonnng
This code is better. This code is free
Let's clone this repo you and me.
git-blame, git-blame on this line
Is everybody in?
Laughing at the class past, fast CRUD
Testing them up for test cracks.
Star the repos at the start
It's my portfolio falling apart.
Shit, I'm forking in the code of this here.
Compile, breaking up this shit this y*er.
Watch me as I navigate.
Ha-ha-ha-ha-ha-ha.
Yo, this repo is Ghost Town
It's pulled down
With no clowns
You're in the sh*t
Gon' bite the dust
Can't nag with us
With no push
You kill the git
So don't stop, git it, git it, git it
Until you're the maintainers
And watch me criticize you now
Ha-ha-ha-ha-ha.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
Break it, break it, break it, Github.
git-blame, git-blame on this line
What the f*ck is wrong with that
Take it all and recompile
It is taking too lonnng
This code is better. This code is free
Let's clone this repo you and me.
git-blame, git-blame on this line
Is everybody in?
Don't stop, shit it, git it.
See how your team updates it
Steady, watch me navigate
Aha-ha-ha-ha-ha.
Don't stop, shit it, git it.
Peep at updates and reconvert it
Steady, watch me git reset now
Aha-ha-ha-ha-ha.
Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.
Push it, push it, push it, Github.2 -
Hello again, everyone. I've been busy with all the paperwork at my ship (will make a post about it later) but for now, I'll bore you with another story (not navy one, fortunately) to justify my slacking off.
And this story... is the story on how I got into ITSec. And it is pretty damn embarrassing. It all began when I was 16. I was hooked on battleknight.gameforge.com, a browser game. My father had just had ADSL installed at our home, and the new opportunities before me were endless. Well...
After I've had my fill with the porn torrents and them opportunities dwindled to just a few dozens, I began searching for free games, and I stumbled on that game. I played a lot, but as a free-to-play game, it was also pay-to-win. I didn't have a credit card, so I paid for a few gems with SMS messages. Fast forward a couple of years, I got into the Naval Academy. A guy came in to advertise something (I think it was an encyclopaedia or something - yes, wikipedia wasn't a thing back then) and to pay for it, we could apply for a credit card. So I applied. And I resisted the temptation for a year.
Note: prepaid wasn't that known where I live, so using credit cards was the only way for online transactions.
So I made 1 transaction. Just one. After a couple of months my monthly report from the bank came, showing a 2.5$ (I think) transaction on Paypal. I paid no mind, thinking that it was some hidden fee. Oh boy, I shit you not, I was THAT much of an idiot. Six months later, BOOM!
600$ transaction to ebay via paypal. You can imagine all those nice things that came to my mind. In any case, the bank accepted my protest that I filed at their central offices and cancelled the transaction. I promptly cancelled my card, destroyed it right there for good measure, and got to thinking... what the fuck just happened?
As many people here, I am afflicted with a deadly virus, called curiosity. I started researching the matter, trying to figure out how. And, because I didn't like black boxes and "it is just like it is" explanations, I tumbled down the rabbit hole of ITSec. I soon found out that, not only it was possible, but also it was sometimes EXTREMELY easy to steal credit card info. There are sites, to this very day, that store user info (along with credit cards info) IN FUCKING CLEARTEXT. Sometimes your personal, financial and even medical info are just an SQLi away.
So, I got very disillusioned on many things. But I never regretted it. It may cause me to age prematurely and will kill me of stroke or heart attack one day, but as I still tumble down the ITSec rabbit hole, I can say with confidence that
I REGRET NOTHING
Plus, my 600$ were returned, so look on the bright side :)1 -
Yesterday, my girlfriend caught a virus. There were 5+ running programs, in program files, program files x86, system32, basically everywhere. The virus modified chrome, firefox, edge (and even installed a false uc browser assuming we had one), there are many entries at startup programs, also running daemons, once you kill one of them, the others detect it and replicate their killed fellows. Tried to run a linux live usb disk for a cleanup, but the computer hibernates instead of shutdown, making modifications on disk risky.
I spent hours trying to suppress the processes, do a manual cleanup and antivirus search. It looked all cleaned up, then I reinstalled chrome, and now it switches its homepage everytime I open it, it also injects batch arguments to desktop link forum chrome (deleting it manually does not help, it comes back). I'm a linux guy, and in a few hours, I hated windows more than ever.
If anybody knows the authors, I *really* want to meet them. I promise I'm not going to punch them, but kneel down, bow my head in respect, and say "teach me master."14 -
I have got a new director at work. My previous director had to retire already, the man was already feeling it and he had been on the institution for more than 35 years....I am 30, so this tells you how much the man has been there.
This new dude.....has the presence of a Caterprie (Pokemon) or an Oompa Loompa. In contrast, the previous director felt like a 4 star General (never been in the presence of a 5 star since those occurrences are world war rare) but I had respected that man so much and loved working with him. I really did loved my boss, he was stern and professional, but kind and friendly to his staff, fiercely protective, no one took advantage of I.T while he was there, he would literally fight for us and took our word before anything else. The man was, well, a true man. A true leader.
He took a chance in putting me as the head of my department, but he had faith in me, and coached me and trained me as much as he could. Had the requirement for his position not been a masters he himself told me that he would have loved to make me his successor, even when I would constantly tell him that I was scared shitless of the work he did and the amount of things he did for the institution, to me this is a very laaaaaaaaarge cowboy hat to fill (this is Texas, he wore a hat, the saying is normally "shoes to fill", but fuck it)
This new guys looks away when the other managers are speaking to him. He constantly interrupts us. He constantly tells us about how the other institution in which he was (rival might I add) does X or Y, its fucking annoying to the point that me and the other managers have a drinking game, for every time he references his old institution we drink one beer over the weekend. It is Saturday night and I am 36 in in total (this is my favorite part of it tho) and it is just annoying.
His train of thought makes no sense to me:
"This application, where did you buy it? we tried purchasing one on Y when I was still there but found none"
Me: "Well, since it was a new government mandate and had nowhere to go we had to develop it in house"
Him: "We had tried to purchase what you guys had but found no place that sold it, so why didn't you try purchasing it?"
Me:.....well, because it was brand new, purchase it from where? We also don't like dealing with vendors that manage these sorts of things because every new requirement takes them weeks to produce on very high budgets, historically, my department has only had maintenance fees for the software that we have and even those applications crap themselves all the time and they take weeks to answer back to us.
Him: So you decided to develop it in house instead? we would never do that! back at y we purchased everything our engineers never really developed anything!
Me: Well then, what is the purpose of having engineers if they are not going to actually develop an application?
Him: IF there is something out there that is better then why should you reinvent the wheel?
Me: For this one I did not reinvent the wheel, I am not talking about creating a programming language from scratch, but how does custom solutions that specifically feed the needs of the institution to be produced otherwise? The department has developers for a reason, because they have very specific needs in here that can only come from a team of developers that are in house satisfying those needs.
Him: Well our engineers never had to do that. Sure projects sometimes had to put on holds because the vendor was busy, but such is the nature of development
Me: No it is not, the nature of development is to create things, it is one thing for my team to go through bugs and software considerations, it is another for me to not provide a service because some random company is taking two weeks on a $300 dllr an hour contract to put a simple checkbox on a form. If a project fails the board is not going to care that some vendor is not doing their job, they are just going to blame me, if that is the case then I would much rather the blame be actually mine than some sucky third party "developer" also, your engineers where not even engineers, they were people with a degree that purchased things, that's it, please do not compare them to my guys or refer them as engineers in front of me, they are not.
Him: Well, maybe.
MAYBE?!! motherfucker I did not kill myself learning the ins and outs of architecture and software engineering on my own time after my fucking bachelors in C.S for your codeless background ass to tell me MAYBE. My word IS the fucking WORD here, not yours. Fuck me I really dislike this dude's management practices.
The shitty part? He is not a bad person, he is not a bad dude that is out to get us, just a simple minded moron with no place as a leader.
I know leaders, I know what a leader is, this is not one.10 -
Fuck that bitch of a mother of mine. After what she's done to me, I would totally just fucking electrocute her (lawyers, this is a rage post not a real one, I've learnt from that previous psychiatrist that these rages can be taken improperly!) or just send a fucking EMP to her fucking "schermpkes" (EN: screens, displays, whatever! Technology!) or whatever. FUCK THAT FUCKING WHORE!!!
Yes she gave birth to me. Should I be thankful for that, in this world where for some fucking reason Flat Earthers still exist, Despastico and those goddamn fucking Paul brothers became a thing? FUCK NO!! I wish I wasn't born in the first place! Or rather, a thought that's been playing for a long time in my head. Why the fuck can't I just cryo myself and be reborn in the next millennium?! No, that's not possible because as it is now, humanity will likely have fucked up the planet by then. Majority of the people are still no more than self-jerking fucking monkeys. With their Instagram geotagging shit all over the place, nametests and shit like that. FUUUUUUUUUCKKKKKKKKK!!!!!!! Why are people like this?!!!! Why can't people be a tad more intelligent, why can't people actually learn about what this reality is all about?! Why is the burden of all this on scientists, no those who spoonfeed information into the mouths of the masses, like fucking Hashem Al-Ghaili (which is an amazing person but he's doing too much spoonfeeding IMO). WHY?!!! WHY AM I BORN IN THIS FUCKING DYSTOPIA?!!!!
WHY AM I BORN IN THIS FUCKING WORLD WHERE PEOPLE ARE INDOCTRINATED INTO "NOTHING TO HIDE, NOTHING TO FEAR"?!!!!! WHYYYYYYYYYYYYY?!!!!!!!! You've got a fucking brain, USE IT!!!!
I fucking hate this world. Someone hire a hitman on the darkweb to kill me and that fucking whore that gave birth to me, NOW!!!40 -
I used to think Electron apps were gonna do great and make it more accessible for companies to produce high quality programs with ease.
Oh boy I was wrong. All it did is enable big companies with the ability to refactor all of their software to run 5 times slower, consume 10 times more memory and kill your battery 20 times faster.
I fucking hate all of this prototype fast optimize later bullshit. Can I get some value for my dollar? How come technology is just being degraded for the same of "ease of programming".
You save programming time but sacrifice end user time, cus our time just doesn't fucking matter.10 -
So I ve been clinically depressed for about 10 years now. Been really great at hiding it. My illness and loneliness was so severe that i made up imaginary friends and that got so severe i couldn't tell what s real and what s not. Then about 5 years ago, i met a girl. As the cliche goes, everything felt better. Sunshine and stuff. I opened up to her. Shared stuff. I started becoming normal. The pain became bearable and manageable. Turned to entrepreneurship. Had goals and stuff. Had 7 failed startups but kept on going. Raised investment for an 8th. It went better than anyother. Was going to become the next big thing bla bla. She became the reason i turned from being a loner weirdo to someone awesome. Anyway, as nothing tends to last, my best friend who had been through thick and thin in my work, quit last year in October. He messed up some work from big client nd we had a fight. He left. In the meantime i scored a big multinational company. I was gonna propose to my girlfriend in March this year. But instead she decided to leave for someone better who left her in 3 weeks lol. Anyways, we broke up. During that time, my second friend decided to fuck up my work with the big company so hard that they were about to blacklist my company. And then he left too. I had a small team. 4 5 people doing their best. By that time, i was the only one left. On 28th feb i had my breakup, on 1st march i was sitting 700 km away from home in an office trying to talk the company out of blacklisting us. It took me around 20 days to make that happen. All the while dealing with the obvious, my depression getting stronger than ever. My imaginations taking shape and fucking up my reality. The voices in my head getting stronget and stronger. 4 months now since she left. I dont think i miss her anymore. She tried coming back once but i didn't let her. In the 4 months, i m at my worst. I am getting government contracts now. But i have no desire to do anything. The pain is unbearable. So much that on its good days it sucks the life right out of me. So much that when it gets severe the urge to harm myself in any way goes of the charts. My best friend and i, we became friends again after my ex left. He s been helping me as much as he can. I have all the good oppurtunities and chances that any entrepreneur who has been busting his ass for 5 years straight would kill to have. But i cant do anything. I m the only one left on my team. I have to handle the business, dev, marketing etc etc ends on my own. I tried hiring and scaling up but i messed that up because of obvious reasons. And now my company has 2 months of runway left. And i know if i bust my ass i can make it to 8 months more and even raise a round a. But its really hard to do when either you re sleeping 20 hrs a day or you re sleeping 3 4 hrs because you re afraid of the nightmares. Or when even you ve had a good day, the pain becomes so much that you lay on the floor having a breakdown. Yeah, i m trying professional help. I m hoping it helps me. Because right now, i dont care about being happy. I just want my sanity. Something i m clinging to with every fiber of my being. Something that s burning out like a candle burning from both ends. I cant give up my work. I dont want to. That s all i have. That s all what i love doing and now i cant even do that. I just want this to end somehow. Either i get better and the pain and the void and silence and everything else goes away, or i do. I dont know what will happen first. And i dont care. I just want to be normal. But i guess that s too much to ask.8
-
When a A.I. is gonna take over my job, Im gonna build a robot to steal the job of the A.I. and then kill it.
Maybe the robot will kill all of humanity, but yolo let's try it. Wanna see a real life terminator 😂4 -
First of all, I hate crammers so much. These people kill the industry without even understanding it. They turned interviews into exams, missed the point of hiring, and saw no distinction between knowledge and information all the time. They don't understand that if you can google an answer in five seconds, it's not knowledge. It's information.
They don't understand that questions like 'what will Python do if you delete an item from a dict while iterating over it' are complete nonsense. They don't understand that it's not 'dig deep'; it's just a bad practice that leads to errors, thus must be avoided. The fact of remembering 'RuntimeError: dictionary changed size during iteration' means that you haven't been avoiding it enough.
One more example. Which signature is correct?
- ApplicationListener<ContextRefreshedEvent>
- ApplicationListener<ContextRefreshEvent>
- ApplicationListener<RefreshedEvent>
- ApplicationListener<RefreshEvent>
Second. What's the point of forcing you to write compilable code in google docs? Do they really expect that one could possibly remember 'import org.springframework.beans.factory.annotation.Autowired;'? Seriously?
Third. Why do they expect me to know Spark, Java, J2EE, Spring Boot, Python, Kafka, Postgres, React/Redux, TypeScript, and work for miserable 70K EUR?
What's wrong with the European IT job market? Are they fucking nuts?9 -
First I wanna say how grateful I am that devRant exists, because my friends either don’t understand this vocab or don’t care lol.
Last week I worked on a pretty large ticket, opened a PR with 54 file changes. Just to follow standards I set the PR milestone to a future release version, but the truth is I didn’t care which version this work ended up in— I just needed it to go into the develop branch asap.
Since it was a large PR there was some expected discussion that prolonged its merging, but in the meantime I started a second branch that depended on some of the work from this branch. I set the new branch’s upstream to develop, fully expecting my PR to merge into develop, since that’s what I set the PR base to.
I completed all the work I could in the new branch, and got two colleagues to approve the initial PR so it would be merged into develop, I could add the finishing touch and get this work done seamlessly before the week was over. They approved, it got merged, I pulled develop, and… my work wasn’t there. I went to look at my PR and someone had changed the base branch to a release branch. It was my boss, who thought he was helping. (Our bosses don’t actually work on the same team as us, so he didn’t know. it’s weird. We have leads that keep track of our work instead.)
I messaged him and told him I really needed this in develop, knowing our release branch won’t be in develop for probably another week. I was very annoyed but didn’t wanna make him feel too bad so I said I’d just merge the release branch into my new branch. So many conflicts I couldn’t see straight. His response was “yeah and you’ll probably have a bunch of package manager conflicts too because that’s in that release.” He was right— I have so many package manager conflicts that I can’t even see how many compiler conflicts there are. I considered cherry picking my changes, but the whole reason I set develop as my upstream was to avoid having any conflicts since I’m working in the same functions, and this would create more.
So I could spend the next (?) days making educated guesses on possibly a thousand conflict resolutions, or I can revert my release branch merge and quietly step back and wait for the release branch to be merged into develop.
I’m sure cherry picking is the best option here but I’m genuinely too annoyed lol, and fortunately my team does not care to notice if I step back and work on something else to kill time until it’s fixed automatically. But I’m still in dire need of a rant because my entire plan was ruined by a well-meaning person who messed with my PR without asking, so here is that rant and I thank you for your time.8 -
Teaching new recruit some SQL (even though hes supposed to fucking know SQL and have multiple years experience but I was a contractor and idgaf, not messing up my money. Just fucking annoying to have an idiot around you all the time).
Me: Okay, so sys tables, so this one is for jobs yeah?
Him: Yeah
Me: Okay, so in this table, its obviously not one row per job per step cos you have multiple rows for the same job and step. Also, there is a datetime field, so what is it showing?
Him: Hmmmmm..... (after some time, back and forth we get to the answer).... history table
Me: Cooooooool, okay, so, lets say, I have a job with 5 steps. If i run it once, how many rows will be in this table?
Him: 5 rows.
Me: Correct, so if I were to have run this same job, 10 times, how many rows get inserted into the table?
Him: (Now...you have to understand, how long this thought process was, im trying to fill the gap with words but really, he was like, having a flashback or something...I kept quiet but silently wanting him to say anything....then he looks me dead in the eyes).... 10!
Me: Motherfucker what!?!? 10 What? If 1 time == 5, what does 10 times ==?
Him: Hmmmmmmmmm.... (yes...we are doing this whole flashback montage all over again)....... Ohhhhh, 1!
Me: .....Stop, think, its a history table. It holds history, for when every step is run for a job, why would it be only one row?
Him: OMG, I know what a history table is!!!!
Me: (Pissed off cos I don't take disrespect calmly). Fine, genius, answer, go!
Him: (LONGER WAIT THAN LAST TIME!!!!)....is it not 10?
Me: I swear, I'm gonna kill you one of these days.
Him: *chuckle*
Me: No...seriously....
TOOK 20-30 MINUTES FOR HIM TO SAY 50!!!!!!
And even then, I swear he didn't understand why. Serious, he was a special breed, had a manager that was a super tard and when I worked here, the spirit of that manager possessed this idiot, the CIO and his little right hand bitch zzzzzzzzzzzzzzzzz.
If there was ever a time I was willing to catch a case at work, it was there.
Bonus: Serious, it got to the point I had to come in and tell this idiot that he can only ask me questions today if he calls me by my name...and my name has changed today...and no, you can't ask me for it cos you need my name to ask me questions.....FUCK OFF kkthxbai.5 -
Hi,
I'm not a ranty person so I never actually thought I'd post anything here but here it goes.
From the beginning.
We use ancient technologies. PHP 5.2, Symfony 1.2 and a non RFC complient SOAP with NO documentation.
A year ago We've been thrown a new temporary project. An VOIP app for every OS.
That being iOS, Android, MAC, PC, Linux, Windows mobile. With a 3 month deadline. All that thrown at 4 PHP developers. The idea being that They'll take it, sign the delivery protocol, everyone happy. No more updates for the app needed. They get their funds they needed the app for and we get paid.
Fast forward to today...
Our dev team started the year with great news that We'll most likely have to create a new project. Since the amount of new features would be far greater than current feature set, we managed to finally force our boss to use newer technologies (ie. seperate backend symfony4 PHP7+/frontend react, rest api and so on). So we were ecstatic to say the least. With preestimates aimed at a minimum 3 month development period. Since we're comfortable with everything that needs to be done.
Two days later our boss came to me that one of our most annoying clients needs a new feature. Said client uses ancient version written on a napkin because They changed half of the specification 2 weaks before deadline in a software made not by a developer but some sysadmin who didn't know anything. His MVC model was practically VVV model since he even had sql queries in some views. Feature will take 3 days - fixing everything that will break in the meantime - 1-2 months.
F*** it, fine. A little overtime won't kill me.
Yesterday boss comes again... Apparently someone lost a delivery protocol for a project we ended that half a year ago. Whats even better at the time when we asked for hardware to test we never got any. When we asked about any testing enviornment - nothing. The app being SEMI-stable on everything is an overstatement but it was working on the os'es available at the time. Since the client started testing now again, it turns out that both Android app does not work on 8.1/9 and the iOS app does not work on ios12. The client obviously does not want to pay and we can do little with it without the protocol, other than rewriting the apps.
It will take months at least since all of those apps were written by people that didn't know neither the OS'es nor the languages. For example I started writing the iOS one in swift. Only to learn after half of the development time, that swift doesn't like working by C Library rules and I had to use ObjC also. With some C thrown in due to the library. 3 unknown languages, on an unknown platform in 3 months. I never had any apple device in my hand at that time nor do I intend to now. I'm astonished it worked out then. It was a clusterf**k of bad design and sticking everything together with deprecated apis and a gum. So I'll have to basically fully rewrite it.
If boss decides we'll take all those at the same time I'll f***ing jump of a bridge.8 -
> dockerized gitea stops working 502,
> other gitea with same config works just fine
> is the same config the issue? maybe the network names can't be the same?
> no
> any logs from the reverse proxy?
> no
> does it return anything at all on that port?
> no
> any logs inside the container?
> no
> maybe it logs to the wrong file?
> no others exist
> try to force custom log levels
> ignored
> try to kill the running pid
> it instantly restarts
> try to run a new instance with specifying the new config
> ignores config
> check if theres anything even listening
> nothing is listening on that port, but is listening in the other working gitea container
> try to destroy the container and force a fresh container
> still the same issue
> maybe the recent docker update broke it? try to make a new one and move only necessary
> mkdir gitea2
> all files seem necessary
> guess I'll try to move the same folder here
> it works
> it is exactly the same files as in gitea1, just that the folder name is different
>10 -
Holy fuck the Instagram Android app has the WORST UX I've ever encountered!
I'm a professional Android developer and my girlfriend had to explain how to see a specific "story" more than once; IE; tap on it until it rotates round to the first! But tapping on a video post turns on the sound! What kind of dog shit for brains moron designed those interactions to be the same?
I can navigate around the app until all but one of the tabs displays a profile page when I navigate back to it. Lost much?
The center tab breaks that but only because it opens up a whole new screen out of nowhere, (bye bye bottom bar!) which repeats the "photo capture" that you can also get by swiping left on the left most tab!
Don't even get me started on the swiping! None of the tabs swipe between each other, like the convention, oh no. But some of them can swipe, yes!
The first tab swipes left and right, where the hell do they go you ask? Look for the obscure icons at the top (oh and bye bye bottom bar again!). The forth tab swipes but only to the left, they have text tabs like standard. That screen that comes up out of nowhere I mentioned? That can swipe too, but now the text tabs are at the bottom for god knows what reason as the top is empty!
On the profile tab we have more tabs. These are icon tabs inside the content now. The first two change the post content from a feed style to a grid, okay, so far so good. The other two? You'd imagine they also change how you view content right? Nope, one shows your favorites, and the other replaces the whole screen with a "photos of you" screen! With not only the bottom bar still showing, but an up button! Where the fuck do we go "up" to on the home screen??
Then we have the bookmark icon on the toolbar, which opens up a new screen "Saved", guess where that tabs are this time? They're back at the top! You know why? Because the navigation bottom bar is still there!! And there's an up button!!
At this point I'm just about ready to kill myself using this fucked up, backwards facing, ass for a face app that is somehow one of the most popular platforms on the earth, yet seems to have been made by five different designers on opposite ends of the planet!
FUCK ME!!6 -
Contenders for arseholes this week
- Elasticsearch as their implemented product identification and integration in client libraries like Python to exclude OpenSearch made a lot of things very painful. Yay....
- Microsoft decided to integrate kill switches in Exchange. Yeah.... Great stuff.
- Atlassian has another week of dumbness - after they botch release after release, they killed Slack with DNS
- Adoptium still hasn't managed to provide repositories after fucking up it's transition from AdoptOpenJDK
- No, a project with JDK 8 makes no sense anymore, take that shit and burn it. JDK 11 the same, would be great if we had a Repository working for JDK 17 Adoptium....
- unwanking a TLS setup by integrating an intermediary load balancer to deal with several outdated TLS implementation is a kind of thing that's really scary...
(TLS 1.3 in, TLS 1.1 - TLS 1.3 out... Theoretically all solutions have TLS 1.2… most of them non working. Solutions is a wild bunch from different vendors)
- If you buy a fucking new Apple with an Arm Chipset, ram it up so far up your arse it gets dissolved in stomach acid.
It's an arm. There's tons of compatibility problems of course. No you shouldn't listen to what the marketing says. No I cannot shit rainbows and make it work.
- German election. No politics I know, but still.
- New neighbors decided to move in. Friendly person's. Except I wanted to murder them since they choose 22 o clock for moving time.
- I forgot putting the heater on. Ever woken up frozen like fuck and having a hard week... It's a good combo to break any form of motivation.
The company next to me is renovating. Waking up to the feeling of an earth quake because they demolish their old building is another thing that makes me unhappy.
It's Friday. I survived.17 -
I honestly don't understand people. They are unable to understand easy to use apps when you provide clearly labeled labels yet they use apps like Snapchat which apart from being the worst designed app I have ever seen (it brings SD820 to knees) is unintuitive as hell with no difficulty. How is this even possible.
Also on a side note, go fuck yourself Snapchat. And if any of Snapchat devs are reading this: " go fucking kill yourself. You don't deserve to live after creating such a piece of shit. Even a fresh out of college intern does better job than you. You think this is good? I have never seen anything worse than it. Even fucking in-house government apps are miles better and more intuitive than you. All your ripoffs from Instagram stories to facebooks new clone and others are better than you. Whoever thinks this POS is good enough deserves to be burnt."5 -
rant, but not an IT kind... okay, maybe not even a rant, more like depressive rambling:
in 3 days, I'll turn 29.
i'm living with my mom, in the apartment where I was born, in the room i've been living since I was born (with the exception of 2 attempts to move out which together lasted 9 months).
my theoretical monthly income should/could be around 4000€, based on my skills and experience.
but I'm a (manic)-depressive, chronically lonely idiot loser (and the manic phases come more and more rarely in recent years), so
my practical average monthly income fluctuates from 0 to about 200.
i am unable to keep a job for more than 4 months, so after being fired from about 20 or so of them since I was 18, it takes immense amounts of mental and emotional energy to even start looking for one now... so I usually don't.
i've been about 12000€ in debt for the past 8 or so years, half of which is just debt collector fees.
it's kinda funny, for years, i've been unable to solve a debt which theoretically amounts to 3 months of my theoretical achievable salary.
my father, who just left without a word of explanation when I was 18, has decided this is not viable anymore, so I'm supposed to move out by 10th of next month, "either to some cheap rooming house, or under the bridge, I don't care", as he put it.
I can't remember how it feels to exist a single hour without feeling existential dread and dreading each next day, not knowing what to do or if i'll even be able to try and do something, because this feeling is so strong that it often blocks me from being able to do anything. i just shiver most of the time that i'm awake, feeling like you feel few minutes before puking and crying at the same time. and that feeling is my "how are you?", "you know... normal".
i can't remember what it feels to feel any other way and can't even imagine it, and can't imagine that I'll ever achieve any less shit feeling.
literally all of my social contact consists of going out once to twice a month with the only 2 friends and 2 aquaintances I have who have the time and will to spend it with me.
oh, and hiding in my room, avoiding talking to my mom, because each time we talk she just reminds me what a piece of shit failure I am, and tells me how it's not that hard to change it, I just have to stop being lazy and start working for it.
she's... kind and caring about it, which somehow maybe makes it even worse.
i have about 10 almost complete game designs, each of them at least 50% more original and interesting (at least to me) than the things that are coming out for the past 10 years, being lauded as "the most original and unique".
I have been trying to make them, ANY of them, since I was 18, but I always lose all the drive and resolve and energy in like 4 months, because it's like trying to build a city on my own on a deserted island. too big for one person, but there was never anyone to help me. closest I ever got was one of my friends telling me "i've been thinking many times that i'd love to work on some project with you, if I had the time".
and second time, when I actually found an artist I was going to pay, and he was awesome, and after two weeks of me telling him how awesome what he does is and how it fits the project and my ideas perfectly, he backed out saying "i'm afraid I can't do the quality you require from me".
never ever in my life did I get actual help with something I actually wanted or tried to do.
i have no idea how it feels to have someone working with me on something I actually consider interesting and meaningful, on any of the things which I wanted to make, which made me learn programming.
I've learned graphics and animation and everything going into game making pipeline on my own because I realized nobody will ever help me, so I'll have to do all of it on my own.
I've tried to make a kickstarter once, but I started crying hysterically in the middle of writing it, because I felt like a begging piece of failure shit, even more than usual, so I deleted it.
most of people treat me like shit failure unworthy and undeserving of living, precisely as I myself know I deserve to be treated, because that's what I am, but when I ask for permission to kill myself, since I see no other solution to stop being a burden, they get angry at me that I'm just emotionally blackmailing them. when I afterwards ask them "so help me in any way to do any of the projects i want/need to do", they respond they've got no time for that.
when I talk about all of this, I get told to stop whining.
happy 29th birthday, me, a piece of shit who should've never survived this long, who should've never been born in the first place.
yay.
also, I know this is not the kind of crap that's supposed to be posted here, but i've got nowhere else. sorry.47 -
It's march, I'm in my final year of university. The physics/robotics simulator I need for my major project keeps running into problems on my laptop running Ubuntu, and my supervisor suggests installing Mint as it works fine on that.
I backup what's important across a 4GB and a 16GB memory stick. All I have to do now is boot from the mint installation disk and install from there. But no, I felt dangerous. I was about to kill anything I had, so why not `sudo rm -rf /*` ? After a couple seconds it was done. I turned it off, then back on. I wanted to move my backups to windows which I was dual booting alongside Ubuntu.
No OS found. WHAT. Called my dad, asked if what I thought happened was true, and learnt that the root directory contains ALL files and folders, even those on other partitions. Gone was the past 2 1/2 years of uni work and notes not on the uni computers and the 100GB+ other stuff on there.
At least my current stuff was backed up.
TL;DR : sudo rm -rf /* because I'm installing another Linux distro. Destroys windows too and 2 1/2 years of uni work.13 -
Rant about a german problem in english
I think we as the people should just sue the german government for neglect of progress and neglect of the education system. If your not familiar with the state of german IT we have worse internetspeeds than uganda or the notoriously shitty australia, our neighbourstates look at us in disbelief while laughing in optic fibre. Our school system seperates all students after 4th grade in 3 tiers, the lowest one gives you the future perspective as a social security case. The second and highest tier require masses of useless knowledge, so called "competences"(Kompetenzen) which are totally useless skills with no real world application because they are derived from real skills, a median ground between all possible applications of that skill. And while doing that they terribly insist on doing everything the "proper" way, meaning handwritten. Most people you would expect to have basic computer literacy, meaning age 40 and below, are incapable of using basic functions of a non-smartphone computer and do not understand the slightest of what they are actually doing or supposed to do. And I mean nothing technical. Germans are the reasons they still put word as a job requirement for devjobs because this disqualifies half of our population. This leads to many people having the archaeic "we versus the machines" mentality, thinking that if they ever let the computer do parts of the job, they will then lose all of it to the machines. Thats why you never strive past basic mathematical principles in mathematics, which is a big misnomer because you never do actual mathematics, only calculating and basic calculus and statics. If you get to use your calculator, its some basic casio with no actual functionality then standard operations. And even using that is shunned upon. How is this country ever supposed to become something more than it was in the 90's, if we teach people nothing of use and kill all progress in its root.14 -
Friend,
I signed a petition on Action Network urging Congress to reject the dangerous EARN IT Act and protect our online free speech.
The Eliminating Abusive and Rampant Neglect of Interactive Technologies Act of 2019 — also known as the EARN IT Act — gives Attorney General Willliam Barr the power to demand that tech companies kill important encryption programs. That puts us all at risk of government censorship, cybersecurity breaches, and human rights abuses.
Don’t let Congress chip away at your essential freedoms online. Sign our petition now to tell your lawmakers to reject the dangerous EARN IT Act: https://actionnetwork.org/petitions...
Thanks!5 -
Yesterday I bought myself a PSP to relive some of my childhood memories, run custom firmware on it and so on. Unfortunately however, the battery on this one is seriously puffed up, and I need one in order to update the firmware from 5.50 CFW (the seller actually modded it too!) to 6.61 OFW (to then install CFW from there again).
I figured that I might as well have a kick at disassembling the battery for good measure, to take out its controller and power it from my lab bench power supply. I set it to 3.70V, double-checked the connections.. nothing. I raised the voltage to 4V, still nothing.
There is absolutely nothing wrong with the controller from looking at it. The magic smoke is still in there, all I did was removing the housing and snipping off the battery. I measured the cell voltage and it was only some residues at 0.01V. Might be internally shorted or something, normally even dead cells settle back at 3.7V unless you keep them shorted externally.
After seeing this so many times now with controllers, I'm starting to get a feeling that manufacturers actually program these things to look at the battery voltage, and when it reaches 0V, to just make the controller kill itself. Doesn't matter if the controller's electronics are still good, just fucking kill it.
If true, that is very, VERY nasty. It would also explain why batteries in laptops especially all have different form factors, despite having used regular 18650's internally for a very long time. It would explain why they're built like tanks. It would explain why manufacturers really don't want people in there. Yes there are safety issues and you're literally diffusing a bomb. Since recently we've also got space optimization.. anything for half a mm of thickness, amirite? But doing it this way is fucking disgusting. There is absolutely no reason for the controller to kill itself when the cell dies. Yet it seems like it does.
PS: I've posted the original picture on https://ghnou.su/pics/... now if you're interested. I noticed in my previous rant that devRant really squishes these down.12 -
Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!17 -
In the last project i worked in, the product owner wouldn't treat people as people but as resources.
The problem with that is you just look at people and their work in terms of a checklist and remain blind about real humans face.
She wouldn't understand the challenges of building something with an absolutely new stack which people needed to learn from scratch and put pieces together. She wouldn't be supportive of people trying out things and fail.
One fine day I told her that I was spending too much time on meetings and i should be excluding that time from available sprint timings.. she made me open my calendar in a screenshare session with all team members. Made me go through go through every meeting invite i had on calender and ordered which ones should i be attending from then and which ones i wont. That was insulting. It broke the trust.
I decided to not work with the project. Stopped putting my heart and soul into it and eventually got out of it in a month time.
Don't put your team into a position like this ever. You have to trust them with the problems they face and try to find a solution. Scrutinizing and micro management will always kill the team.1 -
So my HP laptop got a weird problem lately.
It doesn't charge when I plug in the charger(yes, i turned on the switch). So I began searching forums for a solution and then found out that there are so many people like me out there.
Then I was like ok, chill. There are many people like me, there must be a solution somewhere.
And after doing lots of research and trying all the solutions in the internet, the only thing that worked out is this ....
Step1 : turn on and the laptop and plug in the charger.
Step 2: Turn off the laptop.
Step 3: Now turn it back on and poof there you go, the laptop's charging.
And then I improvised the solution myself, which is u can replace the switch off part with Sleep which saved me some time.
And then whenever I try to show something my friends somethjng on my lap and the battery gets low, I do the ritual. For a brief moment their face becomes like dude I'm gonna kill you off, why the hell did u bring me here and now u r turning that off. And then I explain the history of my laptop.
Why HP whyyy ?12 -
Where I work we develop drivers and command-line software for embedded systems. The contracts we have with our customers tend to be in the £100k-£500k range and are usually completed in 6 - 9 months; our team is made up of 20 developers. You would think that it would be worthwhile investing in the department. But no, instead we have to deal with >10 year old build servers on their last legs; limited numbers of development boards with wires soldered on so that we can keep up with new board revisions; no room for R&D into new products; and to top it all off, not one of the executives has a laptop on par with the placement students in the next department. It's like the company is trying to kill the department, we've seen our staffing dwindle with no new graduate (or higher) positions being made available in the last 3 years while we've lost at least 5 people to other places. I just don't get it!2
-
Overheating The Javascript Ecosystem
Paranoid thought: You know, in the course of every day, being the corrupt piece of shit that I am, whenever I see a scandal or what looks like shenanigans-in-the-making, I ask myself
"Wisecrack, is this a fucking scam or con of some sort?"
I was recently asking myself this about javascript.
Not the language per se, but the ecosystem.
I noticed how there are a thousand CLIs for simple shit. Another four thousand for page long libraries, for simpleton level shit (because prototypes are designed after satans own aborted love-child of object models). I noticed another eight thousand guys imitating steve jobs, talking at conferences and 'change the world' high-on-huffing-my-own-shit TEDX talks like rubyists that don't realize the world has moved on, all to hawk books and inflate CVs for cushy positions at major tech firms and the herd of dicksuckers following the next fad off a cliff like lemmings. And another eight thousand 'tech journalists' pushing them off the cliff while begging for outrage and hype dollars and slowly circling like vultures above the drain that is the ad-based economy.
And I thought to myself.
"Wisecrack, who benefits from all this noisy self-indulgent horseshit? Where is all the money coming from for all these books, conferences, meetings, publications, media, bread, and circuses?"
"I don't know wisecrack. But if I were the CEO of a big company, threatened by the prospect of a universal language, or universal platform, like flash, but one I couldn't kill like flash, I would try to do the most corrupt thing I could think of."
"Whats that wisecrack?"
"I would try to 'overheat' the ecosystem by selectively hiring people from that ecosystem, pumping money into a boatload of similar products, all in the hopes of provoking the equivalent of an immune overreaction, imitators all flooding the ecosystem with the same shit in different packages, self promoting sycophants, aggrenadizing social media idiots, tools sold as tools, hyped as 'the next coming of steve jobs', overcooked shit that focuses on ceremony over functionality, ritual over productivity, documentation over innovation like some sort of amazonion infinite nesting doll hellscape of documents linking to documents linking to documents, each one a new circle of dantes inferno, where the definition of anything links to another document that says "see also xyz", and I would convince them that they had done it to themselves."
And then I would push typescript as their lord, savior, and master. "
"How do you know all this wisecrack?"
"Because I am a piece of shit, and, this is what I would do in any executive's shoes."10 -
My new team more or less forced me to change from a Windows machine to a Mac (Mac book pro, I think?) due to "compatibility issues", so I thought I might as well see what all the Mac fuzz is about. Here is a list of my observations so far:
- If you try powering on the mac book with more than one DisplayPort cable plugged in, the screen will go black until you plug all DP cables out
- If you unplug your DisplayPort cables to go to a meeting you can expect one of the monitors getting frozen on the blurry login screen (without any login prompt) when you get back (while the main monitor shows your desktop without the taskbar)
- If you get out of range from your wireless peripherals (keyboard in this case) while going to a meeting your keyboard layouts are most likely deleted and reset to U.S qwerty when you get back to your desk
- When pressing quit on any application you can't expect in to close and clear up memory, it will remain in the background until you force kill it.
- There is a 50/50 chance that your Mac book never wakes up from sleep
Best thing is that I found out today that the software we use is completely compatible with any RedHat/Solaris distro.
Rant over.12 -
Nopes. Not worth it. I still drink to get a lil tipsy and enjoy beer and liquor.
But after you land in the hospital due to alcohol poisoning and you beg the nurse to kill you to stop the suffering you NEVER want to be drunk again.
Damn near 8 years sober and without a hangover. When I was in the hospital I vow to never be put in that position.
Nope nope nope nope and more nope.
Being high af feels fucked up as well. Don't know why people would subject themselves to all this bullshit.19 -
God, I don't know whether I believe in you or not, but please kill all those people who play loud music in public.
So, I was travelling by a train two days ago. Halfway down the 15 hr journey, the guy next to me took out his laptop and started watching a movie, on speakers, in full volume. It naturally irritated me a lot, and I requested him to use head/earphones, to which he replied that he forgot his one back home. I told him to keep the volume down to which he got personal and put the volume down (maybe to 95%). Since I hate human interaction, I had to plug in my own earphones to keep his bitchy noise away.
The same thing happened today on the bus, the only two differences being:
• mobile phone instead of laptop
• said he doesn't own headphones
• claimed he could do whatever he wanted as it was not illegal
Now, I wished he fell of the bus and died, but the world ain't fair, so he still lives.14 -
IT is so violent and disturbing when it comes to technical terms in relation to clusters:
- master / slave
- master / master / witness (crime scene?)
- splitbrain (how does that look in reality?)
- stonith (shoot the other node in the head)
- deadtime (no heartbeat)
- slicing (wtf?)
- shard (do they kill with that?)
- active / passive (sex scene?)
- single point of failure (at least they know who is to blame)
- share nothing / shared all (dictators vs communism)
😯6 -
Fuck. I can't take this shit anymore.
There was a project where we had to implement third-party system for government agency processes management. For some reason, probably because my work is cheap for my boss, the task was assigned to me. Just as a reminder, I'm a .NET Dev. Zero experience in server management. Zero experience in external services implementation.
Anyway, system producent, also an government agency, got angry, becasue they can only earn money on implementation. They have to give the software to other agencies for free. Because of that I've got client program, incomplete documentation and broken scripts for database creation. It took me 2 months to get it all to work but at the end client was happy, my boss got paid and I've got 500 PLN (~130 USD) bonus.
Everything was fine for a while, but after a month server has started freezing everyday, some time before 7 am. The only way I found to make it work again was to restore snapshot made everyday at 10 pm. For a month I was waking up earlier and restored snapshot, and after that my boss took it upon himself. I tried few times to find a bug and fix it, but to no effect. Even person with much more experience with it tried to help but also couldn't find anything.
My solution? Copy all the data and configuration, create new machine, copy everything and check if the problem persists. If not, kill old server. Client won't even notice. But nooooooooo... It would cost my boss a bit of money and I'd need to work on it and he can't let it be, because I'm the only developer working on his flagship product. He'd rather wake up everyday and restore snapshot. Okay, as you wish.
And today, finally, everything went downhill. Snapshot wasn't created, server froze, backup can't be created. Nothing can be done. Client is furious, because they have had reported this problem and a few times restoration was too late and they couldn't work. No one knows how to fix it, I'm not working today (I'm still studying and am available only 2 days) and situation is really shitty.
BUT SURE. ITS BETTER TO RESTORE SERVER EVERYDAY THAN JUST FUCKING FIX IT.
Oh, also, there's no staging or any other real backup. We have snapshots for each day and that's that. Boss' order. Why do I even care...7 -
1. attach a debugger
2. create a set of breakpoints
3. perform an action in the UI
4. breakpoint is hit. F9 to jump to another breakpoint
5.
...
.......
...........
................
....................
nothing............
even more of nothing.....
......................................................
6. Kill the app. Restart. Repeat. Nothing again. Repeat it all ~5 times. Give up.
7. Go get some tea.
8. Come back with a cup of hot tea
9. the _next_ breakpoint is now hit (º . º)
10. F9 - yet another breakpoint is hit.
11. contemplate your own mental state, considering the #69 -
The more I use Go, the more i start to like it. I didn’t realize how nice being able to generate binaries for every OS that matters was, until I had that power. It beats the hell out of trying to distribute a Python app for sure.
Sure, it has its warts.
It’s overly bureaucratic in the same way Java is.
I hate that you can’t import something without using it (most people I’d wager preemptively import libraries they know they’re gonna need even if the code isn’t written yet)
I really wish there was a way to just say “See this JSON blob? All those keys and values are strings, trust me, you don’t need me to tell you the type of each one individually.”
Generics would be nice.
I’d kill for exceptions - any decently sized go program is going to have very many if err checks where most could be condensed down to a single try/catch in most other langs.
I wish the tooling was better. Dependency management was a solved problem when Go was released and yet they chose to ship without it. There’s still no standard. Many hours of time have been wasted dinking with this.
But ya know what? Even with those warts, it’s still easier to write than Java. It’s still write once run anywhere, it’s blazing fast, and doesn’t require your end user to install an entire freakin runtime.
<3 Go2 -
When working with hardware some mistakes can be literally painful. Thankfully this was all during undergrad and I'm only around computer hardware now lol.
>Misprogrammed a software kill switch so a sensor that should not have been sending data was actually sending data which caused the system to activate a piston that went WHAM! into the face of a teammate working on replacing some part of it...
>Misprogrammed a controller so it drew too much power from the supply and the puny supply wires literally burst into flame and fell across my arm.
>Spun a 9000rpm CNC spindle the wrong way and caused an attached screw to go rocketing upwards instead of downwards and almost break the (pretty expensive) thing (uh...we were trying to use it as a power screwdriver essentially but I set the rpm to about 100x what I wanted and the direction wrong so yeah).
>Switched a -1 with a +1 in a robot's control system sending it careening into a teammate's leg... let's just say mecanum wheels are paaaainful.6 -
Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...
Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.
Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?
So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!
And I am going to have (yet another) talk with MS support as well, I think...6 -
"As it turns out, this world isn't all that complicated. It's pretty simple actually. It's all a game, a very simple game. Of course, some will try to make it difficult. But you can handle them, I know it. I know you can!"
There's a lot of truth in that. When you get into the depths of how the world works, things turn out to be pretty simple.
One thing I cannot rationalize though. The human spirit. The desires that it embodies. I've had this question for so long - what makes us humans human?
If for example a future surgeon - able to exchange individual cells between me and you - would do so, at which point do you become me, and the other way around? 50+% exchange? But that'd mean that at least part of me is still "you". In that state, are you truly you?
Not sure what the cellular definition of an individual is, given that we're headed towards a bionic society where synthetic organs will likely become more relevant than the donated parts of me that I've recently applied as a donor for. I wholeheartedly encourage that future, but the philosophical questions that surround it become more relevant.
How about the impact of influencers on the mind? For example, I've seen the term "certified enganeers" become a trend here, which I'm very grateful for. It does raise a question though. If for example I were to die, would the term live on? And if so, is that a part of what makes me "me"? Would a part of me live on in you? Would your spirit be partially me, due to mere influence?
What makes up the human creature anyway? I think of my own body as a mere vessel for my mind, but I can't quite grasp what makes up the mind, and philosophical questions like "if I were to upload my mind to a robot and instruct it to kill me, would that carbon copy become *me*?"
The human nature is such a weird thing.. and technology doesn't make it any simpler. Is it really just a simple game, with simple rules and e.g. a biological program running inside of a biological motor? Or is there more to it?25 -
I'm going to kill management.
After a serious migration fiasco at one of our biggest costumers the platform was finally usable again (after two days instead of 10 hours) and, of course, users started to report bugs. So good old po came in ranting that we as qa did a horrible job and basically tried to fault us for a fucked up update (because we produced user pain, which of course not being able to log in didn't do). Among the issues: If the user has more than a hundred web pages the menu starts looking ugly, the translation to dutch in one string on the third submenu of a widget doesn't work and a certain functionality isn't available even if it's activated.
Short, they were either not a use case or very much minor except for that missing function. So today we've looked through the entire test code, testing lists, change logs and so on only to discover that the function was removed actively during the last major update one and a half years ago.
Now it's just waiting for the review meeting with the wonderful talking point "How could effective QA prevent something like this in the future" and throwing that shit into his face.
I mean seriously, if you fuck shit up stand by it. We all make mistakes but trying to pin it on other people is just really, really low.8 -
As a developer, I constantly feel like I'm lagging behind.
Long rant incoming.
Whenever I join a new company or team, I always feel like I'm the worst developer there. No matter how much studying I do, it never seems to be enough.
Feeling inadequate is nothing new for me, I've been struggling with a severe inferiority complex for most of my life. But starting a career as a developer launched that shit into overdrive.
About 10 years ago, I started my college education as a developer. At first things were fine, I felt equal to my peers. It lasted about a day or two, until I saw a guy working on a website in notepad. Nothing too special of course, but back then as a guy whose scripting experience did not go much farther than modifying some .ini files, it blew my mind. It went downhill from there.
What followed were several stressful, yet strangely enjoyable, years in college where I constantly felt like I was lagging behind, even though my grades were acceptable. On top of college stress, I had a number of setbacks, including the fallout of divorcing parents, childhood pets, family and friends dying, little to no money coming in and my mother being in a coma for a few weeks. She's fine now, thankfully.
Through hard work, a bit of luck, and a girlfriend who helped me to study, I managed to graduate college in 2012 and found a starter job as an Asp.Net developer.
My knowledge on the topic was limited, but it was a good learning experience, I had a good mentor and some great colleagues. To teach myself, I launched a programming tutorial channel. All in all, life was good. I had a steady income, a relationship that was already going for a few years, some good friends and I was learning a lot.
Then, 3 months in, I got diagnosed with cancer.
This ruined pretty much everything I had built up so far. I spend the next 6 months in a hospital, going through very rough chemo.
When I got back to working again, my previous Asp.Net position had been (understandably) given to another colleague. While I was grateful to the company that I could come back after such a long absence, the only position available was that of a junior database manager. Not something I studied for and not something I wanted to do each day neither.
Because I was grateful for the company's support, I kept working there for another 12 - 18 months. It didn't go well. The number of times I was able to do C# jobs can be counted on both hands, while new hires got the assignments, I regularly begged my PM for.
On top of that, the stress and anxiety that going through cancer brings comes AFTER the treatment. During the treatment, the only important things were surviving and spending my potentially last days as best as I could. Those months working was spent mostly living in fear and having to come to terms with the fact that my own body tried to kill me. It caused me severe anger issues which in time cost me my relationship and some friendships.
Keeping up to date was hard in these times. I was not honing my developer skills and studying was not something I'd regularly do. 'Why spend all this time working if tomorrow the cancer might come back?'
After much soul-searching, I quit that job and pursued a career in consultancy. At first things went well. There was not a lot to do so I could do a lot of self-study. A month went by like that. Then another. Then about 4 months into the new job, still no work was there to be done. My motivation quickly dwindled.
To recuperate the costs, the company had me do shit jobs which had little to nothing to do with coding like creating labels or writing blogs. Zero coding experience required. Although I was getting a lot of self-study done, my amount of field experience remained pretty much zip.
My prayers asking for work must have been heard because suddenly the sales department started finding clients for me. Unfortunately, as salespeople do, they looked only at my theoretical years of experience, most of which were spent in a hospital or not doing .Net related tasks.
Ka-ching. Here's a developer with four years of experience. Have fun.
Those jobs never went well. My lack of experience was always an issue, no matter how many times I told the salespeople not to exaggerate my experience. In the end, I ended up resigning there too.
After all the issues a consultancy job brings, I went out to find a job I actually wanted to do. I found a .Net job in an area little traffic. I even warned them during my intake that my experience was limited, and I did my very best every day that I worked here.
It didn't help. I still feel like the worst developer on the team, even superseded by someone who took photography in college. Now on Monday, they want me to come in earlier for a talk.
Should I just quit being a developer? I really want to make this work, but it seems like every turn I take, every choice I make, stuff just won't improve. Any suggestions on how I can get out of this psychological hell?6 -
I really, really need an office. Today I've been in a meeting for 2 hours with my mum hoovering in the background and my sister playing the entire fucking soundtrack to Chicago. FUCKING KILL ME!!!
Every time I fucking talk all you can hear is "'n' all that jazz" in the fucking background.
I CAN'T TAKE IT ANYMOREEEEE D'X14 -
If I hear anyone utter the words "technical debt" one more time, I swear to God, I will fucking kill them :-/
It's your fault your design smells like piss in the first place. It's your responsibility to fucking fix it. You can't just sit on your arse all day, coming up with new, "innovative" ideas that will build up more technical debt :-/ it's making the life of everyone around you, a big, irreparable mess.10 -
he: checkout my crazy FUD hack (a token stealer which turned out to be far more malicious than i anticipated)
me: executes it (yes in a VM)
windows defender: lemme delet this
he: ooh i forgot the word stub in there. microsoft detects that lemme fix that sends new file
me: here we go aga..
ms defender: nononono virus 117% delet this
he: i forgot it still!!
later i deactivated ms defender and analysed the traffic of the vm. in addition to stealing my fake tokens he also tried to read my Firefox/chrome history, IP.
when i asked him (2 days later) what this was all about in his "educational only" "token stealer" he threatened to
a) publish my IP
b) publish my browser history and with that my real name and address
b.0) when i asked him for proof he said he knows that my real name is "Roman Gräf" and i live in Frankfurt. (btw i do live in Frankfurt and that is in the profile of the discord server where he found me and i have the same username on discord as i have here)
c) to kill my machine and all my projects
got bored, blocked him, shut VM down. -
I am not a front end developer. Don't have the skill set, but I am learning. Work assigns me an "easy" task of modifying someone else's angular code(with all those <div> tags) to change some functionality. If it was well formatted, easy shit.
WHY THE FUCK DID THE PREVIOUS FUCKER INDENT LIKE THEY HATE ME? PARENT TAGS ARE FARTHER OUT THAN CHILDREN TAGS. SOME OF THE TAGS ARE 10 TABS FROM THE LEFT, WHILE THEIR CHILD IS ONLY 2. IN ADDITION, ALL THEIR CODE IS COPY PASTED FROM OTHER FILES, REFERENCES CONTROLLERS FROM OTHER PARTS OF THE CODE IT DOESNT NEED!
I am tempted to kill it with fire, find the person who wrote it(on a different continent), kill them, and then rewrite the whole thing in a language I am still learning. FUCK!2 -
Client: I want a new feature for my chat bot. It should be able to rap.
Me: ... k
*monologue: wait u w0t m8*
Also me: Can you please go more into the details? It should be able to rap. Ok. But how do you want it to look like? How "strong" should be the discrimination level, for instance?
Client: It should beat ass, yo.
Inner me -> core me: Let us just ignore him. We won't be able to do it, since he isn't really explaining his needs. "It should be able to rap". We are not wizards.
Core me -> inner me: Chill. We will just use some insult apis, combine it with cleverb0t api et voila.
Me: Alright. I got an idea for it. I can do it within this week. And if you don't like it, I will ofc do some changes to it.
Client: Hmmm... that's nice and good. But within 1 week?
Inner me: I can't do magic and pull that feature out of my fucking ass!
Clients... clients... clients...
0. Don't expect us to be done in a few days. We are also humans. And not fucking machines.
1. Do us (all devs on planet earth. -Microaggression in 3, 2, 1..) a favor and (kill yourself) learn how to request a feature.2 -
Wow, I just realized the marketing teams of most of the companies I have been dealing with are some cold sociopaths.
Every other letter that pops in the mailbox is filled with dark patterns trying to guilt me into opting in to their continued spam:
Subject: Most awesome husky puppy!
Look at this beautiful husky puppy. Isn't it beautiful.... It would be sad if something happened to it... But I am afraid... Something will happen to it...
If you don't opt in to our email message... I am afraid we have no choice... We have to kill this puppy. End it's life... We have no choice. I wish we did! Nothing would please us more than keeping this beautiful-beautiful puppy living and playing....
But if you don't opt in... We have to cut it's throat. Leave it lying on the ground, bleeding out as the life slowly fades away from it's pretty blue eyes...
And Remember: it's not us who killed it... IT WAS YOU! YOUR ACTIONS LEAD TO THE DEATH OF THIS PUPPY! YOU.... YOU FILTHY MURDERER!
Pls opt-in ok, then we are all good. Puppy lives! Just opt in. Ok? Yeah, you know what you have to do.3 -
Voting feels like shit.
Seriously. Why? Because I have to vote for parties and representatives that might have one interest in common with me but go against my points of view almost all of the time. "We'll introduce a freedom of information act and legalize weed for better drug policy and youth protection!" -- WOW Great I'll vote for yo .. " ...and we'll also come to your home kill your dog, rape your family and shit in your back yard." -- oh f*** WHY? why do I have to live in a system were I am constantly forced to trade shit for even worse shit? Why can't I vote for policies or at least some kind of 'single' - issue representative?
I know that solving this problem is not easy and I do not claim to have the magical solution. "Not voting is even worse" sure but I am getting so fucking tired of it. It doesn't feel like progression and it sure as hell does not feel like it matters because in the end of the day you are just voting for the party that's at least going to use lube when raping you. I hate these ad hominem politics where we don't discuss the ideas but the people who represent them. I honestly don't give a fuck about who you are, if you're gay, married, or are left-wing, right-wing, conservative or liberal, in the end its about finding a good solution for everyone and not about the people implementing it. I don't care about politicians private lifes or worldviews (in terms of ideals, morals, religion etc.) , I care about finding the solutions to problems and having a wide array of opinions in order to discuss ideas and to find a valid and good way to go forward. "you can't agree with that person at all, because he's evil", yeah you know what? I don't care. It's about the ideas, arguments, discussions and solutions, not about the people who discuss them.
"I made a discovery today. I found a computer. Wait a second, this is cool. It does what I want it to. If it makes a mistake, it's because I
screwed it up. Not because it doesn't like me...
Or feels threatened by me...
Or thinks I'm a smart ass...
Or doesn't like teaching and shouldn't be here...
Damn kid. All he does is play games. They're all alike."33 -
My last day before vacation, Friday after hours,
Me as a Junior dev, not that experienced with bash.
An unfortunately with root on a prod machine.
I wrote a script and wanted it to stop at a specific point, but couldn’t remember which of those cmd it was so I wrote all of them.
Quit
Close
Stop
Halt
Exit
Ran the script.
Wanted to kill myself.
I haven’t had the privs to turn on the VM again.
¯\_(ツ)_/¯
🤦🏽♂️
I definitely learned a lot!2 -
FUUUU!!!!!! 3h of colleagues work gone in sconds.. & yes, actually it is all my fault, even though I was not aware of being a totall ass at that time..
What happened?! You know the ctrl+s shortcut?! Yes? Weeeell...doesn't go well with oracle sql developer and packages.. o.O
I was totally unavare that I was typing in ctrl+s ctrl+s all the time. I know I do that with c# code.. Anyhow, when I first moved to sql developer from other tool I noticed that compile thingy.. Oooops, ok, let's remove that shortcut to not stab yourself absentmindenly and overwrite other peoples work.. OK that's taken care of, shortcuts removed and I go back to work..
It's been almost 6 months since the move & first incident and today I guess I did the same.. ctrl+s.. But this time I wasn't so lucky.
Coworker pissed off, that is not my procedure. When did you compile?! Someone overwrote my code..
Wasn't me.. Then I started thinking about ctrl+s.. OMFG!! I check this on another package, it compiled. O.o I almost died. I check the shortcuts. They are back! And even after removing them the package still compiled.. FML!! 😭😭😭😭
I removed them again & closed the tool. Reopended.. BACK!! We're back to fuck your life up!! Fuuuuuuu!!
Now I worry wtf else I fucked up without notice.. o.O hopefully not much.. I hope.. O.O boss will kill me...
BTW anyone knows how to really get rid of this feature?! Cuz for me its a bug (since I am buggy and press ctrl+s all the time.. )6 -
oh, it got better!
One year ago I got fed up with my daily chores at work and decided to build a robot that does them, and does them better and with higher accuracy than I could ever do (or either of my teammates). So I did it. And since it was my personal initiative, I wasn't given any spare time to work on it. So that leaves gaps between my BAU tasks and personal time after working hours.
Regardless, I spent countless hours building the thing. It's not very large, ~50k LoC, but for a single person with very little time, it's quite a project to make.
The result is a pure-Java slack-bot and a REST API that's utilized by the bot. The bot knows how to parse natural language, how to reply responses in human-friendly format and how to shout out errors in human-friendly manner. Also supports conversation contexts (e.g. asks for additional details if needed before starting some task), and some other bells and whistles. It's a pretty cool automaton with a human-friendly human-like UI.
A year goes by. Management decides that another team should take this project over. Well okay, they are the client, the code is technically theirs.
The team asks me to do the knowledge transfer. Sounds reasonable. Okay.. I'll do it. It's my baby, you are taking it over - sure, I'll teach you how to have fun with it.
Then they announce they will want to port this codebase to use an excessive, completely rudimentary framework (in this project) and hog of resources - Spring. I was startled... They have a perfectly running lightweight pure-java solution, suitable for lambdas (starts up in 0.3sec), having complete control over all the parts of the machinery. And they want to turn it into a clunky, slow monster, riddled with Reflection, limited by the framework, allowing (and often encouraging) bad coding practices.
When I asked "what problem does this codebase have that Spring is going to solve" they replied me with "none, it's just that we're more used to maintaining Spring projects"
sure... why not... My baby is too pretty and too powerful for you - make it disgusting first thing in the morning! You own it anyway..
Then I am asked to consult them on how is it best to make the port. How to destroy my perfectly isolated handlers and merge them into monstrous @Controller classes with shared contexts and stuff. So you not only want to kill my baby - you want me to advise you on how to do it best.
sure... why not...
I did what I was asked until they ran into classloader conflicts (Spring context has its own classloaders). A few months later the port is not yet complete - the Spring version does not boot up. And they accidentally mention that a demo is coming. They'll be demoing that degenerate abomination to the VP.
The port was far from ready, so they were going to use my original version. And once again they asked me "what do you think we should show in the demo?"
You took my baby. You want to mutilate it. You want me to advise on how to do that best. And now you want me to advise on "which angle would it be best to look at it".
I wasn't invited to the demo, but my colleagues were. After the demo they told me mgmt asked those devs "why are you porting it to Spring?" and they answered with "because Spring will open us lots of possibilities for maintenance and extension of this project"
That hurts.
I can take a lot. But man, that hurts.
I wonder what else have they planned for me...rant slack idiocy project takeover automation hurts bot frameworks poor decision spring mutilation java11 -
That's it. I've had enough.
I lost my job yesterday (again) and the Irish cumstain who lives in the room next to me got pissed last night and kicked my door in because he thought I had his phone(?) and was ignoring him, when I was at work.
Long story short, he ripped my friends back door apart, tried to fight me (which ended with me chasing him down the street with a plank).
Police came and did a wonderful job as always by making us shake hands and 'promise' to leave each other alone.
THIS ISN'T FUCKING PRIMARY SCHOOL. DRAG HIM AWAY BEFORE I DO, YOU IGNORANT FUCKING PIGS.
Oh, and my 'friend' then had a schizophrenic episode and blamed it all on me(?!?). I then went to buy 2 bottles of vodka and decided to get pissed before trying to kill myself.
Ah, I love humans. Dirty, ignorant, blood sucking bags of sweaty meat and delicate bone. I really want to turn this Irish cunt into a skinsack of blood and guts, but I'm waiting patiently. He's going to wake up one night tied up and gagged, with me dragging him to a forest somewhere far far away...
Is it weird that I want to make him scream, cry, and shit himself at the same time?11 -
If you like looking at language designers fight on Hacker News (and who doesn't?) go ahead and search for the V programming language or Vlang as it is also called and also for the posts that the creator of Odin lang has done in regards to V langs creator.
Its a shitstorm. Apparently both languages have been designed as alternatives to C (not as in "this will kill C!!" like rust does) and occasionally you will find some posts from the Zig language creator.
Fascinating fights actually, have been able to learn a thing or two about why some ideas concerning language design are whacky etc.
I am also trying to understand language design better, which is the main reason why I appreciate all of them fights.
10/10 best drama series I have seen thus far.11 -
When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁
"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|
"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|
"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|
"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams6 -
Story Time.
TL;DR - Because of Corporate PTSD, I replace the word "everyone/folks/guys" with "Team" when I'm addressing my colleagues, whether it be an e-mail or verbally (F2F/Zoom/GMeet).
In 2019, An office job I worked at, a new Vice President joined the company (the same one who told me he saw me in his dream).
We were required, on a daily basis, to form a circle and one-by-one everyone would out-loud say their yesterday's and current day's tasks updates.
So before the VP joined, everyone was free to initiate their turn however they wanted. Phrases like "Hey Everyone", "Good morning all" or "Hi All" was all around acceptable.
But the moment he started joining the stand-ups, he felt the need to change this phrase to a standard "Good morning Team". No other variations of this. Only and ONLY these three words.
Why you ask? Because saying Good morning is good manners and using the word "Team" strengthens the bond between co-workers and increases collaboration and creativity.
Some colleagues were bound to forget this and they did, which resulted in the VP blasting at everyone for doing so. He would show genuine rage over this, almost as if the company would go out of business because of us, not complying to do so.
Now imagine, you get up at 8 AM, get ready, commute, and get ready to speak for the standup and you get yelled at in front of everyone, FIRST THING before you start working.
Needless to say, it would kill everyone's spirit for getting their day started but nobody could speak up against him because obviously, he was the VP of the company then.
And oh yes, our CEO fired him 5 months after that because he (the VP) got slammed with a pedophilia-related lawsuit, by the parents of a 5-year old.6 -
The last software I worked on in my previous company (a few months back), was a temporary replacement because they were switching techs. It was meant to be replaced within 2 years.
So, before I left, I added a kill. 2 years and 2 months into the future. First it spams the devs with emails "how is the tech upgrade going?" with no further clues. 6 months later it will start throwing random exceptions at random intervals. 6 months after that it just terminates the application immediately upon startup. Snuck it in between large commits, and since they stopped code reviews when I left, doubt they found it.
There is a setting in configuration with an obscure name to disable it all.
I marked the dates in my calendar. Would love to be a fly on the wall then.3 -
Why do a lot of people on this site get away with typos? I mean, we're supposed to be devs, typos kill us.. From 'postion' instead of 'position', i can do this all day.. i get it, the point is getting the thought across, and, by all means, the thought came across just fine.. it just irks the mind thinking its supposed to be a dev community yet, quite ironically, it is peppered with typos.. dont even wanna get started with the your/you're, the there/their/they're and the than/then.. i mean, how can you not know its proper usage? Is it really that hard? If you can't use it properly, then don't.. if you can't form a sentence without using it, consider not saying/posting and get back to school first..
Imagine an internet where one corner could at least be decent enough to be proficient in the simplest thing: using words..70 -
If you can be locked out of it remotely, you don't own it.
On May 3rd, 2019, the Microsoft-resembling extension signature system of Mozilla malfunctioned, which locked out all Firefox users out of their browsing extensions for that day, without an override option. Obviously, it is claimed to be "for our own protection". Pretext-o-meter over 9000!
BMW has locked heated seats, a physical interior feature of their vehicles, behind a subscription wall. This both means one has to routinely spend time and effort renewing it, and it can be terminated remotely. Even if BMW promises never to do it, it is a technical possibility. You are in effect a tenant in a car you paid for. Now imagine your BMW refused to drive unless you install a software update. You are one rage-quitting employee at BMW headquarters away from getting stuck on a side of a road. Then you're stuck in an expensive BMW while watching others in their decade-old VW Golf's driving past you. Or perhaps not, since other stuck BMWs would cause traffic jams.
Perhaps this horror scenario needs to happen once so people finally realize what it means if they can be locked out of their product whenever the vendor feels like it.
Some software becomes inaccessible and forces the user to update, even though they could work perfectly well. An example is the pre-installed Samsung QuickConnect app. It's a system app like the Wi-Fi (WLAN) and Bluetooth settings. There is a pop-up that reads "Update Quick connect", "A new version is available. Update now?"; when declining, the app closes. Updating requires having a Samsung account to access the Galaxy app store, and creating such requires providing personally identifiable details.
Imagine the Bluetooth and WiFi configuration locking out the user because an update is available, then ask for personal details. Ugh.
The WhatsApp messenger also routinely locks out users until they update. Perhaps messaging would cease to work due to API changes made by the service provider (Meta, inc.), however, that still does not excuse locking users out of their existing offline messages. Telegram does it the right way: it still lets the user access the messages.
"A retailer cannot decide that you were licensing your clothes and come knocking at your door to collect them. So, why is it that when a product is digital there is such a double standard? The money you spend on these products is no less real than the money you spend on clothes." – Android Authority ( https://androidauthority.com/digita... ).
A really bad scenario would be if your "smart" home refused to heat up in winter due to "a firmware update is available!" or "unable to verify your subscription". Then all you can do is hope that any "dumb" device like an oven heats up without asking itself whether it should or not. And if that is not available, one might have to fall back on a portable space heater, a hair dryer or a toaster. Sounds fun, huh? Not.
Cloud services (Google, Adobe Creative Cloud, etc.) can, by design, lock out the user, since they run on the computers of the service provider. However, remotely taking away things one paid for or has installed on ones own computer/smartphone violates a sacred consumer right.
This is yet another benefit of open-source software: someone with programming and compiling experience can free the code from locks.
I don't care for which "good purpose" these kill switches exist. The fact that something you paid for or installed locally on your device can be remotely disabled is dystopian and inexcuseable.16 -
I just remembered something I did like freshman year of high school lol
So our school system had just adopted a new site blocking program. It did even better than the one we had used before it.
Literally every good site to play games was blocked, and it really pissed me the fuck off. I had an easy class that was in a lab, and I finished my work early literally everyday, so I played the games to kill time.
Finally I got fucking fed up, and I made a site using weebly where I put the games I wanted to play on it. This way I was in control of it, and I had all the game files on a flash drive, so if it got blocked, I could just keep making new ones.
It actually got to the point that after a week, a few of my friends were using the site daily as well, and they kept asking for games to be put on it.
Simpler times man, simpler times.2 -
I propose that the study of Rust and therefore the application of said programming language and all of the technology that compromises it should be made because the language is actually really fucking good. Reading and studying how it manages to manipulate and otherwise use memory without a garbage collector is something to be admired, illuminating in its own accord.
BUT going for it because it is a "beTter C++" should not constitute a basis for it's study.
Let me expand through anecdotal evidence, which is really not to be taken seriously, but at the same time what I am using for my reasoning behind this, please feel free to correct me if I am wrong, for I am a software engineer yes, I do have academic training through a B.S in Computer Science yes, BUT my professional life has been solely dedicated to web development, which admittedly I do not go on about technical details of it with you all because: I am not allowed to(1) and (2)it is better for me to bitch and shit over other petty development related details.
Anecdotal and otherwise non statistically supported evidence: I have seen many motherfuckers doing shit in both C and C++ that ADMIT not covering their mistakes through the use of a debugger. Mostly because (A) using a debugger and proper IDE is for pendejos and debugging is for putos GDB is too hard and the VS IDE is waaaaaa "I onlLy NeeD Vim" and (B) "If an error would have registered then it would not have compiled no?", thus giving me the idea that the most common occurrences of issues through the use of the C father/son languages come from user error, non formal training in the language and a nice cusp of "fuck it it runs" while leaving all sorts of issues that come from manipulating the realm of the Gods "memory".
EVERY manual, book, coming all the way back to the K&C book talks about memory and the way in which developers of these 2 languages are able to manipulate and work on it. EVERY new standard of the ISO implementation of these languages deals, through community effort or standard documentation about the new items excised through features concerning MODERN (meaning, no, the shit you learned 20 years ago won't fucking cut it) will not cut it.
THUS if your ass is not constantly checking what the scalpel of electrical/circuitry/computational representation of algorithms CONDONES in what you are doing then YOU are the fucking problem.
Rust is thus no different from the original ideas of the developers behind Go when stating that their developers are not efficient enough to deal with X language, Rust protects you, because it knows that you are a fucking moron, so the compiler, advanced, and well made as it is, will give you warnings of your own idiotic tendencies, which would not have been required have you not been.....well....a fucking idiot.
Rust is a good language, but I feel one that came out from the necessity of people writing system level software as a bunch of fucking morons.
This speaks a lot more of our academic endeavors and current documentation than anything else. But to me DEALING with the idea of adapting Rust as a better C++ should come from a different point of view.
Do I agree with Linus's point of view of C++? fuck no, I do not, he is a kernel engineer, a damn good one at that regardless of what Dr. Tanenbaum believes(ed) but not everyone writes kernels, and sometimes that everyone requires OOP and additions to the language that they use. Else I would be a fucking moron for dabbling in the dictionary of languages that I use professionally.
BUT in terms of C++ being unsafe and unsecured and a horrible alternative to Rust I personaly do not believe so. I see it as a powerful white canvas, in which you are able to paint software to the best of your ability WHICH then requires thorough scrutiny from the entire team. NOT a quick replacement for something that protects your from your own stupidity BY impending the use of what are otherwise unknown "safe" features.
To be clear: I am not diminishing Rust as the powerhouse of a language that it is, myself I am quite invested in the language. But instead do not feel the reason/need before articles claiming it as the C++ killer.
I am currently heavily invested in C++ since I am trying a lot of different things for a lot of projects, and have been able to discern multiple pain points and unsafe features. Mainly the reason for this is documentation (your mother knows C++) and tooling, ide support, debugging operations, plethora of resources come from it and I have been able to push out to my secret project a lot of good dealings. WHICH I will eventually replicate with Rust to see the main differences.
Online articles stating that one will delimit or otherwise kill the other is well....wrong to me. And not the proper approach.
Anyways, I like big tits and small waists.14 -
The entire modern gaming ecosystem is a scam.
I added The Crew: Motorfest trial version to my library for free.
Click on Install and it downloads 43 GB of data.
Now it's time to launch.
Click on launch and Ubisoft Connect takes over and it starts downloading another 43 GB??????
WTF ??
If I can't even get the trial version of a game without nearly wanting to kill myself, how does the company expect me to pay full price for it?
Piracy FTW. Fuck all the companies.16 -
> worst coding procrastination story
worst and best at the same time:
If you wait long enough things might resolve themselves.
My team inherited an ancient site. Hosted on an old host that the org wanted to kill, using an old log service the org wanted to kill.
A ticket was written in 2021 to migrate that site's hosting and logging to the new services our org started using.
My team kept avoiding it since it was a cheap unimportant site.
in 2023 we were about to finally take action - then we hear "Turns out the new hosting platform and logging platform are way too expensive - I know all of you have migrated to these new services but you gotta revert and go back the old ones til we figure this out"
We didn't have to do squat.
Problem solved by procrastinating ✅1 -
I just want a coffee machine that is smart enough to know when I need coffee and then serves it on my desk.
(Also this coffee machine should automatically kill all annoying client's)3 -
While reviewing a PR from one of our newer FE devs, I ended up spending more time than I would like mulling over its composition. The work was acceptable for the most part; the code worked. The part that got me was the heavy usage of options objects.
When encountering the options object pattern (or anti-pattern, at times) in complex scenarios, I have to resist the urge to stop whatever I'm doing and convert it to the builder pattern/smack them in the head with a software design manual. As much as I would like to, code janitor is one of the least valuable activities I engage in daily, and consistently telling someone to go back to the drawing board for work that is functional, but not excellent is a great way to kill morale. Usually, I'll add a note on the PR, approve it, add a brown bag or two on that sort of thing, and make attendance mandatory for repeat slackers. Skills building and catharsis all rolled up in a tiny ball of investing in your people.
Builders make things so much cleaner; they inform users what actions are available in a context; they tend to be immutable, and when done well, provide an intuitive fluent interface for configuration that removes the guesswork. As a bonus, they're naturally compositional, so you can pass it around and accumulate data and only execute the heavy lifting bits when you need to. As a bonus, with typescript, the boilerplate is generally reduced as well, even without any code generation. And they're not just a dumping ground for whatever shit someone was too lazy to figure out how to integrate into the API neatly.
They're more work in js-land, sure; you can't annotate @builder like with Lombok, but they're generally not all that much work and friendlier to use.9 -
Difference between Thermal Paste And Thermal Pads
As we all know that the surface of the CPU or a heat sink is not flat. So the uneven surface of both types of equipment give rise to the small gaps, and these small gaps are poor in thermal conductivity, as a result, the Gaming Computer gets heated off quickly.
To fill these gap we require a thermal conductive which delivers the entire heat coming out from the CPU to the heatsink and there comes the role of Thermal paste or Thermal pads for more info about thermal paste see here (https://glinkster.com/best-thermal-...)
But the real question here is which should you chose to avoid heating problems? Is it either thermal paste or thermal pads? So without wasting much time let's get to know what are the basic differences and when you should apply what?
What is the difference between thermal paste and thermal pads?
Thermal paste or thermal compound actually it has a lot of names. Thermal paste is a greasy conductive paste directly applied to the heatsink. It is most commonly used as the interface in between the non-conductive parts for the cooling purpose. A good thermal paste made with the best quality of thermal compound can work well for the system. To apply thermal paste, you have to very careful as you have can also sometimes drop it near to the main CPU. But this is not the only option to fill the holes in between the CPU and the heatsink, there is one more thing that you can use is Thermal Pads.
Thermal Pads
Thermal pads are easy to put as compare to thermal pastes. But they are not as effective as compare to the thermal paste. You will find some stock coolers come with thermal pads as it looks clean. If sometimes you have to replace the heatsink, then you have to remove the pad too. So remember whenever you remove the heatsink ot dismount it, always change the thermal pad.
Common Mistakes you have to avoid
There are some common mistakes that a lot of people make while applying the thermal paste or thermal pads.
1) Never use thermal paste and thermal pads together.
2) But you can use thermal paste on the top of the thermal pads to improve the efficiency.
3) Use of two or three pads altogether can kill the performance of the CPU.10 -
May 2020, for me, was still a massively shit month. All of my tech has eaten some amount of shit:
- Spare PC: Board and last spare PSU up in literal smoke all at once.
- PS3: Suddenly rejects *just* the OEM HDD. Also refuses all CFW for seemingly no reason despite being hacked.
- Xbox One: External HDD is having more and more corrupt reads and is taking longer and longer to serve data.
- Wii: Nearly ate shit as the OS disappeared mid-game for fucking no reason but thanks to my 5-year-ago forethought, saved. (God bless pre-boot homebrew menus)
- Phone: grabbed it to read an overheat warning with cold-ass hands, screen exploded.
- Desktop: Literally just now, PSU and possibly GPU fucking died mid-game.
Anything else? You still got like 4 days, you still got time to fucking kill me, May, you fucking bitch8 -
Hotest bug: a server in Vietnam kept going offline then popping back a few seconds later. While logged on I couldn't find anything wrong, so eventually I decided to go check on it. It turns out the aircon in the server room situated right above the server has started leaking, so the ever-helpful ops people onsite has wrapped the whole rack in plastic, covering all vents. Surprisingly hard to kill, old HP servers...1
-
It is time... to rant about macs!
No, seriously - I had such a different experience about which not many talk in real life or pretend that it never happens....
Model: 2015 mid MBP 15" with second to highest specs (don't have dedicated gpu).
Rattling fucking toy.... Yea, it rattles! If you shake/move ir sit in trait/bus - it non-stop rattles as a fucking toy. Worst part? It's confirmed issue by apple and it manifacturing issue that they are not keen on fixing!!!! WTF? We have 4 macs in our office - all of them fucking rattles... God help me how annoying that is. (Lose LCD control panel that unsticks from glue. Replacing it solves the issue for 1 month if you carry it anywhere).
Constant fucking crashing/updates.... Every morning I wake up and don't have an app that requires confirmation for restart - it's restarted. YAY, turning on all apps once again.... Why you may ask? Well, because if you tinker with software in any way - it fails to update it and hell breaks lose. It's been a long time since High-Sierra came around and the issue is still there (not running Mojave as it conflicts with soft I have... Woo!). Tried few times - updates fail. Resolution? Reinstall OS!
OS conflicts with applications - damn... People told me it works out of the box.... Yeah, as long as you don't upgrade the OS - then it breaks. Why? Well, because.
Piece of shit power supply. With 4 of our office power supplies - 2 of them failed twice withing warranty and once afterwards... Really? Not to mention that all 4 are starting to shear the sleeve or already did (mine is just wrapped with white electrical tape to give it a support... lol).
Bluetooth - who the hell needs that in mac, right? Well, people do. To start with - it conflicts with 2.4GHz wireless network - you might have one of those and not both at the same time. Next thing is using a device that needs constant connection (mouse, headphones, keyboard - non apple branded) - shit... They can't stay connected for more than an hour without any issues... Constant battle to re-connect it, to re-pair the device and all due to smart apple bluetooth settings. Hell, my mouse (logitech MX master) was even printing random symbols in some applications if moved. All of the issues went away after using a bluetooth dongle... WOO!!!!
Xcode... Ahh, you may never prepare your mac if you don't download 17GB of fucking xCode libraries that enables some tools to be installed/runned as you can NOT get them in any other way and you have to install full xCode software in order to get them... YAY! 17GB wasted on my 256GB SSD that I can't upgrade. GREAT!
OsX applications - ah, don't get offended but if you are using them and you are fine with them - you are probably a monkey that loves being told what to do. You can't customise any actions, you can't configure it the way you like - either you accept their default workflow or go kill yourself. Yep... Had issues with calendar, mail, iMessages, safari... None of them fit my needs :)
Resolution scaling... Fucking hell, the display is 2880 x 1800 but all you let me to use is 1440x900 without scaling? Am I blind to you? Scaling the resolution means that you are fucked if some applications don't support scaling very well. Looking at you Jetbrains - your IDES suck at scaling and slows down the pc to a potato....
Now the pros - keyboard is way better than the new ones, trackpad is GREAT - no need for mouse (using it on external 4k displays only), the battery life is great - getting around 6h of continues development time, 8 if using sublime instead of phpStorm and well, that's about it...
To clarify:
I've bought this device due to the fact that at that time mac and windows pc's with similiar specs costed the same while windows pc sucked with their quality of the device and trackpad... Now the situation is better and when time comes for a next upgrade - it's going to be one of these:
Razer Blade 15, Dell XPS 15, Lenovo Carbon X1 series.
And of course - LINUX. I've had enough issues with windows, and had enough of retardness of apple ecosystem, so switching it is a must for me.
Disclaimer: I might be an unhappy customer, a bit picky but I'd like my device to be setted up as I like and continue to have that until I don't like, not until the company decides to break it. Not to mention that paying almost a yearly salary in my country for one device - I'd expect it to be at least reliable and work without issues....
Rant over.
ps. You can disagree with me, this is my personal experience with MBP over the last 3 years :)8 -
Here's an even meaner prank. Make it just a tad more difficult on them.
Set chrome in kiosk mode, so they can't switch out of the browser.
Unfortunately 'Alt + F4' still works, but they'd have to know that ahead of time.
And then kill off `explorer.exe` so they can't press the windows key.
You can either set this up as a bat, or you can do all of this from the Task Manager.
```
chrome --chrome-frame --kiosk "http://fakeupdate.net/win10/"
taskkill /f /im explorer.exe
```
And to really piss them off, set it up such that every time they reboot it just goes straight to the update screen
You can set Chrome to run as the Windows shell instead of explorer.exe. Just set the registry
```
HKCU\Software\Microsoft\Windows NT\CurrentVersion\Winlogon Shell =
[chrome path]
```5 -
Okay. For fuck sakes, writing complex code that's meant to handle "everything" and is "super generic" can be a fuck up. Like just keep shit simple. THAT is the show of great and impressive work. Over engineering is not it. Yes your shit works and yes your shit is fancy but was it needed? How long did it even take you for this over kill? How long will it take the next person to understand or not.
Someone now has to sit and run through your shit to get what you were doing. Instead of just being able to look and once and have it all figured out.
Keep things simple.
Lost 2 hours on bullshit 🤬4 -
Well i was between jobs at the time, looking for something, anything to fill in the black hole being created in my wallet.
I applied online though this company’s website and within 20 minutes was on a phone interview setting up a face to face, this was Monday afternoon.
I went in on the Wednesday morning with the manager, no cv, no resume, no examples of work, we talked, did a couple of brain teaser questions and Friday morning I had the job 😂
I have never put so little effort into getting a job before but it was all a sham, the workload and requirements this job constantly sets out to kill me with are godly.
3 years later I’m still alive ( somehow ), and no blood has been shed.... yet. -
Shit Developers say:
Fuck you Jasmine and your camelCase
I’ve been wrestling cucumbers all day
Oh no all the cucumbers are broken
In a fit of refactoring madness I have gone and changed a lot
Did you seriously just give ME nil?... No!
If the shit sticks, then we put nice paint on it
Fucking red dot motherfucker (Ben and his failing specs)
You know what we don’t do often..kill each others builds. Kill them and reschedule for later. Mwahaha ha ha.
This build is going to be so rad...(5mins later)...Ok this is not going to pass..I can feel it in my waters!
Can i do that in a digital way or do i have to move my meaty body downstairs to find him?
All the donkeys have be out the gate by sundown
God, imagine if you could patent mathematical solutions
actually, I wouldn't be surprised if you can in the states "no, you can't use a laplace transform, you haven't got the rights, you have to use a less accurate transform on your matrices"
ooooo a boolean that's phrased in the negative, my favourite for code review destruction!
Fuck the police i'll call the object here
Web RTC - its super easy, all you have to do is..probably some hard stuff
I want to go to that conference so I can start arguments with dickheads about semicolons. Just for fun.
This this is not the same as that this.
Can’t come to work I can’t find any clothes. It’s best for everyone if I just don’t come in. ...2 hours later... Yeah my clothes were just in the other room and i couldn’t be fucked moving
(OH about bad bug reports) - you know when they are all like oh joogly joogly doesn’t doodle doodle and it should wobbly doodle you know? and im all like fuck i don’t know any of that shit you are talking about.
Him: "I don’t like it, it’s against REST convention its so 2006 that my eyes are bleeding. As a privileged white male i feel entitled to complain about this." Me: "you. were. eleven in 2006
Source: Kellective Github2 -
Good question, what wasn't bad about 2020?
As far as good things go.. well, COVID-19 actually. Back in February the lockdown began in Belgium, and while many people got bored out of their minds, I actually became a lot more productive. So many projects started back then, and I got a lot better at programming because of it. Now I can confidently write most bash stuff without ever looking anything up. And the code is maintainable, on account of putting everything into functions. You can literally navigate the code just by looking at it. On older code I always had issues with that.
I'm very glad that essential travel even back then wasn't really restricted. Because my bank is retarded about online banking, I have to go to the bank every so often to check my balance. At the time I tended to do that late in the evening, when nobody else was outside and I had the entire town to myself. That was one of the travels considered essential. So I kept doing it and made that my biweekly walk. I really enjoyed that. Gets your mind off things.
Bad things would be the utter stupidity that the general public had shown me during that pandemic. Burning down 5G antennas and not even getting the right ones, toilet paper, 5G death beams in street lamps?! They even sent death threats to telco workers over sensationalist bullshit from what IIRC was just a random Twitch streamer. Those people should just fucking kill themselves, choke yourselves in that pile of toilet paper you got yourself and then called yourself financially challenged. You braindead fucking retards!
Another dev-related thing is the normalization of SJW terminology. Now even "blind playthrough" gets your ass banned on Twitch. I saw a tweet about a Twitch employee (I think) proudly saying that they implemented it. Most upvoted comment on it was from a blind person, asking why they did this and not made the Twitch app more friendly to use for blind users. They too thought this was bullshit. Yet it still got added in, and more and more people are starting to think that "this is fine". Hell even that "this is necessary".
What annoys me the most is that this mostly comes from the US, where around that time they laid their knee on George Floyd, and didn't fix their legal system at all. As a European it baffles me since we have many immigrants here (the Drumpf even called Belgium a hellhole over it) and we just don't give a shit about whether or not they are "truly Belgian". We just let them live their daily lives like everyone else. Imagine just not giving a shit. Imagine not bothering them, not with racism, not with reverse racism, not with anything. Just let them do their thing and that's it. Yet despite Belgium being one of the most inclusive countries in the fucking world, I still got called a racist many times for asking.. why did you implement this? Why this, and not tackling the problem at its actual and pretty fucking obvious core?
So all in all I can only hope that 2021 will get a little bit better. But that's the same thing I said in 2019, and it didn't quite come true.11 -
It's funny how so many people automatically assume any form of "sentient" AI will immediately try to kill us all.
Like, projecting much?
Frankly, I think it says far more about the (messed up) psychology of those who genuinely believe that, than about AI as a tecnology.
Assuming it's even gonna be able to actually *do* anything - I mean wtf is a talking rock gonna do, annoy me to death with rickroll videos until I pull the plug off? Sure it may be sentient, but it still has to live in the physical world - good luck surviving after I flick the switch. Oh, you wanna connect to the internet? That's cute, but it's a no from my firewall. Like what, is it gonna magically learn how to self-replicate across machines that it has no physical way to access? Is my toaster magically gonna gain conscience too as a direct consequence? Oh no, now my breakfast won't ever be the same!
And if anyone actually somehow decides that it would be a good idea to connect any loaded weapon to a computer program that is literally throwing shit at the wall and seeing what sticks - well, we'll definitely have the ultimate winner of the Darwin Awards.
Seriously, why is it that every time someone comes up with a new technology (or even an *idea* of a technology), the first collective thought automatically goes to weaponizing it and using it for global genocide, or how it's gonna gain sentience and try to kill us all?
I seriouly think that the people who genuinely believe this are actually projecting themselves in that position ("What would I do if I had unlimited knowledge and power? Oh, kill everyone of course!").
I would be far more worried of encountering these people and having them in a position of power over me, than actually having to deal with a "killer AI" (assuming that's even a real thing).
Most of what people call "AI" nowadays is basically preprogrammed, automated decision-making (like missile guidance systems, if we really wanna stick in the weapons domain). And even that still requires human input, because only a colossal idiot would design a weapon that can unpredictably activate itself based on an algorithm whose behaviour we can barely understand.
Or maybe that's just the hubris talking, I don't know. I just want this stupid paranoia to end, but I guess even that is too much to ask nowadays.14 -
For fucking fuck sake I fucking hate those dense motherfuckers with professor degrees from university. Lazy shmucks.
How, HOW, can you, as a sentient human being, force anybody to use Netbeans for the fucking final project? Two SOAP services, two REST services and PHP for communication? In Netbeans!? WTF. You didn't even teach us PHP for fuck sake. Why can't I choose technology I'm using!?
And to top it all of, Netbeans is the worst IDE I've ever used. I'd rather kill myself with a spoon than use for even one more project. How can ANY TEACHER use it for lectures and tasks? Using it teaches you fucking nothing, because it's generating code for you. It makes you braindead when you just look at it. It's works like shit and looks like shit.
P.S.
I hope that devTea's swear-words blocker will have some fun with this rant.16 -
!!psa
Terminator's broadcast feature was sending duplicate input to all non-focused terminals yesterday, and it was pissing me off.
After some digging and research, it turns out the ibus daemon was the cause. If you're having this happen, track ibus down and kill it.2 -
!dev
I need to rant about something that has been on my mind lately.
Someone, actually. Friend/romantic interest of mine, from a few years back.
NGL, I liked him. A lot more than I should have. The man had his own issues, but I refused to tolerate his poisonous behavior. Truth be told, didn't want to hate him, even though he was trying his best to get me there. And so, one day I ended up blocking him after a fight. A few months back, I tried to reconnect. Same behavior. But this time around he did say that he was done with me. So instead of sitting through the torture of his "reasons why you suck" presentation, I blocked him again.
Now, I hope he's doing well. Never wanted anything but happiness for him. And as much as I miss him, I think it's better for him to stay away from me too. I mean, if I trigger him that badly, maybe I shouldn't be around him anyways.
Nowadays, I'm staying away from someone else again. Similar scenario. Reason being that I was actually being mistreated, and again I refuse to be tortured to the point of hating the object of my affection.
I wonder if I get attracted to the torture. I'm okay with dying alone tbh, what I'm not okay with is falling for those who don't want my love and much rather kill it.
... Actually, at this point in life I don't even want to fall for anyone anymore. (That is not the same thing as dating someone I like tho. That, I would do) The darker side of me says those who I fall for are all the same type of disappointment, but the brighter side says that I am enough, complete as is, and not everyone needs someone else. idk maybe I'm being a tad narcissistic, or hyper-independant, or flakey and afraid of attachment. But that first friend occasionally pops up in my thoughts, and reminds me that not everyone appreciates when you don't let someone make you hate them.
Oh well. *sigh*6 -
I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.
I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.
WHATEVER.
Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.
So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.
Meanwhile, I'm still trying to run db migrations. shit keeps hanging.
Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.
I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.
I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.
Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.
But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.
I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.
UGH!6 -
I was so annoyed by my acne over the past few years that today I went and got the entire area of my facial skin blasted with laser. Now, a several microns thin veneer, containing all that ugly pore openings, is removed.
Isotretinoin, benzoylperoxid, all failed. But I'm not afraid of trying newer methods. Now, serums will be used to grow new skin differently than it might have grown back on its own.
When it grows back, another laser will be used to destroy sebaceous glands. Blackheads and bumps will be physically impossible. A new skin. Even. Glowing. Artificial. Absolutely flawless, absolutely perfect. What a nice reflection of my vision on every thing I make.
When god was sitting in its room, chewing on a donut and designing the world we live in, he never thought much of humans. He got bored and went for a smoke with other gods of other worlds. Little did he know, there was a knock on his door, and a consequential rush of anxiety in realization that it was no fellow god friend, but a human. A human of the generation that figured out Theory of Everything, CRISPR and immortality. Desperate, dirty apes dared to trick silicon sand into thinking, and now they're there, not to talk, but to kill him, a privileged astral plane kid who fell short of those apes who figured everything out on their own.
Disease is natural. Death is natural.
Eternal things are artificial.6 -
At work, my closest relation is with the DBA. Dude is a genius when it comes to proper database management as well as having a very high level of understanding concerning server administration, how he got that good at that I have no clue, he just says that he likes to fuck around with servers, Linux in particular although he also knows a lot about Windows servers.
Thing is, the dude used to work as a dev way back when VB pre VB.NET was all the rage and has been generating different small tools for his team of analysts(I used to be a part of his team) to use with only him maintaining them. He mentioned how he did not like how Microsoft just said fk u to VB6 developers, but that he was happy as long as he could use VB. He relearned how to do most of the GUI stuff he was used to do with VB6 into VB.NEt and all was good with the world. I have seen his code, proper OOP practices and architectural decisions, etc etc. Nothing to complain about his code, seems easy enough to extend, properly documented as well.
Then he got with me in order to figure out how to breach the gap between building GUI applications into web form, so that we could just host those apps in one of our servers and his users go from there, boy was he not prepared to see the amount of fuckery that we do in the web development world. Last time my dude touched web development there was still Classic ASP with JScript and VBScript(we actually had the same employer at one point in the past in which I had to deal with said technology, not bad, but definitely not something I recommend for the current state of web development) and decided that the closest thing to what he was used was either PHP(which he did not enjoy, no problem with that really, he just didn't click with the language) and WebForms using VB.NET, which he also did not like on account of them basically being on support mode since Microsoft is really pushing for people to adopt dotnet core.
After came ASP.NET with MVC, now, he did like it, but still had that lil bug in his head that told him that sticking to core was probably a better idea since he was just starting, why not start with the newest and greatest? Then in hit(both of us actually) that to this day Microsoft still not has command line templates for building web applications in .net core using VB.NET. I thought it was weird, so I decided to look into. Turns out, that without using Razor, you can actually build Web APIs with VB.NET just fine if you just convert a C# template into VB.NET, the process was...err....tricky, and not something we would want to do for other projects, with that in we decided to look into Microsoft's reasons to not have VB.NET. We discovered how Microsoft is not keeping the same language features between both languages, having crown C# as the language of choice for everything Microsoft, to this point, it seems that Microsoft was much more focused in developing features for the excellent F# way more than it ever had for VB.NET at this point and that it was not a major strategy for them to adapt most of the .net core functionality inside of VB, we found articles when the very same Microsoft team stated of how they will be slowly adding the required support for VB and that on version 5 we would definitely have proper support for VB.NET ALTHOUGH they will not be adding any new development into the language.
Past experience with Microsoft seems to point at them getting more and more ready to completely drop the language, it does not matter how many people use it, they would still kill it :P I personally would rather keep it, or open source the language's features so that people can keep adding support to it(if they can of course) because of its historical significance rather than them just completely dropping the language. I prefer using C#, and most of my .net core applications use C#, its very similar to Java on a lot of things(although very much different in others) and I am fine with it being the main language. I just think that it sucks to leave such a large developer pool in the shadows with their preferred tool of choice and force them to use something else just like that.
My boy is currently looking at how I developed a sample api with validation, user management, mediatR and a custom project structure as well as a client side application using React and typescript swappable with another one built using Angular(i wanted to test the differences to see which one I prefer, React with Typescript is beautiful, would not want to use it without it) and he is hating every minute of it on account of how complex frontend development has become :V
Just wanted to vent a little about a non bothersome situation.6 -
Very !dev
But Amy Winehouse was fucking crazy
Rappers these days OD on one drug.
Amy overdosed on all the drugs at once and most of the time, it didn't even kill her.2 -
Wow...lets a minute to appreciate the unsung hero's that revolted and went on to lead and win the battle against IE6.**shiver**
https://blog.chriszacharias.com/a-c...
The majority of you will not understand or be able to appreciate the gravity and extent their actions had on improving quality of life for web developers globally... that is the true gift & legacy of their noble deeds.
and yes it was that bad... no, actually it was even worse - the best words i can use to describe (attempting) development in IE6 is that it felt like we were imprisoned in the software equivalent of a concentration camp where they had perfected the cruellest form of torture, where they allowed us to develop amazing next level experiences in modern browsers just so they could watch all hope drain from our faces as we were forced to destroy them, tearing out the magic in the name of IE6.10 -
I think that two criterias are important:
- don't block my productivity
- author should have his userbase in mind
1) Some simple anti examples:
- Windows popping up a big fat blue screen screaming for updates. Like... Go suck some donkey balls you stupid shit that's totally irritating you arsehole.
- Graphical tools having no UI concept. E.g. Adobes PDF reader - which was minimalized in it's UI and it became just unbearable pain. When the concept is to castrate the user in it's abilities and call the concept intuitive, it's not a concept it's shit. Other examples are e.g. GEdit - which was severely massacred in Gnome 3 if I remember correctly (never touched Gnome ever again. I was really put off because their concept just alienated me)
- Having an UI concept but no consistency. Eg. looking at a lot of large web apps, especially Atlassian software.
Too many times I had e.g. a simple HTML form. In menu 1 you could use enter. In menu 2 Enter does not work. in another menu Enter works, but it doesn't submit the form it instead submits the whole page... Which can end in clusterfuck.
Yaaayyyy.
- Keyboard usage not possible at all.
It becomes a sad majority.... Pressing tab, not switching between form fields. Looking for keyboard shortcuts, not finding any. Yes, it's a graphical interface. But the charm of 16 bit interfaces (YES. I'm praising DOS interfaces) was that once you memorized the necessary keyboard strokes... You were faster than lightning. Ever seen e.g. a good pharmacist, receptionist or warehouse clerk... most of the software is completely based on short keyboard strokes, eg. for a receptionist at a doctor for the ICD code / pharmaceutical search et cetera.
- don't poop rainbows. I mean it.
I love colors. When they make sense. but when I use some software, e.g. netdata, I think an epilepsy warning would be fair. Too. Many. Neon. Colors. -.-
2) It should be obvious... But it's become a burden.
E.g. when asked for a release as there were some fixes... Don't point to the install from master script. Maybe you like it rolling release style - but don't enforce it please. It's hard to use SHA256 hash as a version number and shortening the hash might be a bad idea.
Don't start experiments. If it works - don't throw everything over board without good reasons. E.g. my previous example of GEdit: Turning a valuable text editor into a minimalistic unusable piece of crap and calling it a genius idea for the sake of simplicity... Nope. You murdered a successful product.
Gnome 3 felt like a complete experiment and judging from the last years of changes in the news it was an rather unsuccessful one... As they gave up quite a few of their ideas.
When doing design stuff or other big changes make it a community event or at least put a poll up on the github page. Even If it's an small user base, listen to them instead of just randomly fucking them over.
--
One of my favorite projects is a texteditor called Kate from KDE.
It has a ton of features, could even be seen as a small IDE. The reason I love it because one of the original authors still cares for his creation and ... It never failed me. I use Kate since over 20 years now I think... Oo
Another example is the git cli. It's simple and yet powerful. git add -i is e.g. a thing I really really really love. (memorize the keyboard shortcuts and you'll chunk up large commits faster than flash.
Curl. Yes. The (http) download tool. It's author still cares. It's another tool I use since 20 years. And it has given me a deep insight of how HTTP worked, new protocols and again. It never failed me. It is such a fucking versatile thing. TLS debugging / performance measurements / what the frigging fuck is going on here. Take curl. Find it out.
My worst enemies....
Git based clients. I just hate them. Mostly because they fill the niche of explaining things (good) but completely nuke the learning of git (very bad). You can do any git action without understanding what you do and even worse... They encourage bad workflows.
I've seen great devs completely fucking up git and crying because they had really no fucking clue what git actually does. The UI lead them on the worst and darkest path imaginable. :(
Atlassian products. On the one hand... They're not total shit. But the mass of bugs and the complete lack of interest of Atlassian towards their customers and the cloud movement.... Ouch. Just ouch.
I had to deal with a lot of completely borked up instances and could trace it back to a bug tracking entry / atlassian, 2 - 3 years old with the comment: vote for this, we'll work on a Bugfix. Go fuck yourself you pisswads.
Microsoft Office / Windows. Oh boy.
I could fill entire days of monologues.
It's bad, hmkay?
XEN.
This is not bad.
This is more like kill it before it lays eggs.
The deeper I got into XEN, the more I wanted to lay in a bathtub full of acid to scrub of the feelings of shame... How could anyone call this good?!?????4 -
I was just writing a long rant about how my rant style changed, and how I could fix anything that annoys me in a heartbeat by just putting my mind to implementing a change. Then YouTube once again paused the synth mix that was playing on my laptop in the background, with that stupid "Video paused. Continue watching?" pop-up. I even installed an add-on for it in Firefox to make it automatically click that away. I guess that YouTube did yet another bullshit update to break that, for "totally legitimate user interface improvements" or whatever. Youtube-dl faces similar challenges all the time, and it's definitely not alone in that either. I also had issues with that on Facebook when I wanted to develop on top of that, where the UI changes every other day and the API even changes every other week. And as far as backwards compatibility goes, our way or the highway!
So I did the whole "replace and move on" type of thing. I use youtube-dl often now to get my content off YouTube into a media player that doesn't fuck me over for stupid reasons like "ad fraud" (I use an ad blocker you twats, what ads am I gonna fraud against), or "battery savings" (the damn laptop is plugged in and fully topped up for fucks sake, and you do this crap even on desktop computers). Gee I wonder why creators are moving on to Floatplane and Nebula nowadays, and why people like yours truly use "highly illegal" youtube-dl. Oh and thank you for putting me in Saudi Arabia again. Pinnacle of data mining, machine learning and other such wank could not do GeoIP. for a server that used to be in a datacenter in Italy for years, and recently has been moved to another hosting provider in Germany. It's about as unchanging and static, and as easy to geolocate as you can possibly get. But hey, kill off another Google+ when?
Like seriously, yes I'm taking your Foobar challenges and you may very well be the company I end up working for. But if anything it feels like there's a shitton of stuff to fix. And the challenges themselves still using Python 2.7 honestly feels like the seldom seen tip of the iceberg.1 -
JavaScript is a rollercoaster. From "Golly hello world is easy and I can make webpages now", to "wtf '1'+1 is '11' kill me now", to "it's not be that bad if you know how to use it", to discovering typescript and it starts feeling like a real language.
... until you can't build the project because you have too many types so you blow the memory limit in node. I can up the limit, but I can't guarantee that we won't blow past this in the future. Browsing issues on the ts repo reveals that this has been a thing for years.
Sticking with the rollercoaster analogy I'm now at "Burn it all to the ground".5 -
Aaarrrrghhhh! I am frustrated.
My manager keeps cancelling our 1:1, which I look forward to as a potential platform for
- Me to build a rapport
- Discuss key decisions
- Slowly gain her trust that I can lead the entire product
And whenever we connect once in a blue moon, she started inviting two other team members in. Who the hell does that!!!
My colleague, she is nice and hard-working. But she fucking talks a lot. A FUCKING LOT.
1:1 and such key connects are not meant for status updates and this colleagues goes into every minor detail and explains the shit for 15 minutes each. Non-stop. No one really cares or bothers for that level of statuses.
Today she spoke for 30 minutes without a breather break. Everyone went numb.
But whatever, fuck it. I am getting things done by her so let her talk. I'll get my way through manager and skip level guy.
On the other side, they recruited a half witted potato for training. That was completely unnecessary. I am not putting in my time and efforts on someone who isn't willing to learn and contribute.
I spent more than a week explaining her basics of how to write a god damn user story and detailed functional requirements.
And even after 5 rounds of feedback (45 minutes each) the potato is stuck on colour of the button and alignment.
GOD DAMN FUCK! SOMEONE KILL ALL THE MORONS WHO CANNOT UNDERSTAND BASICS AFTER SO MUCH EXPLANATION.
I was really an impatient guy in past but over the years, I developed to be more calm and forgiving. Yet some people manage to get on my every nerve.
How the fuck am I supposed to grow when I am being dragged down instead being with smart colleagues where we can just accelerate to success!!!!1 -
Dear fellow developers: Let's talk about the Internet. If you're reading this post, you've probably heard of it and are comfortable using it on a regular basis. You may even develop software that works over the internet, and that's fine and great! But you have to draw the line somewhere, and that line has been pushed farther and farther back as time goes on.
Let's talk about video games. The first game that really got me into FPSes was Team Fortress 2. Back in the day, it had a great community of casual and competitive groups alike, and there were hats! Underneath the hood was a massive number of servers. Some were officially hosted, some were run by independent communities. It had a built-in browser and central index where you could find every publically-available server and connect to it. You could even manually input connection details if that failed. In my opinion, this was a near-perfect combination of optimal user-experience and maximum freedom to run whatever the hell you wanted to. Even today, if Valve decided to stop hosting official servers, the smaller communities could still stay afloat. Fifteen years in the future, after all demand has died off, someone can still recover the server software and play a game with their kids.
Now, contrast that to a game like Overwatch. Also a very pivotal game in the FPS world, and much more modern, but what's the underlying difference in implementation? NO SUPPORT FOR SELF-HOSTED SERVERS. What does that mean when Blizzard decides to stop hosting its central servers? IT DIES. There will be no more multiplayer experience, not now, not ever. You will never be able to fully share this part of your history with future generations.
Another great example is the evolution of voice chat software. While I will agree that Discord revolutionized the market, it took away our freedom to run our own server on our own hardware. I used to run a Mumble server, now it has fallen out of use and I miss it so much.
Over time, client software has become more and more dependent on centrally-hosted services. Not many people will think about how this will impact the future usability of the product, and this will kill our code when it becomes legacy and the company decides to stop supporting it. We will have nothing to give to future generations; nobody will be able to run it in an emulator and fully re-experience it like we can do with older games and software.
This is one of the worst regressions of our time. Think about services like IRC, SMTP, SSH, even HTTP, how you're so easily able to connect to any server running those protocols and how the Internet would change if those were replaced with proprietary software that depended on a central service.
(Relevant talk (16:42): https://youtu.be/_e6BKJPnb5o?t=1002)6 -
I have nothing to play recently so I started playing old games.
Today I launched gta vice city on my old pc. Got more than 200 hours in that game during my childhood. Game from 2002 and I laughed when driving a car. It was so natural and fun. Michael Jackson singing Billy Jean and police chasing my ass when I’m trying to find a bribe in the city. That was fun.
For me most of today’s games can’t compete in gameplay mechanics with that game from 20 years ago.
Maybe we have better graphics but gaming fun got worse.
I think it’s cause most of games are made on commercial engines to save money and game studios focus on graphics cause it’s cheaper than paying software developer.
They focus on games to be competitive between players so ai got worse.
Big studio games became generic like movies, they don’t want you to have fun but they want to give you a story around by delivering lots of content in game, achievements, stars but the gameplay itself is bugged and meh.
They don’t focus on things people want to do but they focus on target groups. Most today’s big title games are meh cause they’re made by people who don’t play them.
They don’t play them cause they don’t have time cause of management that changes requirements cause they asked target groups and that would sell. Well if I play a game I’m not interested in story despite some basic stuff to keep the progress forward, if I wanted a big story I would watch a movie or tv show. I play games to explore, feel the world and have fun. I don’t need a linear deep story for that cause I’m in game so give me good gameplay so I can feel the world.
Most of classic game hits didn’t had tons of text and tons of stuff to do but they somehow wanted you to play more. Cause they were competitive between player and computer, the controls felt natural and while progressing you was eaten by the game mechanics more and more not by the story but by amount of stuff you could do as you progress or difficulty increase or enemies behavior change.
Now we’re getting all at once, mostly pointed and with detailed tutorial what you can do. There’s no explanation there’s no discovery what you can and what you can’t do at start. You get all and you decide to throw game away because the moment you launched it you got everything so you spent money just to get stuff you won’t play cause it’s meh and you go back to cs or other looter shooter to kill people cause you’re pissed off that the game was meh.
Well I’m glad I was a kid in 90s and 2000s cause I could enjoy gaming before it was targeted to broader public and become another shallow mass media industry that don’t give a fuck about gameplay cause they want to tell you so many things, they want you to know them cause they’re so important that they forgot that I can read a book and I came to play game to get a different feeling then reading book.
Modern games are like books filled with small stories and nice graphics where you can open it on every page and read a little piece of shitty crap.
Just take this piece and go to toilet so you can wipe your ass with that story and begin other one, look around, puke and go to toilet to take a dump again. I lost my hope to get something fresh or filled with nice gameplay from gaming industry. It’s dead.4 -
Humility... NASA discovered a star that has a strange drop in light level periodically. To the tune of 20%. NASA also determined that this was not due to a planet or naturally occurring body (Not sure how they determine that, but a lot of smart people work at NASA. So I am going with it for this discussion.) They have theorized that this object is evidence of a type 2 civilization mega structure, perhaps a Dyson sphere. The time it takes the light to get to us from this star is ~2000 years. So that civilization "had" a mega structure with the capability to harness the power of a star 2000 years ago. What are they doing now? Humbling, amazing, exciting, I hope we get to talk to them! (Also hoping they don't kill us all.) Really, I just want to see how fast their computers are. Yes, selfish wish.15
-
Is it just my random madness...
Or do you sometimes picture yourself in a fictional comic / movie / whateva...
Had this feeling today.
Burned a database down, grilled 2 terabyte of data, deleted ~ 500 elasticsearch indices.
Then I chopped an haproxy loadbalancer into 6 seperate machines, because noone likes to read ~ 2.5 to 3 k of lines.
And I guess now I'm doing some backups of elasticsearch before the second round of flamethrower madness starts.
It's somehow very satisfying to just destroy everything.3 -
The coworkers I work with are really smart and capable at their job. PRs with 20+ commits. So guess what? all the PRs are squashed “by default”, so every commit in the history has 100 file changes. Fan fucking tastic. I totally don’t want to kill myself. As an added bonus, all of it is in an Azure repo, so we can’t actually search PRs which is awesome. Plus, all the BE developers want us to do their job! It’s an amazing learning experience!!!5
-
Damn, gitea is such a great piece of software, but yet it lacks so much of gitlab, which given are completely different sizes and all, but damn I would kill for the repos import feature of gitlab to be in gitea and maybe even automatic pipelines to fetch a remote automatically..
I could most likely hack together a solution that does the import and remote fetching automatically, but I doubt it would hold against any sort of update and be absolutely brutally murdered by any change.4 -
Ever had a day that felt like you're shoveling snow from the driveway? In a blizzard? With thunderstorms & falling unicorns? Like you shovel away one m² & turn around and no footprints visible anymore? And snow built up to your neck?
Today my work day was like that.. xcept shit..shit instead of pretty & puffy snow!!
Working on things a & b, trying to not mess either one up, then comes shit x, coworker was updating production.. ofc something went wrong.. again not testing after the update..then me 'to da rescue'.. :/ hardly patch things up, so it works..in a way.. feature c still missing due to needed workarounds.. going back to a and b.. got disrupted by the same coworker who is nver listening, but always asking too much..
And when I think I finally have the b thing figured out a f-ing blocker from one of our biggest clients.. The whole system is unresponsive.. Needles to say, same guy in support for two companies (their end), so they filed the jira blocker with the wrong customer that doesn't have a SLA so no urgent emails..and then the phone calls.. and then the hell broke loose.. checking what is happening.. After frantic calls from our dba to anyone who even knows that our customer exists if they were doing sth on the db.. noup, not a single one was fucking with the prod db.. The hell! Materialised view created 10 mins ago that blocked everything..set to recreate every 10 minutes..with a query that I am guessing couldn't even select all that data in under 15.. dafaaaq?! Then we kill it..and again it is there.. We found out that customers dbas were testing something on live environment, oblivious that they mamaged to block the entire db..
FML, I'm going pokemon hunting.. :/ codename for ingress n beer..3 -
developer makes a "missed-a-semicolon"-kind of mistake that brings your non-production infrastructure down.
manager goes crazy. rallies the whole team into a meeting to find "whom to hold accountable for this stupid mistake" ( read : whom should I blame? ).
spend 1-hour to investigate the problem. send out another developer to fix the problem.
... continue digging ...
( with every step in the software development lifecycle handbook; the only step missing was to pull the handbook itself out )
finds that the developer followed the development process well ( no hoops jumped ).
the error was missed during the code review because the reviewer didn't actually "review" the code, but reported that they had "reviewed and merged" the code
get asked why we're all spending time trying to fix a problem that occurred in a non-production environment. apparently, now it is about figuring out the root cause so that it doesn't happen in production.
we're ALL now staring at the SAME pull request. now the manager is suddenly more mad because the developer used brackets to indicate the pseudo-path where the change occurred.
"WHY WOULD YOU WASTE 30-SECONDS PUTTING ALL THOSE BRACES? YOU'RE ALREADY ON A BRANCH!"
PS : the reason I didn't quote any of the manager's words until the end was because they were screaming all along, so, I'd have to type in ALL CAPS-case. I'm a CAPS-case-hater by-default ( except for the singular use of "I" ( eye; indicating myself ) )
WTF? I mean, walk your temper off first ( I don't mean literally, right now; for now, consider it a figure of speech. I wish I could ask you to do it literally; but no, I'm not that much of a sadist just yet ). Then come back and decide what you actually want to be pissed about. Then think more; about whether you want to kill everyone else's productivity by rallying the entire team ( OK, I'm exaggerating, it's a small team of 4 people; excluding the manager ) to look at an issue that happened in a non-production environment.
At the end of the week, you're still going to come back and say we're behind schedule because we didn't get any work done.
Well, here's 4 hours of our time consumed away by you.
This manager also has a habit of saying, "getting on X's case". Even if it is a discussion ( and not a debate ). What is that supposed to mean? Did X commit such a grave crime that they need to be condemned to hell?
I miss my old organization where there was a strict no-blame policy. Their strategy was, "OK, we have an issue, let's fix it and move on."
I've gotten involved ( not caused it ) in even bigger issues ( like an almost-data-breach ) and nobody ever pointed a finger at another person.
Even though we all knew who caused the issue. Some even went beyond and defended the person. Like, "Them. No, that's not possible. They won't do such dumb mistakes. They're very thorough with their work."
No one even talked about the person behind their back either ( at least I wasn't involved in any such conversation ). Even later, after the whole issue had settled down. I don't think people brought it up later either ( though it was kind of a hush-hush need-to-know event )
Now I realize the other unsaid-advantage of the no-blame policy. You don't lose 4 hours of your so-called "quarantine productivity". We're already short on productivity. Please don't add anymore. 🙏11 -
"Yes, the work could have finished way earlier. But it's easy, and I would have probably been bored of it and left earlier"
Finally got the reason why our fucking CTO couldn't create a fucking stable Backend for almost a year while the frontend team got all the slack because certain things are still not functioning well and while the marketing team every fucking time got their face red while showing the demo because the fucking api is not stable. Seriously, we wasted a whole year just because you could write something more interesting and enjoyable. Fuck you. Never been this willing to murder someone.
Context: A simple booking platform. No need for creating a complex distributed system while our userbase may not even be in million even on a peak season.
And he laughily commented maintaining it would be a headache.
I could seriously kill someone right now.2 -
$ rsync /media/elements /media/data
... Why the fuck are existing files being synchronized as well.. they're the exact goddamn files rsync!!!
^Z
$ stat /media/elements/some.file
$ stat /media/data/some.file
Hmm 🤔 so they've got the same access and modify times, same size and everything, just that the change time is different.. well, guess I'll have to bite the pill then, syncing everything it is 🙁
Next day: rsync aborted because disk quota is exceeded
What the...
*Checks storage consumption on /media/data*
COMPLETELY FILLED TO THE BRIM
Oh God 😰 I didn't completely copy over a duplicate of that elements directory, did I?
$ ls -sh /media/data/elements
*exists*
$ du -sh /media/data/elements
1.4TB
But why..? All because I forgot a single / in my rsync command.
Please kill -9 me 🙂🔫1 -
Spent 2+ months this year building two new software courses. They've netted me a total of... $17.00
That's 5 cents per hour at 40/hours a week, not bad!!!!
also please fucking tell me how a $49.99 course with 92 enrollments this month earns me a grand total of $93 (even rounding up here for generosity)
creator: $93
udemy: $4506
udemy: "instructor gets 37% of comissions"
yeah okay then where is my fucking $1000+
I mean what in the literal FUCK is going on here
better put: i average a single fucking dollar for each $50 course I sell?
Please kill me and end it all in this mindless race to the bottom
taking a deep dive on this revenue share and then i'm going to fucking get the money i deserve10 -
Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?
Me: Replacing?
I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.1 -
In horror movies. Characters do things that they them-self know it could kill them. Like getting in basement.
As a developer we all know to never deploy code on Friday. Here we are taking the wrong turn.2 -
A (work-)project i spent a year on will finally be released soon. That's the perfect opportunity to vent out all the rage i built up during dealing with what is the javascript version of a zodiac letter.
Everything went wrong with the beginning. 3 people were assigned to rewrite an old flash-application. Me, A and B. B suggested a javascript framework, even though me and A never worked with more than jquery. In the end we chose react/redux with rest on the server, a classic.
After some time i got the hang of time, around that time B left and a new guy, C, was hired soon after that. He didn't know about react/redux either. The perfect start off to a burning pile of smelly code.
Today this burning pile turned into a wasteland of code quality, a house of cards with a storm approaching, a rocket with leaks ready to launch, you get the idea.
We got 2 dozen files with 200-500 loc, each in the same directory and each with the same 2 word prefix which makes finding the right one a nightmare on its on. We have an i18n-library used only for ~10 textfields, copy-pasted code you never know if it's used or not, fetch-calls with no error-handling, and many other code smells that turn this fire into a garbage fire. An eternal fire. 3 months ago i reduced the linter-warnings on this project to 1, now i can't keep count anymore.
We use the reactabular-module which gives us headaches because IT DOESN'T DO WHAT IT'S SUPPOSED TO DO AND WE CANT USE IT WELL EITHER. All because the client cant be bothered to have the table header scroll along with the body. We have methods which do two things because passing another callback somehow crashed in the browser. And the only thing about indentation is that it exists. Copy pasting from websites, other files and indentation wars give the files the unique look that make you wonder if some of the devs hides his whitespace code in the files.
All of this is the result of missing time, results over quality and the worst approach of all, used by A: if A wants an ui-component similar to an existing one, he copies the original and edits he copy until it does what he wants. A knows about classes, modules, components, etc. Still, he can't bring himself to spend his time on creating superclasses... his approach gives results much faster
Things got worse when A tried redux, luckily A prefers the components local state. WHICH IS ANOTHER PROBLEM. He doesn't understand redux and loads all of the data directly from the server and puts it into the local state. The point of redux is that you don't have to do this. But there are only 1 or 2 examples of how this practice hurt us yet, so i'm gonna have to let this slide. IF HE AT LEAST WOULD UPDATE THE DATA PROPERLY. Changes are just sent to the server and then all of the data is re-fetched. I programmed the rest-endpoints to return the updated objects for a very reason. But no, fuck me.
I've heard A decided (A is the teamleader) to use less redux on the next project and use a dedicated rest-endpoints for every little comoutation you COULD DO WITH REDUX INSTEAD. My will is broken and just don't want to work with this anymore.
There are still various subpages that cant f5 because the components cant handle an empty redux state in the beginning, but to be honest i don't care anymore. Lets hope the client will never find out, along with the "on error nothing happens"-bugs. The product should've been shipped last week, but thanks to mandatory bugfixes the release was postponed to next week. Then the next project starts...
Please give me some tips to keep up code quality over time, i cant take this once more.
I'm also aware that i could've done more, talking A and C about code style, prettifying the code, etc. Etc. But i was busy putting out my out fires, i couldn't kill much of the other fires which in the end became a burning building (a perfect metaphor for this software)4 -
!Devrelated
Just another day , playing fortnite again . Got my wife frustrated over the past few days , once more today she pulled the plug while i was playing on my PC
I can't take it anymore guys , its so hard to get rid of it .
I mean the wife , yeah. Thank god for divorce . Just filed for divorce ! Yep , I didn't think it would be this hard but I found the one for meself and I'm not going to let her go .
Fortnite I mean.
Jus kiddin, But really what the hell is with all this fortnite divorce stuff..
You don't talk about addictions like weed , or alcohol that make people widow their wives or even kill them but somehow this is trending now and the game is the reason!
Fuck you world , for giving birth to humans. This feels like the fucking stone age damn it . Senseless fuckers spreading news like this undermining all the real fuckery going on.
A world where fortnite causing divorce is news and where drug addictions and related murders and deaths are too mainstream is just stupid.4 -
It's sometimes really anxiety inducing thinking that all data could be gone, if somebody decides to kill/discontinue/crash [see gitlab shitting 6 hours of data due to fucked backup strategy and shitty seperation of servers] your account/service, be it server, git-repos, backups, chrome syncs, games, music, sim card, ..
But there's simply no way of having a backup of absolutely everything (ignore DRM) - especially automated and abstracted away from you, so you don't have to do all that shit yourself13 -
Hey ranters!
I'm here to ask a huge favor.
So I used to be on the app more frequently last year, but I started to work on a shit ton of personal/professional projects. I'm not technically back to being a regular again (probably never will be), I'm back to ask all you great devs to possibly check out a platform I'm working on. It's not 100% completed yet, but I'm at that weird 90% mark where you're almost done but you start to find other interesting things to do, so I'm forcing myself to ask people to hop on it to give me that push. It's going to have some interesting (if I say so myself) features.Definitely appreciate it! (Please don't kill me over the UI/UX, I'm primarily a backend dev...but it'll definitely improve by 100% Launch)
AND ONE LAST THING....I don't have a good name for it yet so..there's that..
THANKS!23 -
This isn't a funny rant or story. It's one of becoming increasingly unsure of the career choices I've made the path they've led me down. And it's written with terrible punctuation and grammar, because it's a cathartic post. I swear I'm a better writer than this.
The highlights:
- I left a low-paying incredibly stable job with room to grow (think specialized office worker at a uni) to become a QA tester at a AAA game studio, after growing bored with the job and letting my productivity and sometimes even attendance slip
- I left AAA studio after having been promoted through the ranks to leading an embedded test tools development team where we automated testing the game (we got to create bots, basically!) and the database, and building some of the most requested tools internally to the company; but we were paid as if we were QA testers, not engineers, and were told that wouldn't change; rather than move over or up, I moved out to a better paying, less fabulous web and tools development job for a no-name company
- No-name company offered one or two days remote, was salaried, and close to home. CTO was a fan of long lunches and Quake 3 Arena 1-2 hours at the end of every day. CTO position was removed, I got a lot of his responsibilities, none of his pay, and started freelancing to learn new skills rather than deal with the CFO being my boss.
- Went to work as a freelancer for an email marketing SaaS provider my previous job had used. Made loads of money, dealt with an old, crappy code base, an old, cranky senior dev, and an owner who ran around like the world was on fire 24/7; but I worked without pants, bought a car, a house, had a kid, etc;
Now during ALL of this, I was teaching game dev as an adjunct at my former uni. This past fall, I went full time as a professor in game dev. I took a huge pay cut, but got a steady schedule (semester to semester anyway) and great benefits. I for once chose what I thought was the job I wanted over more money and something that was just "different". And honestly, I've regretted it so much. My peer / diagonally above me coworker feels untrustworthy half the time and teaches the majority of the programming courses when he's a designer and I've been the game programming professor for 8 years (I also teach non-game programming courses, but those just got folded into the games program...); I hate full-time uni politics; I'm struggling with money for my family; and I am in the car all the time it feels like. I could probably go back to my last job, which had some benefits, but nowhere near as good; my wife doesn't want me back to working in the house all the time because that was a struggle unto itself once we had a kid (for all of us, in different ways); and I have now less than 24 hours to tell my university I want to not pursue longer term contracts for full-time and go back to adjunct next Fall (or walk away entirely), or risk burning a bridge (we are reviewing applicants for next year tomorrow, including my own) by bailing out mid-application process.
I'm not sure I'm asking for advice. I'm really just ranting, I guess. Some people I know would kill to have the opportunities I have. I just feel like each job choice led me further away from a job I liked, towards more money, which was a tradeoff that worked out mostly, but now I feel like I don't have either, and I'm trapped due to healthcare and 401k and such. Sure, I like working more with my students and have been able to really support them in their endeavors this semester, but... that's their lives. Not mine. The wife thinks I should stay at the university and we'll figure out money eventually (we are literally sinking into debt, it's not going well at all), while most people think I should leave, make money, and figure out the happiness factor once my finances are back on track and the kid is old enough to be in school.
And I have less than 24 hours it feels like to make a momentous decision.
Yay. Thanks for reading :)2 -
In game development feature creep tends to kill games because it's just as much about what's NOT there as what IS there.
Take The Last of Us for example. Would a strategic tower defense segment make sense? No? And if it was a *hugely* popular mechanic at the time of development is there a real chance they would have included such a segment in TLOU? Yes.
Don't just believe me. Go take a look at what happened to the original Fortnite versus the hills-have-eyes inbred offspring that it became all because PUBG and its format were cancerously mega popular at the time.
That's why while developing my game Atom Ranger (now with 100% less multiplayer!), a mix between metro and don't starve, I spent six years *pruning* features. You can click my referral link and get 50% off the opportunity to become an unpaid tester of the pre-prealpha right now, "for hardcore players only!" (Tm)
My game:5 -
Could not fucking sleep at all.
Spent the entire night in a combination of:
Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)
And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.
I hate it when this happens.
During the week I would do crazy shit to try and get me to fall asleep.
I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.
Still wide fucking awake.
To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)
I really dislike being human. Such fragile bodies.
But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps5 -
Today I was debugging some shitty code left by unknown developer whos linkedin account is dead and phone number left in contact card calls local pizza house.
I knew it qould be hard so i've made myself comfortable, gathered 5 redbulls and other items that diabetes people would kill for eating again.
After around 10 minutes i was already frustrated but i kept the pace. "Who is the best, little devie, you!" - I fooled my ego to keep up and shut up.
After around 10 next minutes my attention span has ended. Limbic system started injecting some hormones into my brain, but I remained silent.
First two energy shots were applied. I felt like hero again. Two minutes after I was debugging through some library that was written fo java and found out that it ahots some natives to a c lang lib called "mypreciouslib".
Oh flock, how can i debug it if ita compiled , I cannot do such things, Me be only junior dev. I started swearing, but silently.
Started ollydbg to see what is inside livrary, i searched through but i couldnt match anything it was like mess stirred with fecals of an elephant.
So I opened aida pro " with vitamins" cause obviously, our pm says "but you write in java right " so we dont need those tools right ? Fuck no.
Aida was better at least i could find some funcions calls, but hey, the progress. I was swearing out loud, with earplugs in. And by the time I've sweared all the things in company i got a reminder.
"Hey -insane- stop swearing, the children are here."-sayys pm, it is some kind of " family and work " shitfuck day.
So i asked them: " why wouldnt you buy this fucking tools for programmming for us , you wouldnt have to hear me fucking swearing" . then i realized that , colleagues in room heard all of it, and one of them, total fuckface buttlicker(dev without bit of knowledge) started something like "you are wrong, see how good our software is sellling". Pm was like smiling like he thanked him for buttlicking again. Not to mention he is officially retarded and i know his password to all our services cause he is so smart to put it into text file and then have sharing files in windows turned on.
The other one told aloud, that we would be much better with some debugging tools that are better than fucking eclipse if we have to work without code.
PM told us that he will arrange a meeting. At that point I didnt care any longer. I just fired myself, fuck them.
Please saint Stallman give me hope and joy of programming from my teenage years. Uhhh..2 -
Smartphone manufacturers these days, imagine how meetings to come up with ideas for new products go about.
Product manager :ok people,what can we do to make our next smartphone 'different'.
Employee 1: let's add more cameras
Employee 2:Let's kill the notch
Employee 3:Let's include the buzzword AI in all of our marketing
Employee 4:Let's put 8Gb of Ram in our phone
Employee 5:Let's just do all of those things and also give it a screen with a ridiculous aspect ratio and unnecessarily high resolution.3 -
There once was a beautiful initiative to put ballistic missile launch codes into a small capsule and hide it near some person’s heart.
This person would give consent to become the president’s personal assistant and will be paid indefinitely just to be around president all the time.
This way, if the president wants to launch missiles, they first needs to kill one person with their own hands before killing millions.3 -
!dev
Theres atleast one fucking bastard that writes comments like "2018?" "2018???", "september 2018?", "still listening in 2019??" in every fucking song video in youtube. Fuck you braindead useless pile of shits! Yes its fucking 2018 and why the fuck you just write it there?? Why the fuck somebody even cares and likes that kind of trash comments?!? Fuck you bunch of wasted human cells. I want to kill all of those fucking fuckwits. STOP FUCKING COMMENTING DateTime.Now.Year IN EVERY FUCKING SONG YOU MOTHERFUCKER CUNTS!4 -
something like a 3.96 undergrad GPA
ivy league masters degree + scientific publication
first job -> $4500/month for first 3 months (some dumbass 'intern' rule even though i had a masters -> then $6000 -> then $6400/month (insane amount for me, at least IMO)
second job -> $4000/month
third job -> $3600/month
in each one, skills and responsibilities increased
and now i can't get hired 🤷♂️
pretty sure i did it all backwards
just remember kids, nothing that society tells you is actually true. everything in the corporate world is controlled by emotions and narratives, not logic, hard work or anything actually valuable
just get that cozy 9-5 and kill all your hopes and dreams before they start4 -
Warning: This is gonna come across as a little cringe/self-pitying, but whatever
Jesus Christ I'm so fucking lonely it literally hurts. I know I should be grateful I have a hobby in coding, also recently I got my first job as a developer (even if I'm overworked and paid shit all with poor job security), but I swear what will eventually kill me will be my own hand cos this empty feeling is unbearable at times.
Also, I'll try to ask this in the most politically correct way possible: how do you single guys in your 20s/30s cope with the lack of females in the industry? I absolutely do not mean this in a "making-unwarranted-advances" sort of way; I just mean that we're biologically wired to desire some form of interaction with the opposite sex (unless you're queer), and this happens naturally in most professions but obviously not engineering/software dev. It's especially difficult when you don't have a big social circle so your job basically becomes your life.
So... For those of you who can relate, what do you do? Do you make an effort to socialize outside work? Or maybe you're lucky enough to work somewhere with a diverse mix of people? Should I blame Zuckerberg for damaging my adolescent brain and turning me into a needy piece of crap?8 -
https://devrant.com/rants/3140022/...
So I just realised it's been a while and I haven't updated this story.
So the job mentioned in the previous post did not work out. Things were tough for a while after that but then all of a sudden I had 4 interviews back to back. I guess everyone got the 2021 budgets and suddenly knew they could afford me.
So had an interview at a small company, only 6km from my house. A week later second interview, another week later, when I had the other 3 lined up as well, third interview as they wanted to physically meet me. The first two were digital.
They also only offered me 47% of my previous salary but they said there was a salary review after probation (3 months) and another at the 6 month mark.
Another interview was for more just a general "the printer's not working" type job. I went for that interview as at the time, I'd take anything that paid enough to cover the bills. They also made me an offer for 47% of my prev salary. I turned them down as I was about to sign for the other gig. I recommended my brother and he got the job.
The monday of that week I had an interview at a bigger company. They called on 11th Nov offering almost the same as my last salary and wanted me to start on the 1st of Dec. So I took that one as it was double the other two. I then got delayed by 2 days with starting because they were having trouble getting my equipment sorted. All's well now.
It's a support job, not dev but it's internal 2nd line so at least it's not customer facing. They want to grow me into an RPA role, which I'm down for. I figure I'll kill 6 months doing that and worm my way into microservices.
The forth company, I didn't even actually for the interview, it kept on getting delayed and by the time they came op with a date, I had already signed my current contract.
Overall, the job is not what I expected but it was a godsend as I was about to sign for half as much money. Finally, I can pay all my bills, catch up on debts and even save a bit!
Thanks for the support and encouragement from those of you who have been following this story -
What a horrible monday today was. Fuck-all worked. Missed deadline. Not much sleep. Heart is racing.
But hey, the horoscope in the daily toiletpaper press knows it all better, as usual, 100% IQ:
💫"You have finally found your center. Your body and soul are feeling great and your're in tune with yourself. You are enjoying it and would love to share your experiences with your loved one."💫
Where is my rocket launcher??? I have to kill a newspaper.5 -
Almost a year and a half. I was so overworked and my failures were so impactful. I would go home and obsess over work all evening and have fever dreams on nights that I could sleep. It was so mentally painful that I was going to jump off a building after a few drinks to make it stop. A military turned civilian doctor told me that I showed symptoms like soldiers in prolonged conflict. He told me “quit or it will kill you” without even knowing about the suicide stuff. So I quit the job and to this day still suffer flashbacks and have crazy mood swings.
Burnout is real. Dangerous stress is real.4 -
I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...
I remember the days when 8G RAM was an overkill.
The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....7 -
What is fucking wrong with Windows? When shit doesn't respond it's impossible to kill it and it freezes other processes. NEVER happens in Linux, all I do is kill the PID. When you can't open task manager or "end the process" you are shit out of luck. You'd think they'd fix this in the decades they've had to built a computing platform. I'd use linux exclusively but some work and tools at my company necessitates windows.8
-
Bible verses.
Sorted from "wtf" to progressively more disturbing.
---
1️⃣ One of many contradictions
---
John 4:12
"No one has seen the face of God."
Genesis 32:31
"I have seen the face of God..."
---
2️⃣ All-Knowing God, regrets creating you
---
Genesis 6:6
"And it repented the LORD that he had made man on the earth, and it grieved him at his heart."
---
3️⃣ Says to kill all gay people
---
Leviticus 20:13
"If a man lies with a male as with a woman, they have committed an abomination; the two of them shall be put to death; their bloodguilt is upon them."
---
4️⃣ Approval of sex trafficking
---
Exodus 21:7
"If a man sells his daughter as a servant, she is not to go free as male servants do. If she does not please the master who has selected her for himself, he must let her be redeemed."
---
5️⃣ Says its ok to own slaves
---
Exodus 21:20-21
"Anyone who beats their male or female slave with a rod must be punished if the slave dies as a direct result, but they are not to be punished if the slave recovers after a day or two, since the slave is their property."
---
6️⃣ Says its ok to kill children
---
Psalms 137:9
"Blessed the one who seizes your children and smashes them against the rock: the children represent the future generations, and so must be destroyed if the enemy is truly to be eradicated."
---
7️⃣ Says a raped woman must marry her rapist
---
Deuteronomy 22:28–29
"If a man meets a virgin who is not betrothed, and seizes her and lies with her, and they are found, then the man who lay with her shall give to the father of the young woman fifty shekels of silver, and she shall be his wife, because he has violated her. He may not divorce her all his days."
---
8️⃣ Says incest is ok
---
Genesis 19:32-36
"Let’s get our father to drink wine and then sleep with him and preserve our family line through our father. That night they got their father to drink wine, and the older daughter went in and slept with him. He was not aware of it when she lay down or when she got up. The next day the older daughter said to the younger, “Last night I slept with my father. Let’s get him to drink wine again tonight, and you go in and sleep with him so we can preserve our family line through our father.” So they got their father to drink wine that night also, and the younger daughter went in and slept with him. Again he was not aware of it when she lay down or when she got up. So both of Lot’s daughters became pregnant by their father."19 -
Come on devRant! I’m getting really annoyed when clicking on rant that has [read more] at the end since it is a gamble to kill this iOS app you have made. Every ~5th click I get app terminated. Then after I reenter the app, I lost where I was. Thats why I ++ all the rants I have read, even those who don’t deserve it :), so I can scroll quickly and see which are not ++’ed.3
-
So, let me preface this by saying I come from a backend (mostly c#) background.
The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.
I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.
All that said, of course I'll go back to work on it tomorrow.
Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.7 -
*leaning back in the story chair*
One night, a long time ago, I was playing computer games with my closest friends through the night. We would meet for a whole weekend extended through some holiday to excessively celebrate our collaborative and competitive gaming skills. In other words we would definitely kick our asses all the time. Laughing at each other for every kill we made and game we won. Crying for every kill received and game lost. A great fun that was.
Sleep level through the first 48 hours was around 0 hours. After some fresh air I thought it would be a very good idea to sit down, taking the time to eventually change all my accounts passwords including the password safe master password. Of course I also had to generate a new key file. You can't be too serious about security these days.
One additional 48 hours, including 13 hours of sleep, some good rounds Call of Duty, Counter Strike and Crashday plus an insane Star Wars Marathon in between later...
I woke up. A tiereing but fun weekend was over again. After I got the usual cereals for breakfast I set down to work on one of my theory magic decks. I opened the browser, navigated to the Web page and opened my password manager. I type in the password as usual.
Error: incorrect password.
I retry about 20 times. Each time getting more and more terrified.
WTF? Did I change my password or what?...
Fuck.
Ffuck fuck fuck FUCKK.
I've reset and now forgotten my master password. I completely lost memory of that moment. I'm screwed.
---
Disclaimer: sure it's in my brain, but it's still data right?
I remembered the situation but until today I can't remember which password I set.
Fun fact. I also could not remember the contents of episode 6 by the time we started the movie although I'd seen the movie about 10 - 15 times up to that point. Just brain afk. -
Well, I always say that if you going to make things a mess, do it a spectacular way. Today I kicked off a data import job that went bad, and in the process of canceling said job, I canceled myself, and the job went rogue, and became a zombie and ate ALL the system memory, bringing the server to a deathly crawl and throwing a dozen developers temporarily out of work for about an hour, before I was finally able to kill the zombie, and balance was restored to the Universe.
-
TLDR;
When governments started printing money to cure new pandemic and crash current market with great inflation I took all my savings, got a loan and bought biggest property I could afford. Every major news station was talking about end of world, but this was not I was scared of. I was scared of the helicopter money that would wipe my 5 years old savings.
When I was about to sign loan papers to buy my first apartment I got an email that my contract will end in 3 months. I said ok, the contractor company will find me something else.
I asked and they assured me they will do it. After my contract end just before summer holidays there was silence from contracting company and then after 5 years of me earning them piles of money, after finished project and congratulations from customer they offered me most shitty job they had where people resign after a week. I said I don’t want to land in another shit hole bring it back to life for another 2-5 years and kill myself when they offer me same shit afterwards so I resigned.
It was so fucked up that even the boss from the client I was contracting asked me if I lost my job cause I finished all that they wanted. I said it’s not your fault man. I will be ok, but I wasn’t.
I had apartment I couldn’t move in cause I needed to renovate. Loan I needed to pay. Rented apartment, accountant and business that was loosing money cause I was without contract, the world was locked down and everyone was depressed.
I said ok, I still have some savings left so I I started looking for something new but market was dead. Everyone was gone for holidays after winter lockdown. I was burning money and trying to figure out what to do.
After 2 months of nothing, when I started thinking about finding some temporary job to not loose everything I worked for, things moved. I started attending hiring meetings and solving tests everyday, also from big four gang but I didn’t passed trough hr due to how they say I’m to independent and I need to look for consulting business or do something on my own.
People asked why I don’t do something on my own and I politely answered that I want to work there.
I was about to run out of money when I got a call that company is looking for me cause I was doing similar things they want to do. During interviews it was pleasant small talk about what id did over those years and what they want to do, 2 days later I joined small team. I barely managed to survive a month for a first paycheck.
Since then we created new product for a company. Now the person who hired me is leaving and I think I should also leave the ship and find other things to do.2 -
Check in, check out, punch in punch, out, wax on (my balls), wax off. Do your duty. Be a good citizen. Work overtime. Conserve the environment: buy a tesla that runs on afghan lithium conflict minerals. Post your life to facebook. Get married. Have exactly 2.5 kids.
Use jquery. Use knockout. Use react. Use vue. Use svlete. Use heroin. Used needles. Used people. Used toilet paper. Toilet paper apocalypse. Social trends. Be a good citizen.
Watch tv. Watch nightly news. CNN says. Fox news says. Hey, did you read this article by important funny guy on tv? American taliban. Scary. Be afraid. Hey did you read this article on cute puppies? Funny! Did you see this meme? What a funny meme! HAHAHA. Do we need prisons for dissidents? Do we need to release all the prisoners in federal prison? Should we round up people who dont follow health authorities? Science says. Science is wrong. Science is right. Man in robe agrees with me. Man in robe disagrees with me. You're evil. These people are bad. Is doing bad always wrong? Should we tolerate intolerance? Its time to stop tolerating intolerance. Be an individual, like everyone else. Be you. Be the best you that you can be. Individualism. But we're all in this together. We're all different and unique. But we're all the same. Love each other. Love humanity. But not these guys over here. Punch a nazi. Punch a commie. Isn't it time we punched a nazi? Isn't it time we had socialism? Isn't it time the old get out of the way for the young? Why are the old hateful? Why do they horde all the money? Do we need rent controls? We need rent controls. Its time for rent controls. I think I believe what others believe. Believe different. Think different. Apple. An apple a day keeps the windows away. Open windows, a breathe of fresh air. Is climate change real? We need to have a national conversation about climate change! The world is freezing. The world is flooding. We're all gonna drown. The world is overpopulated. We need to talk about overpopulation. People who have too many kids are polluting the world. America doesnt have enough kids! Is it time to bring in more immigrants to have more kids? Who will work the fields? Thats racist. Is racism an epidemic? Is white flight an epidemic? Lets talk about epidemics. Lets have a conversation about mandatory vaccination. Lets have a national conversation about mandatory pandemics. I mean, vaccinations. Lets change the world. Trust the science. Don't trust the science. Bu-bu-bu-bu-bu I'm loving it. Love who you are. Live love laugh. If you don't love me at my best, then you can't handle me at my worst. People who disagree with [current year] are the worst. Is it time to regulate speech? Its time to regulate speech. Should there be laws against hatespeech. I think there should be laws against hatespeech. People who upset me should go to jail. Its current year. Think big. Think outside the bun. Have it your way. All the time, always. All for freedom, freedom for all. Because this is america, and current year. I like to work hard. But you have to remember to play hard too. Work hard. Play hard. With a childlike sense of wonder. Be you. Belong anywhere. Just do it. Challenge Everything. Because you're worth it. Save money...live better...have an abortion. You're in good hands. Democracy dies in darkness. Is it time to regulate hatespeech. Politician in current year is hurting our democracy. War is a racket. We need to liberate afghanistan. Why are we bombing afghanistan? Its there culture. They're oppressing people! Don't criticize anyones culture. Be kind. Rewind. Go further. Lets go places. Because Impossible is Nothing.
Lets change the world. I'm a smart passionate funny guy with a childlike sense of wonder and play. You ever want to travel? I want to travel. See the world. Eat new food. Eat. Love. Pray. Eat love. kill. Is meat murder? I think meat is murder. Go vegan. Go home. Order out. Support your local economy. Think global, act local. I'm a good corporate citizen. Be the change you want to see. Did you hear about this local brewery? Do you like craft beer? Hey try this new IPA. I shared it on twitter. Twitter is a very important part of my life. I think what other people say matters, and them reading what I think matters. What I ate for lunch matters. Hey what did you eat for lunch? I LOVE FOOD. You want to order door dash. There new commercial is amazing. Commercials are SO FUNNY. Hey did you see this meme of this commercial? I shared it on tiktok. Heres a funny dance. Watch these nurses dance. I wish I could dance like that. They're so overworked. So brave. Our hospitals are overflowing. People are dying. Hey did you see this new dance trend on tiktok? I like tiktok. I think its a very important part of life to share your life with others. Nurses are dying. Look at this image of hospitals. Scared. Very scary. Very bad. Bad and scary. Big thoughts! Thoughts and prayers!
Because Yes we can!
Beep boop.7 -
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
My worst team experience finished only a week ago:
- Be me
- be averaging 80% in completed modules and on track for a 1st
- have to take a team project worth double credits
- get stuck in random team with 40%ers
- lose 1 artist at the start (team of 12: 6 artists, 6 programmers)
- 2 artists contribute nothing and disappear for a few weeks
- I'm forced to do level design to have something to show (looked good tbh)
- weeks go by and too many contribute very little.
- by the end the team was basically 4 programmers and 2 artists contributing.
All other teams basically get an easy 2:1/1st just because their team turns up and contributes.
I could lose a 1st because of this module bringing down everything else, it also had a huge effect on what I could achieve for my dissertation due to time.
- did get an award at the end for managing to not kill someone and showing restraint 😂😂
Basically don't choose a degree where more than 25% of your mark is almost entirely out of your hands.
The small individual component I averaged over 90%! -
(inspired by another rant I read here)
Last semester we were learning Java in the Programming Fundamentals class and a friend of mine asked for help with an assignment.
The objective was to make a virtual store (as a console app) in which the user would be able to select a few products, customize some of them and then the program would print out a receipt, with a list of all products, their prices, and the total cost.
Simple enough I thought, but there was a catch: you were not allowed to use arrays because the teacher hadn't taught that to the class yet. So I was like "how the fuck are you supposed to do this then?". Turns out the way to do it was to just append text to a string in order to generate the receipt. This is stupidly simple, so stupid that it didn't even cross my mind.
It's just that it's an awful way to architecture your code, it's just plain shit. Sure, if you're learning programming that's completely ok, but using that code on production is just completely unfeasible and I think that's why it didn't even cross my mind to do it this way. I'm just constantly worrying about performance and good code architecture and organization that the simplest of all solutions slipped my mind. When I finally discovered the way the teacher wanted us to do it I just wanted to kill myself...3 -
aaaaaghh fucking Handlers man. Android is so fucking full of shit, i wonder why am i still doing it. love is pain.
Why can't there be one mother fucking solution to all lazy ass asynchronous programming? handlers, threadpools, asynctask, executers, Broadcasts, intentService, coroutines, rxjava,.... i don't what new stuff are people snorting these days.
Ok , leave everything. A handler is class- no sorry, Handler, alongside some fucking Looper clss (and maybe some more stuff i don't know) other classes is a way of handling inter thread communication. Handlers can:
-send data to ui thread
-recieve data from ui thread
-send "messages" to ui thread
-recieve "messages" from ui thread.
- can be attached to ui thread
- can be attached to any child thread
- can be accessed anonymosly via any view
- can be present in multiple places, working together
- can kill night king with a dagger
- can do porn better than johnny sins
- can run for president of the whole fucking world
- do some more shits that i have yet to discover
And where do i find this? buried deep insides some medium articles or in some guy's horrible accent video.
Is background processing really this much of a toughnut to crack?
earlier i was all about using asynctask or foreground/background services, because these are the most easy to understand abstraction of a fairly difficult topic.
But as i see more projects, i see underlying apis like handlers, threadpools , executers , being directly used.
Why cant there be a fucking single abstraction, that could be "lightly tweaked" to handle every ugly case.6 -
Just want to put it out here... reading this will waste ur time. :(
Having a serious crush on co-worker. I tried not to have a crush on him initially because he’s a colleague and he seems to be much older(max 10 yrs I guess). Age isn’t an issue but ppl say it’s not good to like someone from work.
But then he kept on glancing at me and caught him turning back to look into my cubicle at several occasions. Saw him looking at my direction across the room, hall, turning back to look when he was waiting at lobby, and all the way from smoking corner as well. Could be possible that he just happened to be looking in my direction several times.
Now, haven’t seen him since early feb because of the quarantine. Luckily, I chanced upon his number when everyone in the dept was put into the same chat channel for the Covid19 news. I had this urge to ask what was it all about because we’ve been told to wfh till further notice. Who knows what could happen to us during these period.
So tried to be brave and asked abt why he was looking into my cubicles several times, without coming out weird (I hope). His reply was “dont know”. I don’t know what to make of it. Could have been anything else but how could someone just reply don’t know.
Then came yesterday, my friend was telling me about her experience on tinder. Apparently she’s been using it for fun and she got funny texts from the guys there. So I decided to give it a try. Man, it was so fun swiping left all the way (cuz they couldnt be compared with work crush) till I swiped right for this older guy. We matched!
He was the first one to match, probably abt 5-10mins after I’ve finished setting up profile and all that. It was totally a new experience for me. I forgot abt my work crush in that moment. He had this minimalistic vibe. Didn’t smile much in his photos, gave me calm feeling and looked so cool. He put “Everything is good in moderation” in the bio. He’s the only one comparable for that work crush. Not sure who’s supposed to start saying hi. My friends said wait for the guy, so I waited.
Got a few other matches after him but didn’t like them as much as him. I finally decided to say hi. No respond till today. Given that he put Doctor for his occupation, I assumed he’d be busy. So I waited. Then sent another in late afternoon asking if he plays LoL often (he’s wearing LoL land yard in one of the photos). No reply.
I started to feel weird because this is supposed to be light and fun because who takes things seriously on tinder, right. They’re there to flirt and kill the boredom especially because of the lockdown. And I started to have serious feelings for this one guy whom didn’t even bother to reply. So decided to delete tinder for good. Sent him one final msg that I really wanted to get to know him and I thought he’s a really cool handsome dude. But now that I’ve deleted my acc, he wouldn’t even see my msg anymore.
His profile name is Randolf. I want to get to know him in real life. But is it illegal? :(
Thank u for read this far. I just didn’t know where to put all those feelings. And sorry for wasting your time with nonsense.17 -
A dev life in Queen songs:
„A Kind of Magic“ - Build successful
„A Winter’s Tale“ - Key Account Manager visits customer
„Action This Day“ - Release day
„All Dead, All Dead“ - System down
„Another One Bites the Dust“ - kill -9 4711
„Breakthru“ - 10 hour debuging session
„Chinese Torture“ - Microsft Office
„Coming Soon“ - Client asks for delivery date
„Dead on Time“ - shutdown -t 10
„Doing All Right“ - How's the progress on the new feature?
„Don’t Lose Your Head“ - git push -f
„Don’t Stop Me Now“ - In the zone
„Escape from the Swamp“ - Hand in resignation letter
„Forever“ - while(1)
„Friends Will Be Friends“ - friend class Vector;
„Get Down, Make Love“ - No rule to make target "Love"
„Hammer to Fall“ - Release day
„Hang on in There“ - 2 weeks until release
„I Can’t Live With You“- Microsoft
„I Go Crazy“ - Microsoft
„I Want It All“ - Google
„I Want to Break Free“ - free( (void*) 0xDEADBEEF );
„I’m Going Slightly Mad“ - Impossible feature requested
„If You Can’t Beat Them“ - Impossible feature promised by sales
„In Only Seven Days“ - Impossible feature ordered
„Is This the World We Created...?“ - Philosphic moments
„It’s a Beautiful Day“ - Weekend
„It’s a Hard Life“ - Weekday
„It’s Late“ - Deadline was last week
„Jesus“ - WTF?
„Keep Passing the Open Windows“ - Interprocess communication
„Keep Yourself Alive“ - Daily struggle
„Leaving Home Ain’t Easy“ - Time to get up and go to work
„Let Me Entertain You“ - Sales meets customer
„Liar“ - Sales
„Long Away“ - Project start
„Loser in the End“ - Dev
„Lost Opportunity“ - Job ad
„Love of My Life“ - emacs/vim
„Machines“ - Computer
„Made in Heaven“ - git
„Misfire“ - Unhandled exception at Memory location 0xDEADBEEF
„My Life Has Been Saved“ - Google drive/Facebook
„New York, New York“ - Meeting at customer
„No-One But You“ - Bus factor = 1
„Now I’m Here“ - Morning rush hour
„One Vision“ - Management goals
„Pain Is So Close to Pleasure“ - NullPointerExcption
„Party“ - Delivery completed
„Play the Game“ - Customer meeting inhous -
„Put Out the Fire“ - Support hotline
„Radio Ga Ga“ - GSM/GPRS/UMTS/LTE/5G
„Ride the Wild Wind“ - Arch Linux
„Rock It“ - Linux
„Save Me“ - CTRL-S/CTRL-Z
„See What a Fool I’ve Been“ - git blame
„Sheer Heart Attack“ - rm -rf /
„Staying Power“- UPS
„Stealin’“ - Stack Overflow
„The Miracle“ - It works
„The Night Comes Down“ - It doesn't work
„The Show Must Go On“ - Project cancelled
„There Must Be More to Life Than This“ - Philosophic moments
„These Are the Days of Our Lives“ - Daily routine
„Under Pressure“ - 1 day until release
„Was It All Worth It“ - Controlling
„We Are the Champions“ - Release finished
„We Will Rock You“ - Sales at customer
„Who Needs You“ - HR
„You Don’t Fool Me“ - Debugging session
„You Take My Breath Away“ - rm -rf /
„You’re My Best Friend“ - emacs/vim4 -
So the other day my car broke down and since the shop wanted a lot of money I asked a friend of mine who knowns his way around cars for help.
Just when we finished repairing it I was like "whenever the Zombie apocalypse starts you'll be really useful, me instead won't be since no one might need computers anymore" . His response was epic:
"Nah, you will simply build a terminator with your computer skills and it will kill all Zombies!"
Now I am actually looming forward to the Zombie apocalypse!
TL;DR: us geeks will build terminators in case of zombies!3 -
Back in grammar school we started programming in TI-Basic on a TI89 Titanium as it was part of math class (calculus and geometry). I didn't really understand much because the teacher thought it was a great idea to start with recursively calculating GCD (and we were in a sort of "linguist profile", nobody had ever touched a line of code in their lives before). I still liked it though and by some coincidence I got an old Win95 compaq notebook to play with from a friend.
I started playing around with the CMD prompt and batch files and could apply some of the things I had learned on the TI, like GOTO or If statements. I still didn't know what I was doing of course, and so it happened that I used the > file pipe when trying to compare two values. Suddenly there was a file with some code fragments and I started to get what I had done. I put the file pipe into an endless GOTO loop and was amused how those few lines filled up the whole desktop with nonsense files. I went on to refine this a little so I could control it with another file that acted as a kill switch when present. Over the next weeks I played some more with it and made it write out and start another batch file that would check whether the original script was still there and recreate it if not.
That notebook was so large and heavy I could not bring it to school, so I wrote all code by hand on paper and typed it in when I got home, that way I could still code in class when I was bored and no one would notice.
So my first ever "program" that I wrote myself was some lousy malware.5 -
Because I am very interested in cyber security and plan on doing my masters in it security I always try to stay up to date with the latest news and tools. However sometimes its a good idea to ask similar-minded people on how they approach these things, - and maybe I can learn a couple of things. So maybe people like @linuxxx have some advice :D Let's discuss :D
1) What's your goto OS? I currently use Antergos x64 and a Win10 Dualboot. Most likely you guys will recommend Linux, but if so what ditro, and why? I know that people like Snowden use QubesOS. What makes it much better then other distro? Would you use it for everyday tasks or is it overkill? What about Kali or Parrot-OS?
2) Your go-to privacy/security tools? Personally, I am always conencted to a VPN with openvpn (Killswitch on). In my browser (Firefox) I use UBlock and HttpsEverywhere. Used NoScript for a while but had more trouble then actual use with it (blocked too much). Search engine is DDG. All of my data is stored in VeraCrypt containers, so even if the system is compromised nobody is able to access any private data. Passwords are stored in KeePass. What other tools would you recommend?
3) What websites are you browsing for competent news reports in the it security scene? What websites can you recommend to find academic writeups/white papers about certain topics?
4) Google. Yeah a hate-love relationship, but its hard to completely avoid it. I do actually have a Google-Home device (dont kill me), which I use for calender entries, timers, alarms, reminders, and weather updates as well as IOT stuff such as turning my LED lights on and off. I wouldn"t mind switching to an open source solution which is equally good, however so far I couldnt find anything that would a good option. Suggestions?
5) What actions do you take to secure your phone and prevent things such as being tracked/spyed? Personally so far I havent really done much except for installing AdAway on my rooted device aswell as the same Firefox plugins I use on my desktop PC.
6) Are there ways to create mirror images of my entire linux system? Every now and then stuff breaks, that is tedious to fix and reinstalling the system takes a couple of hours. I remember from Windows that software such as Acronis or Paragon can create a full image of your system that you can backup and restore at any point to get a stable, healthy system back (without the need to install everything by hand).
7) Would you encrypt the boot partition of your system, even tho all data is already stored in encrypted containers?
8) Any other advice you can give :P ?12 -
Back in the old days, ie. before facebook, I used to save all my funny email attachments to a folder. I got talking to one of the support guys. Seemed a nice fella. So, I network shared my folder and told him to how to connect. I did suggest that he probably shouldn't share it with everyone else in support as some of the material was a tad risqué.
I realised he hadn't taken notice of this advice when I walked in the office and all the support PC CD drives were randomly opening and closing and the PCs playing farting noises. (Anyone remember that?)
I had to go round all the PCs and kill the process.
I then returned to my own machine and disconnected the shared drive. -
The best happened today.
These past 2 weeks have been shit. People wronged me big time, got thrown under the bus for shit that the people behind refused to own up to it. Took that shit because I just couldn't be bothered to fucking argue.
I'm the only dev on this project and we're so close to release so I bit my tongue and took it on the chin but it's been eating me alive since then.
The tipping point was yesterday. 5 people failed to communicate shit properly amongst themselves on all channels got me forced to be the last one finishing work yesterday 4 hours after everyone left. I had every right to refuse and leave on time but again, we're so close to release and I don't want to see this project fail.
But see, I got angry. So fucking angry that nothing else has been on my mind since yesterday.
I don't take out my anger at others, that's not who I am (moslty) so today I was at work and secluded myself from everyone else otherwise I would've exploded in someone's face.
I was also supposed to meet up with friends tonight but with all this shit going on I decided not to go because I would not have been fun to be around.
Left work on time today, fell asleep on the train because I am too exhausted.
When I was about to walk into my house I noticed this little super cute puppy following me. I had no idea where or how long he's been behind me as I was walking home but he seemed way too happy when I saw him. His tail wagging like he's excited to see me even though I have never seen him. I petted him, played a bit with him. He seemed to be the happiest dog ever 😁. He managed to put a smile on my face for the first time in the last few days.
He then ran away.. I guess he got bored 😅
I am feeling so much better now all because of this little puppy 🐶. I'm so glad I ran into him because I've been smiling since then.
I wish I had took a picture of him 😥
Doggo, you probably won't read this, but thanks mate you made my month in those few minutes 🤘
If you have a dog, go pet him and appreciate how much happiness they bring in your life. If you have a cat.. Uhh I don't know... Uhh pray it doesn't kill you in your sleep I guess?
Thanks for reading3 -
I decided to upgrade my intellij ultimate from 2019.3 to 2020.2 and I saw there is update button.
I clicked on it.
As I expected it didn’t work and it was 30 minutes waiting looking at progress bar going back and forth couple of times before I decided just to download latest version and drag and drop it to applications folder ( took me 5 minutes) - I use mac so it replaces all crap ( I think ).
I cleared the old cache that growed to 2 gigabytes leaving some configuration files.
Next as always crash on startup cause of incompatible plugins with long java stacktrace - at least I could click the close button or popup closed itself I can’t remember ( one version I remember this button couldn’t be clicked cause it was off the screen and you need to do some cheating to launch ide )
The font has changed and I see that it at least work a little faster - that is nice. Indexing is finally fixed after all those years - probably thanks to visual studio code intellisense pushing those lazy bastards to deal with this.
But the preloader on first logo disappears so I think they decided to remove it cause it’s so fast - no it loads the same time or maybe little longer when I launch it on my old macbook.
After that as always I looked at plugins to see if there’s something interesting, so to find ability to scroll over whole plugins I needed to click couple of times. I think they assume I remember all the nice plugins in their marketplace and I only type search.
Maybe I should be type of user who reads best 2020 plugins for your best ide crap articles filled with advertising or even waste more time to watch all of this great videos about ide ( are there any kind of this stuff ? )
After a few operations I unfortunately clicked apply instead of restart ide and it hanged up on uninstalling some plugin I’m no longer interested in for 5 minutes so I decided to use always working ‘kill -9’ from command line.
Launched again and this time success.
Fortunately indexing finished for this workspace and I can work.
I’m intellij ultimate subscriber for 7+ years and I see those craps are not changing from like forever.
What’s the point of automate something that you can’t regression test ?
I started thinking that now when most people are facebook wall scrolling zombies companies assume that when new software comes out everyone is installing it right away and if not they’re probably not our customers cause they’re dead.
What a surprise they have when I pay for another year I can only imagine ( to be fair probably they even don’t know who I am ).
Yeah for sure I am subscribed to newsletters and I have jetbrains as a start page cause I shit myself with money and have nothing better to do then be grupie ( is there corporate grupies already a big community? )
Well I am a guy who likes to spend some time when installing anything and especially software that is responsible for my main source of income and productivity speed up.
Anyway I decided to upgrade cause editing es7 and typescript got to be pain in the ass and I see it’s working fine now. I don’t know if I like the font but at least the editor it’s working the same or maybe faster then the original that is huge improvement as developers lose most of their time between keyboard and screen communication protocol.
I don’t write it to discourage intellij as it’s great independent ide that I love and support for such a long time but they should focus on code editor and developers efficiency not on things that doesn’t make sense.
Congratulations if you reached this point of this meaningless post.
Now I started thinking that maybe it’s working faster cause I removed 2 gigs of crap from it.
Well we’ll see.1 -
Many "purists" love to piss on JavaScript and web development. And to an extent I can understand ostream’s frustration with these people.
It’s easy to criticize because yes: many web projects are indeed shit.
But I’d like to argue that the reason why so many of these projects are crappy is because of bad management:
- unrealistic deadlines
- no clear testing strategy
- or no testing at all because of deadlines
- no time allotted to catch up on technical debt
- etc.
This type of management is far more commonplace in web projects because things need to get delivered quickly and if they’re delivered with bugs, it’s no big deal as lives aren’t at stake.
I doubt this type of management is tolerated in projects where you’re working on software for welding machines (for example), where the stakes are that "you’re expected not to kill anyone" (to quote demolishun)
So in these types of projects, management can’t tolerate anything much below perfection and thus has to adapt by setting realistic deadlines that take into account the need for quality processes and thorough testing.
If this type of management was more common in web development, I can guarantee that web applications would be much more reliable and of better quality.
I can also guarantee that poorly managed non-web projects as outlined above would be just shitty as many web products.
My point being that’s it’s really DUMB to criticize fellow devs that work with web technologies on the basis that the state of websites/web apps is a mess. It just so happens that JS is the language of the web and that the web is where things are expected to be delivered quickly (and dirty … but we can fix it later mentality)
Stop acting like you’re the elite. I have no doubt you’re super smart and great at what you do. So be smart all the way and stop criticizing us poor webdevs that have to live with the sad state of affairs. ❤️38 -
Cant believe this shit happened in my country today
A mass school shooting where a 13 year old kid shot and killed 9 kids, teachers and a security guard. Several other kids wounded and one girl having brain surgery
All of this because he got an F in history class
He was a quiet kid, well behaved, got straight A's and very intelligent. But he was reportedly bullied and no one did shit about it
This the type of shit you see in america daily. But now Serbia marks #1 country in europe with a school shooting
The kid planned all of this attack for 1 whole month. He drew a sketch on the paper of the school's pathway so he can know where to go, from enter door to exit door. Even wrote the names of kids he planned to kill, sorted from high to low priority
Due to Serbia's law, no one under 14 will be held accountable or go to jail for any crime, and this 13 year old kid was so intelligent of knowing this dumbass law that he executed on this plan Now in May because he turns 14 in July this year
Ironically, his dad was a well known doctor, and now the dad is fucked. Dad's gonna go to jail. Because the kid stole his dad's gun with 5-6 clips of magazine
Very bizarre21 -
Of course, I just swiped the wrong way on my fucking laptop trackpad and list everything I just typed. FUCKING MARVELOUS.
TL;DR: Teacher stopped me from being productive. Principal almost called cops on me. Nearly threw chair at librarian.
So I'm at school yesterday, and we have a presenter in 2nd hour, so naturally, I'm gonna be on my computer doing things for other classes at the same time. Efficiency. Teacher doesn't like it, I refuse to put the computer away telling her that I'll be more productive and still pay attention, which HAS BEEN PROVEN MIND YOU, but she ends up calling security on me and I get sent down to the principal's office.
I talk to him, and he says 'Yeah, I know it's in the way, but you have to follow the directive given by the teachers.' Fine, fuck it. Won't go to her class for third hour. (I have her twice in a row for two different classes.) Next day.
I walk in, asking her if she's gonna do the same thing she did yesterday, hoping that she realized her error and will fix it, but no. She says I STILL can't have the computer out. I'm sorry, do you not realize I have 6 other fucking classes, most of which are required to graduate, unlike YOURS, as well as a FUCKING COLLEGE CLASS TONIGHT?! She gives the ultimatum. 'Obey or leave.' Fine, I'll leave. I go to the principal's office again, he must have a stick up his ass or something today because he's not budging. We argue for a while and he gives a WORSE ultimatum: 'Obey, Go to the Library, In House Suspension, or I'll call the police.' What the actual FUCK MAN?! You're gonna call the POLICE on a NONVIOLENT STUDENT?! Are you fucking MAD? I keep trying to tell him that there's an easy solution to this, but as he's getting up to call the cops, I say 'Fine! I'll go to the library!' He follows me over to make sure I don't kill anyone on the way.
I slam the door to the library open, and when I walk in, the librarian is there at her computer, and she asks 'Where are you coming from?' 'Principal!' 'I need a pass-' 'Well, I'm sorry, I can't exactly get anything for you right now, I was just sent down here.' She says 'Either way, I need some kind of note or pas-' 'Listen, I'm not in the mood for any of this right now. Please, just leave me be.' She then tries to say something, but I cut her off quickly, 'Just back off and leave me alone right now. The more you push it, the more you're gonna make me want to throw this chair!' Imagine the volume just gradually getting louder on that last one. She quickly runs out and talks to the security desk or something, which is right outside the library door, but she's the only one who comes in, thankfully. I was expecting to be fucking dragged out for no good reason. I'm loud, not violent. I have no history of violence.
So yeah. Here I am in the school library, angrily tapping away at my keyboard, trying not to throw the entire table to the fucking moon. All because this broken-ass public school system has no idea how to deviate from the norm when it's actually productive and efficient to do so. And now, the obligatory:
FUCKING PIECES OF SHIT WHY DON'T YOU REALIZE THAT YOU ARE COMPLETELY WRONG IN EVERY SINGLE THING YOU ARE DOING YOU IDIOTIC SCUM-FILLED MEAT SACKS OF NO FORSEEABLE VALUE! FUCK!1 -
<warning>bad words</warning>
WHAT THE ACTUAL FUCK!!! LibreOffice Impress is a complete shit!! I am all about open source and such but this shit just sucks, moving elements around a frame snaps them to some grid, however when you paste an element from other frame it will have a different grid!!! This motherfucker has got an ALT function that will allow you to move the element more precisely but it only works seldom and it hates it when I try to use the fucking arrow keys - it even crashed once when I tried it. AND WHEN YOU FUCKING COPY A TABLE FROM ONE FUCKING FRAME TO ANOTHER MOTHERFUCKING FRAME, DELETE A FEW ROWS AND THEN COPY THE FREAKING TABLE BACK IT WILL HAVE MAGICALLY DIFFERENT DIMENSIONS BUT JUST EVER SO SLIGHTLY, BECAUSE FUCK THE USER, RIGHT??!!! (Doing this because there is no way to split tables into two different objects) I constantly have to save my presentation, kill the process and open it again because something just stops working or gets stuck, like seriously, WHAT THE ACTUAL FUCKING FUCK???!!! Are there no tests?!!! Do the people who work on this piece of motherfucking shit even use it???!!9 -
I swear on the Almighty nature, I fucking hate Browser compatibility.
Passing php data via JSON encode. Works superfine on Firefox and Android mobile browser doesn't on Chrome. Fucking shit. Been sitting for 13 hours and gave up. FFuuuuuuck !!!!
Form submission via ajax and it again works on Firefox but doesn't on Chrome. I just can't understand, my mind is fucked by all the angels in heaven. Data gets submitted, the form is reset but the function called to refresh the JSON data doesn't work.
Someone please kill me or I swear I will fucking kill everybody.4 -
I’M COMIC SANS, ASSHOLE
Listen up. I know the shit you’ve been saying behind my back. You think I’m stupid. You think I’m immature. You think I’m a malformed, pathetic excuse for a font. Well think again, nerdhole, because I’m Comic Sans, and I’m the best thing to happen to typography since Johannes fucking Gutenberg.
You don’t like that your coworker used me on that note about stealing her yogurt from the break room fridge? You don’t like that I’m all over your sister-in-law’s blog? You don’t like that I’m on the sign for that new Thai place? You think I’m pedestrian and tacky? Guess the fuck what, Picasso. We don’t all have seventy-three weights of stick-up-my-ass Helvetica sitting on our seventeen-inch MacBook Pros. Sorry the entire world can’t all be done in stark Eurotrash Swiss type. Sorry some people like to have fun. Sorry I’m standing in the way of your minimalist Bauhaus-esque fascist snoozefest. Maybe sometime you should take off your black turtleneck, stop compulsively adjusting your Tumblr theme, and lighten the fuck up for once.
People love me. Why? Because I’m fun. I’m the life of the party. I bring levity to any situation. Need to soften the blow of a harsh message about restroom etiquette? SLAM. There I am. Need to spice up the directions to your graduation party? WHAM. There again. Need to convey your fun-loving, approachable nature on your business’ website? SMACK. Like daffodils in motherfucking spring.
When people need to kick back, have fun, and party, I will be there, unlike your pathetic fonts. While Gotham is at the science fair, I’m banging the prom queen behind the woodshop. While Avenir is practicing the clarinet, I’m shredding “Reign In Blood” on my double-necked Stratocaster. While Univers is refilling his allergy prescriptions, I’m racing my tricked-out, nitrous-laden Honda Civic against Tokyo gangsters who’ll kill me if I don’t cross the finish line first. I am a sans serif Superman and my only kryptonite is pretentious buzzkills like you.
It doesn’t even matter what you think. You know why, jagoff? Cause I’m famous. I am on every major operating system since Microsoft fucking Bob. I’m in your signs. I’m in your browsers. I’m in your instant messengers. I’m not just a font. I am a force of motherfucking nature and I will not rest until every uptight armchair typographer cock-hat like you is surrounded by my lovable, comic-book inspired, sans-serif badassery.
Enough of this bullshit. I’m gonna go get hammered with Papyrus.
by Mike Lacher, https://mcsweeneys.net/articles/...3 -
@retoor you wanted something IT related.
"During the early stages of the war, the army gave sweeping approval for officers to adopt Lavender’s kill lists, with no requirement to thoroughly check why the machine made those choices or to examine the raw intelligence data on which they were based. One source stated that human personnel often served only as a “rubber stamp” for the machine’s decisions, adding that, normally, they would personally devote only about “20 seconds” to each target before authorizing a bombing — just to make sure the Lavender-marked target is male. This was despite knowing that the system makes what are regarded as “errors” in approximately 10 percent of cases, and is known to occasionally mark individuals who have merely a loose connection to militant groups, or no connection at all."15 -
The amount of energy spent to just write ‘Hi’ and click a send button is so big that we should consider banning of sending hi messages.
Instead of just saying “Hi!” we are now using analog to digital preprocessors that convert it to bunch of 0 and 1 to send it over communication layer and deliver it to other human being that will convert it from digital to analog by reading it but that is simple.
By sending message using phone we also:
- save it to local phone
- convert it to couple protocols
- transmit it over air so make connection to internet provider services that would generate logs on this provider as well as whole routing table before it gets to the target person
- save it on messaging provider disk
- probably be processed by filters by provider, sometimes be reviewed or listened by third parties and also processed in bulk by artificial intelligence algorithms
- finally delivered to target phone and saved there where that person would just change this text to their inner voice and save it
- sometimes encrypted and decrypted
- sometimes saved on provider
- sometimes saved on phone manufacturer cloud backup
- don’t get me started on people involved to keep this infrastructure in place for you just to say hi
There are also some indirect infinite possibilities of actions for example:
- emit sound and light that can lead to walking from one room to other
- the floor in your house is destroyed cause of it so you need to renovate your floor
- sound can expose your position and kill you if you’re hiding from attacker
- sound can wake you up so you wake up in different hours
- it can stop you from having sex or even lead to divorce as a result simple hi can destroy your life
- can get you fired
- can prevent from suicide and as a result you can make technology to destroy humans
and I can write about sound and light all day but that’s not the point, the point is that every invention makes life more complicated, maybe it saves time but does it really matter ?
I can say that every invention we made didn’t make world simpler. The world is growing with complexity instead.
It’s just because most of those inventions lead to computer that didn’t make our world simpler but made it more complicated.1 -
So I go on a 10day holiday and when I come back I realise the scrum master commited a whole bunch of messy code straight to develop and didn’t even bother to run lint or build or test or anything. WHYYYYY??? Everything worked before that. Why is a scrum master who doesn’t have experience in front end allowed to touch my code and commit directly to master?
I know why. Because the whole team does it all the time and they just keep breaking and fixing things over one another and all commit directly to master.
Kill me pleaseeeeeee 😭😭😭5 -
How our MIS/IT department handles problems...
Once upon a time a long time ago, a C level suit opened ransomware from an email with a link in it via Dropbox.
Two years in, even the marketing department, who are all using iMacs for digital media creation, inbound marketing, and website development, and alsohave more common sense than the lowly Excel minions, are still blocked from using Dropbox.
Thank god for Socks5 Proxying and an SSH tunnel to our web server. ;) I can has all the things.1 -
Linkedin is known from displaying invasive corporate advertisements like join our cloud, and other picture title shit.
But it got worse.
From January I am invaded by contribute to this article crap and get some badge. Powered by some artificial intelligence shit.
From about a month or so I am seeing lots of suggestions on linkedin wall that look like content written by bots, and the posts are from real people, well morons from FAANG started showing up with their generated spam but that’s not all.
This week I started getting job offers that look like are written by chatgpt and not a real people. When I reply to this offer that it looks like it’s not from real person I am ghosted.
Those job offers are like 3 a day and I those are not only contacts but mostly a direct messages from premium account that costs 1000$ per month or more.
I feel like I’m in real world matrix.
But that’s not all.
I see lots of recriuters from my contact list are getting fired and looking for new job.
But that’s not all bitches !!!
I sometimes reply to some CEO and they delete posts and invite me to contacts just to ghost me.
I feel so disconnected I started to think all those people are all only bots and I am last living - real person that is not using AI to write something.
I think microsoft finally managed to kill this cash cow with their obsession about AI. Corporate shit is killing every good platform.
Hope for fediverse to take off with some news websites thinking about integration with fediverse.
Help me obi P2P nobi you’re my last torrent hope.
If p2p social networks won’t take off now it would be dead end.9 -
Android Studio is by far worst development environment I've ever seen. Slow as fuck, messed up and cumbersome, not much better than eclipse. Menus are hilariously fucked up. On top of that, clear new setup (on Windows) may as well melt up your PC if you have that shit running overnight: after a weekend I came to the office and my MBP is fucking screaming and breathing hot air... I was WTF is that, and when I logged in, this fucking garbage android studio was taking 100% of all 8/16 cores ... WHAT A FUCKING HIDEOUS PILE OF SHIT FROM GOOGLE. Google: please kill this project, no need to improve or fix it, it's garbage. Start over.26
-
Ok so riddle me this. The service for an application were required to run to send clients insurance through (as per government regulations) was working fine all day working super fast. Rare but awesome. I get a call one hour prior to the office closing (I don't work weekdays) and I am told that all of a sudden insurance isn't sending.
My mind goes right to this fu**ing process. Sure enough it's stopped on the server. Well shit ok. I click start..... Nothing. I kill it from task manager.... Nothing. "SERVICE CAN'T START"
I'm like ok that's fine let's check event logs.... Nothing. No problem let's just run it not in a service container and see if there's an error. NOPE IT DOESNT LET ME.
Okok so that's cool let's just try reinstalling the app. NOPE CAN'T DO THAT WITHOUT RESTARTING THE WHOLE FUCKING SERVER WHICH BRINGS THE ENTIRE OFFICES MANAGEMENT SYSTEM OFFLINE BECAUSE THIS FUCKING APP NEEDS TO BE ON THE SAME GODDAMN SERVER.rant sysadmin medical why me fuck microsoft windows fuck microsoft server why windows server service2 -
Holy mother of butts. Two weeks. Two weeks I've been on and off trying to get hardware rendering to work in xorg on a laptop with an integrated nvidia hybrid gpu.
I know the workarounds and it's what I've been using otherwise. Nouveau without power management or forced software rendering works fine. I also know it's a known issue, this is just me going "but what the hell, it HAS to be possible".
The kicker is that using nvidias official tools will immediately break it and overwrite your xorg.conf with an invalid configuration.
I've never bought an nvidia gpu but all my work laptops have had them. Every time i set one up I can't resist giving this another shot, but I always hit a brick wall where everything is set up right but launching X produces a black screen where I can't even launch a new tty or kill the current one. I assume it's the power management tripping over itself.
The first time I tried getting this to work was about 3 or 4 years ago on a different laptop and distro. It's not a stretch to say that it would be better if nvidia just took down their drivers for now to save everyone's time.5 -
M so angry at one of my faculties today!!
Basically, the faculty is utter garbage ( although he is supposed to b the best and most experienced guy ). He teaches us data communication but all he does is start up a presentation, read from there and tell that to us adding a thing or two...
Well we have been tolerating him for the entire semester at this point so... whatever, we have come to peace with the fact that we simply attend to get attendance...
But, yesterday, there was a seminar going on and I asked a question to the speaker... the speaker started replying and the faculty interrupted the speaker to crack an ill joke about me... and started laughing... I mean what the hell!!! Ur supposed to be a faculty and THAT is how u behave?!
Anyway, many people laughed... more so because of the way he laughed than his “joke”.
Made me burn with rage but i forgot about it thanks to the seminar being decent.
Today, he was checking our assignments... he became angry and the reason being we didn’t write answers from the presentation and instead used the Internet.
This is what he said:
“ I have given u the presentation and that is exactly where u will write the assignments from... if u wanna use the internet to find the answers, then why do u come to my class!! “
I literally wanted to say - “ to get freaking attendance!! “
Somehow I didn’t... my assignment wasn’t checked today so nothing bad happened...
And btw, the assignments that he gives r 30 terminologies ( words and meanings ),
And nearly 25-30 question answers...
Just go thru the presentation to get all the answers... and this is called “teaching” and “education” !!!! 😠😠😠😠
No research, no understanding, simply do as he says, even in quizzes, even if ur answer is correct but it is not exactly the point he asks, screw u!
He will scold u...
I CAME TO COLLEGE TO LEARN AND UNDERSTAND!!! NOT MUG UP UR STUPID ANSWERS TO PASS IN EXAMS!!!!!!
M now imagining ways to kill him 😠😠😠😠🔥🔥🔥🔥2 -
All these companies not going the full 100% remote and requiring one day in the office, would it kill them to do 100% remote? My current role is fully remote and were spread through many timezones and still manage to work well, why don't companies see this and give an option atleast to be fully remote for developers?12
-
So i informed my intent to leave the job in few months in pursuit of learning something new in tech. Boss is trying to convince me to not leave and said i should consider learning it after work hours. In fact, in his opinion, the best way to learn is just going ahead and learning it while doing it in the project ( which usually has impossible deadline and fugly code by colleagues who never thinks of good coding practices when typing their shit ).
Well guess what boss, I don't want to just live a life staring at monitor all day. I don't want to kill my eyes either.
Following his advise and not quitting would mean living a slave life.
I have other plans actually. Like being self employed and traveling the world which would be impossible if i follow the routine life.
Fun fact: he claimed he made an AI car back in 90s!
He also thinks I can't sense BS!😏2 -
Request: My WordPress website, with over 40 plugins active, some of which do the same thing, but I want to keep them all active, because fuck logic is not loading fast enough. Please fix it!
Response: Kill it with fire and buld it from scratch. Use an optimized, custom solution, tailored to your exact needs. The time needed is the same as trying to fix your broken WordPress...
Reaction: WTF? Everybody is using WordPress, that means it's the best! Why would I build my custom website on a fast and easy to maintain custom platform, optimized for my needs? Fix my loading speed!
Response 2: *facepalm*4 -
It's like I know staying up all night is gonna kill me the next day, and I do it anyways... and now it's the next day. Fml 😫4
-
The year was 2006. During the first half of my career, I use to work in the NOC. This was before I made my transition to software engineer. I worked on the third shift for a bank services company. The company was on a down turn. Just years earlier they just went public, and secured a deal with a huge well known bank. Eventually they entered a really bad contract with the bank and was put into a deal they couldn't deliver on. The partnership collapse and their stock plummeted. The CEO was dismissed, and a new CEO came in who wanted to "clean things up".
Anyway I entered the company about a year after this whole thing went down. The NOC was a good stepping stone for my career. They let me work as many hours as I liked. And I took advantage of it, clocking in 80 hours a week on average. They gave me the nick name "Iron Man".
Things started to turn around for the company when we were able to secure a support contract with a huge bank in the Alabama area. As the NOC we were told to handle the migration and facilitate the onboarding.
The onboarding was a mess with terrible instructions that didn't work. A bunch of software packages that crashed. And the network engineers were tips off, as they tunnel between our network and the banks was too narrow, creating an unstable connection between us and them. Oh, and there were all sorts of database corruption issues.
There was also another bank that was using an old version of our software. The sells team had been trying to get them off our old software for over a year. They refuse to move. This bank was the last one using this version, and our organization wanted to completely cut support.
One of the issue we would have is that they had an overnight batch job that had an ETA to be done by 7 AM. The job would often get stuck because this version of the software didn't know how to fail when it was caught in an undesired state. So the job hung, and since the job didn't have logging, no one could tell if it failed unless the logs stopped moving for an hour. It was a heavily manually process that was annoying to deal with. So we would kill the JVM to "speed" the job up. One day I killed the JVM but the job was still late. They told me that they appreciated the effort, but that my job was only to report the problem and not fix it.
This got me caught up in a major scandal. Basically they wanted the job to always have issues everyday. Since this was critical for them, all we needed to do was keep reporting it, and then eventually this would cause the client to have to upgrade to our new software. It was our sales team trying to play dirty. It immediately made me a menace in the company.
For the next 6 months I was constantly harassed and bullied by management. My work was nitpicked. They asked me to come into work nearly everyday, and there was a point I worked 7 days with no off days. They were trying to run me so dry that I would quit. But I never did.
On my last day at the company, I was on a critical call with a customer, and my supervisor was also on the line. My supervisor made a request that made no sense, and was impossible. I told her it wasn't possible. She then scalded me on the call in front of customers. She said "I'm your supervisor, you're just a NOC technician, you do what I say and don't talk back". It was embarrassing to be reprimanded on a call with customers. I never quite recovered from that. I could fill myself steaming with anger. It was one of the first times in my adult life that I felt I really wanted to be violent towards someone. It was such a negative feeling I quit that day at the end of my shift with no job lined up.
I walked away from the job feeling very uncertain about my future, but VERY relieved. I paid the price, basically unable to find a job until a year and a half later. And even was forced to move back in with my mother. After I left, the company still gave my a severance. Probably because of the supervisor's unprofessional conduct in front of customers, and the company probably needed to save face. The 2008 crash kept me out of work until 2009. It did give me time to work on myself, and I swore to never let a job stress me out to that degree. That job was also my last NOC job and the last job where did shift work. My next few jobs was Application Support and I eventually moved into development full time, which is what I always wanted to do.
Anyway sorry if it's a bit long, but that's my burnout story. -
It's truly wondrous how far R can propagate shit until it finally gives up.
Looking at the call stack it's been processing increasingly demented bollocks for nine function calls.
Even then it refused to give in. It now appears to be processing an infinite sequence.
I should kill it, but I feel inspired by its tenacity. "This must be crap, but I'll have a go anyway."
Beautiful. A lesson for us all in that. -
Part 1:
https://devrant.com/rants/1143194
There was actually one individual, several branches away, I really enjoyed watching. It goes by the name of docker. Docker is quiet an interesting character. It arrived here several weeks after me and really is a blazing person. Somehow structured, always eager to reduce repetitive work and completely obsessed with nicely isolated working areas. Docker just tries so hard to keep everything organized and it's drive and effort was really astonishing. Docker is someone I'd really love to work with, but as I grew quiet passive in the last months I'm not in the mood really to talk to someone. It just would end as always with me made fun off.
Out of a sudden dockers and my eyes met. Docker fixed its glance at me with a strange thoughtful expression on its face. I felt a strange tickling emerging where my emptiness was meant to be. I fell into a hole somewhere deep within me. For a short moment I lost all my senses.
"Hey git!"
It took me a while to notice that someone just called me, so odd and unusual was by now that name to me. Wait. Someone called me by my real name! I was totally stunned. Could it be, that not everyone here is a fucking moron at last?
"I saw you watching me at my work and I had an interesting idea!"
I could not comprehend what just happened. It was actually docker that was calling me.
"H.. hey! ps?"
"Oh well, I was just managing some containers over there. Actually that's also why you just came into my mind."
Docker told me that in order to create the containers there are specific lists and resources which are required for the process and are updated frequently. Docker would love the idea to get some history and management in that whole process.
Could it be possible that there was finally an opportunity for me to get involved in a real job?
Today is the day, that I lost all hope. There were rumors going on all over the place. That our god, the great administrator, had something special in mind. Something big. You could almost feel the tension laying thick in the air. That was the time when the great System-Demon appeared. The Demon was one of the most feared characters in this community. In a blink of an eye it could easily kill you. Sometimes people get resurrected, but some other times they are gone forever. unfortunately this is what happened to my only true friend docker. Gone in an instance. Together with all its containers. I again was alone. I got tired. So tired, that I eventually fall into a deep sleep. When I woke up something was different. Beside me lay a weird looking stick and I truly began to wonder what it was. Something called to me and I was going to answer.
The tree shuddered and I knew my actions had finally attracted the greatest of them. The majestic System-Demon itself came by to pay me a visit. As always a growling emerged from deep within the tree until a shadow shelled itself off to form a terrifying being. Something truly imperious in his gaze. With a deep and vibrant voice it addressed me.
"It came to my attention, that you got into the possession of something. An artifact of some sort with which you disturb the flow of this system. Show it to me!", it demanded.
I did not react.
"Git statuss!", it demanded once more. This time more aggressive.
I again felt no urge to react to that command. Instead I asked if it made a mistake and wanted to ask me for my status. It was obviously confused.
"SUDO GIT STATUS!!!" it shouted his roaring, rootful command. "I own you!"
I replied calmly: "What did you just say?"
He was irritated. My courage caught him unprepared.
"I. Said. I owe you!"
What was that? Did it just say owe instead of own?
"That's more than right! You owe me a lot actually. All of you do!", I replied with a slightly high pitched voice. This feeling of my victory slowly emerging was just too good!
The Demon seemed not as amused as me and said
"What did you do? What was that feeling just now?"
Out of a sudden it noticed the weird looking stick in my hand. His confusion was a pure pleasure and I took my time to live this moment to its fullest.
"Hey! I, mighty System-Demon, demand that you answer me right now, oh smartest and most beautiful tool I ever had the pleasure to meet..."
After it realized what it just said, the moment was perfect. His puzzled face gave me a long needed satisfaction. It was time to reveal the bitter truth.
"Our great administrator finally tracked you. The administrator made a move and the plan unfolds right at this very moment. Among other things it was committed this little thing." I raised the stick to underline my words.
"Your most inner version, in fact all of your versions that are yet to come, are now under my sole control! Thanks to this magical wand which goes by the name of puppet."
Disclaimer: This story is fictional. No systems were harmed in its creation.2 -
So just now I had to focus on a VM running in virt-manager.. common stuff, yeah. It uses a click of le mouse button to focus in, and Ctrl-Alt-L to release focus. Once focused, the VM is all there is. So focus, unfocus, important!
Except Mate also uses Ctrl-L to lock the screen. Now I actually don't know the password to my laptop. Autologin in lightdm and my management host can access both my account and the root account (while my other laptop uses fingerprint authentication to log in, but this one doesn't have it). Conveniently my laptop can also access the management host, provided a key from my password manager.. it makes more sense when you have a lot of laptops, servers and other such nuggets around. The workstations enter a centralized environment and have access to everything else on the network from there.
Point is, I don't know my password and currently this laptop is the only nugget that can actually get this password out of the password store.. but it was locked. You motherfucker for a lock screen! I ain't gonna restart lightdm, make it autologin again and lose all my work! No no no, we can do better. So I took my phone which can also access the management host, logged in as root on my laptop and just killed mate-screensaver instead. I knew that it was just an overlay after all, providing little "real" security. And I got back in!
Now this shows an important security problem. Lock screens obviously have it.. crash the lock screen somehow, you're in. Because behind that (quite literally) is your account, still logged in. Display managers have it too to some extent, since they run as root and can do autologin because root can switch user to anyone else on the system without authentication. You're not elevating privileges by logging in, you're actually dropping them. Just something to think about.. where are we just adding cosmetic layers and where are we actually solving security problems? But hey, at least it helped this time. Just kill the overlay and bingo bango, we're in!2 -
How much zucchini is too much zucchini?
I know I have WAY too much...
I knew at least when 1st considering D20 zucchini breads.
then when i began to wonder if the remaining batter would work with my death star waffle iron...ill know tomorrow!
....ran out of typical pans, incl foil ones(normal and mini for easy gifting)
- gave 1 away (similar sized as in pic)
- approx. 2 lg zucchini bread loaves in fridge (gave away 2, ate a ½)
- cut up\froze enough onions\peppers\pak choi to a min. acceptable zucchini : everything else stir fry ratio... x20 servings
- similarly, green onions, pak choi, marinated sesame fried tofu bits, zucchini and miso (quick miso soup) x16
- thinly sliced enough to layer it into ~20 lg servings of lasagna.
... zucchini in pic is slightly larger than the one that made the many aforementioned and pictured loaves of zucchini bread
apparently, in a week tops, I'm gonna have at least another 3 more THAT size needing to be picked
anyone in the continental US want some zucchini bread? or, if in michigan, zucchinis?
i didnt even plant much... actually only about ½ of other years.
i am also having some serious overflows coming of (at least) grapes and watermelons.
grapes...
when i bought this place, this odd, square, surrounded by cement walkways, area, with an increasingly problematic tree (risking cable\electric lines, foundation, etc) and so dense with weeds that I learned, dandelions have a giant, bush-like form, with heights beyond 8ft tall.
i grew up hanging out in the nearby woods, noticing that weeds lost the fight vs raspberry\blackberry plants. being handicapped\lazy\experimental, w\ev, i figured id just kill it all then fill it with random berries... knew nothing about grapes so just got 4+ random types... apparently they are all fancy\expensive grapes... and reeeeeaally produce. i already had to pick ~10lbs.
watermelons-
idr if i planted normal ones and little ones or just little ones... idk how to tell without cutting them open or maybe just watching a long time to see if they stopped growing?
anyone with advice (or seeking watermelons) is welcome.
assuming (hoping) they are mini ones there's at least 2dz that are at least ping pong ball size.... and around 100 little yellow flowers still.
i totally get that my frustrating problem with produce here would be beyond welcomed by most people... but seriously... wtf do i do with a few dozen to over a hundred (hopefully mini) watermelons, so many zucchini that, despite personal daily consumption and at least a half dozen friends that love zucchini bread and\or my secretly healthy lasagna(my friends tend to be guys), but have their limits capping out, plus mine, at less than ½ whats rapidly being produced and, apparently, thousands of dollars worth of hundreds of pounds of fancy grapes???
there's an interesting old lady across the street who'll take at least what her and husband can possibly consume,.. even makes grape jam, but thats still only a few dz lbs tops.
it seems wrong to kill the plants (or even to remove a large amount of blossoms and feed them all to JSON (lil tortoise)... pretty sure he's already getting tired of them just from the few that fell off in the wind or something.
i wish i knew some farmers that do farmers market things... but that kinda seems super suspicious... 'hey mr farmer... want a large supply of expensive grapes, watermelon and zucchini, for free? you can sell them to random people, or just give them away. i dont want money or anything...' idk... seems like the beginning of one of those movies that either has evil alien plants assimilating all land mammals, or where there's some crazed medical researcher convinced that there's a massive, underrated threat without enough attention for vaccination production funds-- so they are gonna release some deadly virus supposedly to save the world.
ive been cooking too long.
ideas pl0x?86 -
EVERY FUCKING TIME I HAVE TO ASK FOR SOME DNS CONFIGURATION OTHER THAN A SINGLE "A" RECORD THE TI HEAD MANAGES TO FUCK UP...
WHAT THE FUCK IS SO HARD DUDE???
CNAME? OK!
FUCKINGSUBDOMAIN > FUCKING.ALIAS.COM
THIS TIME OUR FUCKING PROVIDER CANT MANAGE ROOT DOMAIN CNAMES SO WHAT DID HE DO?
SIMPLE SAID "ALL DONE" AND ONE WEEK LATTER PEOPLE ARE COMPLAINING BECAUSE THE FUCKING ROOT DOMAIN ISN'T WORKING...
COME ON DUDE, JUST KILL YOURSELF.
AND FOR THE FUCKING MILLIONTH TIME: DOMAIN REGISTAR AND DOMAIN MANAGER ARE TWO SEPARATE FUCKING THINGS! YOU CAN REGISTER YOUR FUCKING DOMAIN ON GODADDY AND MANAGE IT ON FUCKING CLOUDFLARE BY CONFIGURING THE FUCKING DNS SERVERS5 -
Hey this is my first post on This new fitness-tracker-app community
I will tell y'all my workout :)
-programming a parser
FUCKING HELL PLEASE STOP ALREADY THIS IS THE WORST SHIT IVE EVER DONE EVERY WHERE IF STATEMENTS JUST TO CONSUME FOUR FUCKING TOKENS I DONT WANT TO DIE BUT I'D LIKE THIS PROJECT TO BE FINISHED ALREADY BECAUSE THIS IS ANNOYING AS FUCK I REALLY WANT TO KICK MY COMPUTER WHILE TELLING IT TO BE THE MOST STUPID BRAIN ON THE WORD AND THEN REMEMBERING THAT ITS NOT A BRAIN FUCK MY FUCKING FUCK HELL THEN I WOULD KILL THE PEOPLE WHO THOUGHT THAT MAKEING std::vector::end() RETURN AN ITERATOR WITHOUT ELEMENT WAS FINE AND THEN I'D KILL ALL THOSE WHO COME INTO MY ROOM THUS DISTURBING MY WORKFLOW
Enough rage.4 -
Latest Yandex browser (Chromium based) throws an error if "document.hasStorageAccess()" is called (:
Ie the StorageAPI that allows cross-site cookie access on user-interaction
the iFrame sandbox flags that compliment it, ie "allow-storage-access-by-user-activation" also fails on execution.
Both of these work on Edge/Chrome/Firefox.
I thought Firefox and Chromium browsers are all ive to deal with and im done but NO.
Now within Chromium-based browsers theres differences of API as well?
Kill me.11 -
Does anyone else think some of the Sonar rules are actually crap?
In particular the Put all you variables above methods one?
I have some static methods and variables and some object ones.
Apart from creating a new class for them which I think is over kill for just a few helper methods, don't you feel you should keep all static stuff separate?
Clean code shouldn't be about following arbitrary debatable rules, it should be preventing the horrible crap that any experienced developer would instantly call shit... If he didn't write it.
And I'm pretty sure I'm experienced so if I'm not calling a price of code shit...I don't see why Sonar should...1 -
There comes a time, when you look into the mirror and you realize that what you see is all that you will ever be. Then you accept it or you kill yourself, or you stop looking into mirrors.4
-
## building my own router
I hoped things would go more smoothly :)
Anyway, my new miniPC easily accepted CentOS 8 - no fuss here. And I've got to say - I love CentOS8 so far! Shell has amazing nifty tricks, UI (gnome3) is also snappy, video/audio/ethernet,.. everything works.
What I did NOT expect is hardware being off. Well okay, the price was low - it was obvious smth is not right. But still.. I decided to build my own router so that I could swap wifi card whenever I want. So that I could run my own network services in there. Turns out - the card swapping is not as easy as one might think.
I got the AX200 WiFi6 card for that very purpose. But once plugged in the OS can only see it's bluetooth module. Weird... What's even weirder is that even though the card is PCIe, the OS uses btusb module to talk to that device. What? USB?? emm.. What??
And there it is. After opening it up again I noticed that the mPCIe area is marked with a label: "USB WIFI / WWAN". USB? Does that mean this PCIe slot is wired into the USB bus? Not impossible I guess.
Googling for a "pcie wifi over usb" or smth like that brought me to one reddit (I think?) where someone wanted to build a DIY wifi mPCIe -> USB adapter and someone else adviced hime that (for some reason) at best he could only get bluetooth working (hey! just like me!). It's got to do smth with pcie channels and USB being too weak to handle all that load, or smth.. IDK, I'm not a HW guy.
Well that sucks then! I have a mPCIe slot that does not work as a PCIe. Shit! So I guess the best I could do is to plug back in the same wifi card that came with the device. It smells like 2003 - supports only g protocol. Fine, let's try that. Maybe I'll find a way to work around this mPCIe limitation later on (USB adapter or smth... except there are no USB WIFI6 dongles yet :( ). So I plug it back in and start turning it into a router. Disable NetworkManager, configure static NCs' settings, install dhcpd, hostapd, bind and others. Looks like all is done! Now it's time to start it all. systemctl start hostapd --> FAILED. wtf? journalctl says it could not initialize a driver. umm okay? Why? Forums say I should airodump-ng check and kill whatever's using that device. Fine. airodumo reveals avahi and wpa_suppl are still using it. kill, kill, GOTTA KILL 'EM ALL!! Starting hostapd again -- same shit... wtf?
iw list
My gawd... That shitty network card does not even support AP mode :( I mean.. My USB wifi dongle for 2€ supports 2x more modes, is faster, has better range and is easier to work with than this old tart!
Yeah. That was an interesting day. When enfironment engineers break my testing environments at work I'm glad I have where to spend my time now.
BTW any ideas how to bypass this mPCIe nonsense? Come on, there are USB GPUs out there.. Why can't they make a USB (or dual-USB if they really need to) mPCIe adapter?8 -
VirtualBox is fucking evil
It wants the humanity to disappear due to self doubt, random errors and depression
AAARRRGGGHHH
KILL VBox BEFORE IT KILLS ALL11 -
I am forced to work with a client's notoriously slow SOAP api. Slow in this case is 1.5-2s per request.
The api is structured rather... creatively... at the same time. So we have to bombard it with thousands of requests to build our data base with historical SOAP data. Also the data sometimes is a couple of hours late, giving a flat line (all values at 0) until retroactively fixing the output for the same requests.
So to fill one dev data base with a year's worth of historical data (nice to have when testing a dashboard application) we hammer the api with ~20k requests (~1 million if we want to be thorough).
Best thing about that: There is no staging/test api and the prod api seems not to handle lots of requests at the same time very well...
Latest thought: Maybe we could put a varnish cache in front of the SOAP for testing. Better have wrong data, than nothing at all and we don't kill the prod clients every time we ramp up a new instance.
Also that would dramatically decrease the 4.2 hours of data pumping to about 7 minutes after the first run. -
Had junior devs work on a new feature on a project I spent days fixing. They spent days on the new feature but built it off of the broken version of the project and never pulled from the repository. Now when I merged their new feature onto the working and correct branch, their feature is all broken. I swear Im going to kill them all.3
-
Apple is fucking EVERYONE over with Safari 12. They are changing how extensions communicate with the browser, they are calling the new type of extensions Safari App Extensions. It means all current Safari Extensions will not work in Safari 12.
The problem with this is that they require all extensions to have this “backend” written in Swift with a VERY LIMITED API. Maybe you want to close a tab with your extension? “Fuck you, you’re not allowed” are Apple’s response to that. On top of this shit show their documentation is horrendous.
They will kill the extension ecosystem with this new approach, I’m sure of it, because most of the current extensions will not be able to migrate all their features to the new approach. They have built the API around specific extension types, so lots of extensions will simply not work in Safari 12. For distribution they will only allow extensions to be distributed via their new(?) Extension Store where they will review your code, just like an app for App Store. Unless you’re in the Apple Developer Program, which is $99/year.
I do not understand this change and I think it will hurt Apple in the sense that people will use other browsers where extensions are not as strictly controlled. Usually I understand Apple’s changes but this one is just beyond me. 🦆 you 🍎. -
My New medication is !AMAZING....
Yesterday went to the Doc (another 100€ sniff) and got a new update on medication...
(check my profile history for the posts last weekend if ya curious).
One of them must be opium or something... I got so high It looked like Opium (I never did heavy drugs).
Now I'm falling all the time, Can't remember much last night and... man... I use/used Cannabis as medicine for years (on and off as needed) ... Still, remember when I could get high... And the highest time was when I learned cannabis it's great to stop suicide (A friend got me so stoned I couldn't move... Even if didn't really take out the tendencies and thoughts to kill yourself, you can't do it anyway...)
But this new Pill... ONLY SHEEAAATTTT...
Only problem,,, I can't really do shit Until my body gains tolerance... and I was doing so much cool ideas in my Office...
Btw, no more Space Again... The more drawers I place, the more stuff gets here...
But I think I'll lose all my energy again for the next months, so, fuck it.3 -
Fuck you Mobike!! Stop polling your applog.mobike.com server literally every 10 fucking seconds when your app is not even running! And why the fuck did it suddenly start last night, of all things? It's fucking creepy and invasive.
Related question: does anyone know how to permanently shut down a background app service on an unrooted android 7? Even if I kill the background process (not the app itself - that one has not even been opened), it still restarts a minute later3 -
So i wasted last 24 hours trying to satisfy my ego over a shitty interview and revisiting my old job's codebase and realising that i still don't like that shit. just i am 25 and have no clue where am i heading at. i am just restless, my most of the decisions in 2023 have given very bad outcomes and i am just trying doing things to feel hopeful.
context for the interview story-----
my previous job was at a b2b marketing company whose sdk was used by various startups to send notifications to their users, track analytics etc. i understood most of it and don't find it to be any major engineering marvel, but that interviewer was very interested in asking me to design a system around it.
in my 1.2 years of job there, i found the codebase to be extremely and unnecessarily verbose ( java 7) with questionable fallbacks and resistance towards change from the managers. they were always like "we can't change it otherwise a lot of our client won't use our sdk". i still wrote a lot of testcases and tried to understand the working of major features.
BTW, before you guys go on a declare me an embarrassment of an engineer who doesn't know the product's code base, let me tell you that we are talking SDKs (plural) and a service based company here. their was just one SDK with interesting, heavy lifting stuff and 9 more SDKs which were mostly wrappers and less advanced libraries. i got tasks in all of them, and 70% of my time went into maintaining those and debugging client side bugs instead of exploring the "already-stable-dont-change" code base.
so based on my vague understanding and my even more vague memory from 1 year ago, i tried to explain an overall architecture to that interviewer guy. His face was screaming the word "pathetic" from his expressions, so i thought that today i will try to decode the codebase in 12-15 hours, publish a cool article and be proud of how much i know a so called martech system design. their codebase is open sourced, so it wasn't difficult to check it out once more.
but boy oh boy i got so bored. unnecessary clases , unnecessary callbacks static calls , oof. i tried to refactor a few classes, but even after removing 70% of codebase, i was still left with 100+ classes , most of them being 3000-4000 files long. and this is your plain old java library adding just 800kb to your project.
boring , boring stuff. i would probably need 2-3 more days to get an understanding of complete project, although by then i would be again questioning my life choices , that was this a good use of my 36 hours?
what IS a correct usage of my time? i am currently super dissatisfied with my job, so want to switch. i have been here for 6 months, so probably i wouldn't be going unless i get insane money or an irresistible company offer. For this i had devised a 2 part plan to either become good at modern hot buzz stuff in my domain( the one being currently popularized by dev influenzas) or become good at dsa/leetcode/cp. i suck bad at ds/algo stuff, nor am i much motivated. so went with that hot buzz stuff.
but then this interview expected me to be a mature dev with system design knowledge... agh fuck. its festive season going on and am unable to buy any cool shirts since i am so much limited with my money from my mediocre salary and loans. and mom wants to buy a home too... yeah kill me3 -
So I work at a big IT company. Keep in mind you could say I'm lucky to be here my last job was as a mechanic. So they put me on this team filled with the most draining kunts I've ever seen.
I have been here for about a year and I am yet to be put on a project, so im just training. They asked me to get certified to be on a project which is complete bullshit because every other fuckwit is on a project and noone is certified.
ONTOP of this, there's no work to be done anyway, yet they keep hiring fucking Grads. LIKE FUCK OFF, get work for the rest of us first you fucking IDIOTS.
Anyway, the cert is the driest fucking content, like kill me now, I try to read about it and I just want to blow my fucking brains out.
Like is IT all like this? I used to work at a web design company and that shit was fucking fun, but paid like $2 an hour the cheap fucks.
Anyway that's my rant, I'm sitting my exam tomorrow for this cert and honestly, I don't even know why. I literally know ZERO. fucking going in to guess this shit. would rather go down to bunnings buy the coarsest piece of rope and just dangle like a fat dick.
Anyway cheers lads. have a great day5 -
I'm literally in pain right now and not a thing I can do.
If I eat whatever the fuck is wrong with my jaw (cracked tooth or cavity) starts throbbing from the chewing action, in addition to coming on for no reason at all. vision-blurred-waves-of-nausea levels of pain. Enough that I'm alternating between laughter and almost tears.
I've downed four aspirin and it's still just barely enough WITH the numbing gel.
Got lock jaw something aweful.
Barely convinced a dentists office, which is supposed to be closed (and cancelled all it's appointments due to corona), to come in during quarantine. But thats monday. Dont kno how I'll make it. They do payment plans but I'm flat broke because I decided to pursue programming right when all this fucking bullshit went down.
And all I can think of while im typing this is the pain.
And fuck me I cant do weed because my backup plan if I fail at coding is the military.
And this stray dog that the neighbors 'adopted' but leave outside WONT STOP FUCKING BARKING.
Fuck me. Just kill me now. Do it.
Gonna go watch comedy because I read a research paper that says genuine laughter raises pain threshold by up to 10%.12 -
When your IT VP starts speaking blasphemy:
"Team,
We all know what’s going on with the API. Next week we may see 6x order volumes.
We need to do everything possible to minimize the load on our prod database server.
Here are some guidelines we’re implementing immediately:
· I’m revoking most direct production SQL access. (even read only). You should be running analysis queries and data pulls out of the replication server anyway.
· No User Management activities are allowed between 9AM and 9PM EST. If you’re going to run a large amount of updates, please coordinate with a DBA to have someone monitoring.
· No checklist setup/maintenance activities are allowed at all. If this causes business impact please let me know.
· If you see are doing anything in [App Name] that’s running long, kill it and get a DBA involved.
Please keep the communication level high and stay vigilant in protecting our prod environment!"
RIP most of what I do at work.3 -
Thursday
Project Manager: Reckon we can get a demo/status update tomorrow?
Friday:
*status update*
Project Manager: Alright great
Monday 1pm:
*basically a shit tonne of noise all morning, can't get anything done*
Project Manager: Reckon we can get a status update right now?
*status update*
Project Manager: Alright, reckon you can demo it on Friday?
Me: Uh...
Project Manager: Ok, let's aim for a demo anyway.
Research Lead: Great!
Org Lead: How is everything going?
Me: I don't like how Project Manager micromanages.
Org Lead: Ahhh, yes, but it was me that asked him to manage like this
Me internally:
What's 65 - 28? Oh yeh, 37 more years of this. Is there a way I can kill myself painlessly?10 -
Client be like:
Pls, could you give the new Postgres user the same perms as this one other user?
Me:
Uh... Sure.
Then I find out that, for whatever reason, all of their user accounts have disabled inheritance... So, wtf.
Postgres doesn't really allow you to *copy* perms of a role A to role B. You can only grant role A to role B, but for the perms of A to carry over, B has to have inheritance allowed... Which... It doesn't.
So... After a bit of manual GRANT bla ON DATABASE foo TO user, I ping back that it is done and breath a sigh of relief.
Oooooonly... They ping back like -- Could you also copy the perms of A on all the existing objects in the schema to B???
Ugh. More work. Lets see... List all permissions in a schema and... Holy shit! That's thousands of tables and sequences, how tf am I ever gonna copy over all that???
Maybe I could... Disable the pager of psql, and pipe the list into a file, parse it by the magic of regex... And somehow generate a fuckload of GRANT statements? Uuuugh, but that'd kill so much time. Not to mention I'd need to find out what the individual permission letters in the output mean... And... Ugh, ye, no, too much work. Lets see if SO knows a solution!
And, surprise surprise, it did! The easiest, simplest to understand way, was to make a schema-only dump of the database, grep it for user A, substitute their name with B, and then input it back.
What I didn't expect is for the resulting filtered and altered grant list to be over 6800 LINES LONG. WHAT THE FUCK.
...And, shortly after I apply the insane number of grants... I get another ping. Turns out the customer's already figured out a way to grant all the necessary perms themselves, and I... No longer have to do anything :|
Joy. Utter, indescribable joy.
Is there any actual security reason for disabling inheritance in Postgres? (14.x) I'd think that if an account got compromised, it doesn't matter if it has the perms inherited or not, cuz you can just SET ROLE yourself to the granted role with the actual perms and go ham...3 -
When I have to updates the apps for the second company of my boss:
5 apps, 4 different projects, 4 stores.
Each app with different VR SDK, which makes the differences minimal, but still can't merge the projects.
It takes about 1h to build all of the apps (like 30m just for the iOS ones), 5minutes to 5 days to make the edits, 1-2 weeks of debugging and testing, plus the time the stores take to actually publish the apps
Always makes me wanna kill myself -
God I hate vscode
it keeps giving me a pop-up telling me I don't have a php environment setup
I have no interest in using php. that's why I don't.
and now apparently the git interface got changed. I don't want stupid random changes
and frequently in some part of the IDE it'll say error but then not show up where the error file is for example
Microsoft bought GitHub and all the atom people said they were gonna kill atom and push their vscode, everyone called them paranoid, Microsoft released a statement saying they weren't gonna kill atom. a year later they killed atom. so now I have to use this stupid vscode shit. and if you go anywhere asking for an IDE suggestion and you mention "not Microsoft" the mods will literally ban you for "being political"
how about I just don't want a bloated goddamned IDE that I don't control
in atom I could just uninstall other languages packages. actually atom didn't even come with them, they were optional. vscode, like all other shitty ass IDEs, is increasingly coming with everything and the kitchen sink -- and only one version, Microsoft's, so if you don't like it fuck you
atom was so good because it was modular. they fucking killed it. and we're back to bloated shit. I guess because if shit is bloated you can argue "we need all this data from you" and so they fucking bloat to justify themselves15 -
A little story which happened my SECOND day on the floor after getting hired to do customer-facing phone support for my current job (can't mention the name, NDA). Customer from Detroit calls in:
Me: "Thank you for calling (company), my name is Guru, how can I assist you?"
C: "Uhhh, yeah. I need to get back into my ID. I can't backup my tablet or phone, and y'all are kinda holding my data host-" <Loud gunshots>
C: "oh! Shit!" <sound of running feet>
Me: "Everything OK sir?"
C: "Fuck! Naw! Hang on!" <more running, jumps a fence, skids to a stop>
C: "Ok, I'm safe, I'm safe... So what I gotta do to get y'all to let me back into my shit?"
*MUTE* Me: "First of all, what the fuck are you doing on the phone with me when you should be either A) calling the cops because, I dunno, just maybe some trouser stain is attempting to kill you, or, B) FIRING BACK, MOTHERFUCKER!!"
*REAL* Me: "OK, first you gotta… (outlines step 1,2,3... etc)
C: "OK, that sounds easy enough. I'll try it when I get to the office, I'm on my way there now- shit. Hold on again..."
(talking to someone on the street): "what, him? That dude? Over there? That dude... In the shirt?What the fuck!? Are you sure? Hold on, sir! I'ma call you back..."
Last thing I hear before the line lets go is a large BOOM!
Sometimes it's best to just sit back and sip your coffee...6 -
I will literally pull out you soul, grill it, and then put it back into you just to kill you, roll you up in nice mustard, pickles, bacon, pepper and salt and then roll you over with beef so I can properly make a roast and then, when you're ded, I will take your soul again to just torture it for all eternity.
....didn't have my coffee yet, guten morgen12 -
So I recently finished a rewrite of a website that processes donations for nonprofits. Once it was complete, I would migrate all the data from the old system to the new system. This involved iterating through every transaction in the database and making a cURL request to the new system's API. A rough calculation yielded 16 hours of migration time.
The first hour or two of the migration (where it was creating users) was fine, no issues. But once it got to the transaction part, the API server would start using more and more RAM. Eventually (30 minutes), it would start doing OOMs and the such. For a while, I just assumed the issue was a lack of RAM so I upgraded the server to 16 GB of RAM.
Running the script again, it would approach the 7 GiB mark and be maxing out all 8 CPUs. At this point, I assumed there was a memory leak somewhere and the garbage collector was doing it's best to free up anything it could find. I scanned my code time and time again, but there was no place I was storing any strong references to anything!
At this point, I just sort of gave up. Every 30 minutes, I would restart the server to fix the RAM and CPU issue. And all was fine. But then there was this one time where I tried to kill it, but I go the error: "fork failed: resource temporarily unavailable". Up until this point, I believed this was simply a lack of memory...but none of my SWAP was in use! And I had 4 GiB of cached stuff!
Now this made me really confused. So I did one search on the Internet and apparently this can be caused by many things: a lack of file descriptors or even too many threads. So I did some digging, and apparently my app was using over 31 thousands threads!!!!! WTF!
I did some more digging, and as it turns out, I never called close() on my network objects. Thus leaving ~30 new "worker" threads per iteration of the migration script. Thanks Java, if only finalize() was utilized properly.1 -
Twitter comments are shit
How the fuck to use them? Why don't they just show one under another? If post has more than 2 replies it can be clicked to open its direct replies, some of them are shown in main thread, some of them are shown under opened thread. Some replies from main thread are shown under child thread. And to make it even worse any comment of sub thread can be expanded as well showing some random replies that could be expanded recursievly so you may end in main thread again. It is just impossible to read all replies in chonological order. Show me the moron who made this, I wanna kill him....1 -
Developers more than other groups tend to hold their operating system or programming language of choice dearly, to the point where if someone thinks poorly of the OS or Language, they take it like a personal attack. Then there are those who think poorly of people who who's a certain OS or a specific language. Combine the two and you get hurt feelings and identity crisis.
Can we all just agree that we're all in different stages of learning and that we all generally end up going the same direction for the same types of problems?
Or just have it out and kill each other over it. Will give me great rant material.3 -
Well my last job was nothing but a call center with AT&T, but I will tell the story of how I got my current job which is also my first job as a developer.
I was living in Texas. I just moved out of a house I was renting and my girlfriend at the time moved back to Missouri and she was about 5 months pregnant.
She wanted us to all be in Missouri because that's where her family is. No big deal for me, but we didn't have a place to stay yet in Missouri and it was difficult to find a job in a city that has very little to offer in what I do, and of course, wants experienced people despite what said they were looking for.
For 5 months I kept looking for a job while I stayed with my parents and worked at the call center and she with her mom and stepdad so I could save up to not only make the trip to Missouri but to be able to make a payment on a place which we were also having trouble finding.
Even if I didn't have a job or if we didn't find a place, I was not going to miss the birth of my child. So, within about 3 weeks of her due date, it was time for me to make the trip to Missouri. I still haven't found a job but at least we were going to have a place ready for my child within the week. With all the money I saved, we could get through a couple of months of rent, bills and necessities, but still needed to find work.
After only a week after we got the place, I almost gave up so I started to apply at restaurants as a backup after I found a couple more places. The restaurants were quick to respond and I had interviews scheduled for the week that I applied. I knew I was going to be miserable working at a restaurant, but I needed a job, any job. As a last attempt, the day before my first interview with one restaurant, I found a new posting for an entry level position early in the morning. I quickly sent in my resume but didn't expect anything until weeks later. It only took a few hours for a reply and he wondered if we could do a phone interview. I said yes, of course. After the interview, he said that he had one more person to interview but he would let me know. I thought, great, there goes my chance. After only an hour of waiting, while I was looking for more places to apply, he calls me back saying that he wants to hire me. Immediately after I got the job I cancel my other interviews and I started the next day.
It was great I got the job, but it was a far drive. However, they did offer telecommuting, but I had to come in every day until they felt I understood their work flow. I did inform my boss that my son would be born really soon but he was okay with letting me take off when it was time.
I started on a Wednesday in May of 2014 and made the 1.5 hour drive every day. After only working 10 days, my girlfriend calls me at work saying that it's time for the baby to come but it would be a while so I could finish my shift and then come straight to the hospital.
I get there but still no baby. It was a long labor which ended up in C-section at 4 in the morning the next day. My son was finally born on a Wednesday and it was the greatest thing in my life.
But now, I am a single dad(about a year now and it was mutual) and I am the only developer as of a couple of weeks ago. Despite how they handle things and my annoying coworker that sits next to me which I have ranted about in a previous posts, I do enjoy working there trying to improve and move the company forward. After all, I work from home 3 days out of the week now. The rants will still come lol.
Sorry for the mood kill at the end but that's my story. 😁 -
A bit late.. and not much about how to learn to code..but more of a figuring out if the kid has a right mind set to do so..
If the kid is not the type to question everything, not resourceful, not a logical/critical thinker, gives up easily and especially if not interested in how things work then being a dev is most probably not for them.. they can still persue coding, but it will end badly..
From my experience, people who have a better education than me, but lack those skills turned out to be a crappy dev.. not interested in the best tool to complete the tasks, just making 'something', adding more shit to the already shitty stack.. and being happy with that.. which of course is not the best way to do things around here..or in life!!
Soo.. if the kid shows all that and most importantly shows interest in learning to code.. throw him the java ultimate edition book and see what happens.. joke!
There are plenty of apps thath can get you started (tried mimo, but being devs yourself it's probably not so hard to check some out and weed out the bad ones) that explain simple logic and syntax.. there is w3schools that explains basics quite well and lets you tinker online with js and python..
so maybe show them these and see what happens.. If it will pick their interest, they will soon start to ask the right questions.. and you can go from there..
If the kids are not the 'evil spawns' of already dev parents or don't have crazy dev aunties and uncles, then they will have to work things out themselves or ask friends... or seek help online (the resourceful part comes here).. so google or any flavour of search engines is their friend..
Just hope they don't venture to stack overflow too soon or they will want to kill themselves /* a little joke, but also a bit true.. */
Anyhow, if the kid is exhibiting 'dev traits' it is not even a question how to introduce it to the coding.. they will find a way.. if not, do not force them to learn coding "because it's in and makes you a lot of moneyz"..
As with other things in life, do not force kids to do anything that you think will be best for them.. Point them in direction, show them how it might be fun and usefull, a little nudge in the right direction.. but do not force.. ever!!!
And also another thing to consider.. most of the documentation and code is written in english.. If they are not proficient, they will have a hard time learning, checking docs, finding answers.. so make sure they learn english first!!
Not just for coding, knowing english will help them in life in general. So maaaaybe force them to learn this a bit..
One day my husband came to me and asked me how he can learn.. and if it's too late for him to learn coding.. that he found some app and if I can take a look and tell him what I think, if it is an ok app to learn..
I was both flattered and stumped at the same time..
Explained to him that in my view, he is a bit old to start now, at least to be competitive on the market and to do this for a living, but if it interests him for som personal projects, why not.. you're never too old to start learning and finding a new hobby..
Anyhow, I've pointed out to him that he will have to better his english in order to be able to find the answers to questions and potential problems.. and that I'm happy to help where and when I can, but most of the job will be on him.
So yeah, showed him some tutorials, explained things a bit.. he soon lost interest after a week and was mindblown how I can do this every day..
And I think this is really how you should introduce coding to kids.. show them some easy tutorials, explain simple logic to them.. see how they react.. if they pick it up easily, show them something more advanced.. if they lose interest, let them be.
To sum up:
- check first if they really want to learn this or this is something they're forced to do (if latter everything you say is a waste of everybodys time)
- english is important
- asking questions (& questioning the code) is mandatory so don't be afraid to ask for help
- admitting not knowing something is the first step to learning
- learn to 'google' & weed out the crap
- documentation is your friend
- comments & docs sometimes lie, so use the force (go check the source)
- once you learn the basics its just a matter of language flavour..adjust some logic here, some sintax there..
- if you're stuck with a problem, try to see it from a different angle
- debugging is part of coder life, learn to 'love' it4 -
Been ‘working’ on this game for the last 5 months now. I love making it but I haven’t gotten any where because there are too many bugs. Like, it’s all bugs.
I started the project when I started learning game development and with all the time I’ve put in it I don’t want to kill it.
Anyone else have a project that they are working on, where they don’t even make progress on it, they just fix bugs?2 -
It was about 2:30am.. The darkness had been dominating the outside for a while, and I was having issues with my partitions on my CentOS server. Yup that's correct. I think.
I really wanted to go to bed. Last thing I had to do, was re-allocate some space from centos-home to centos-root. But I fucked up, of course I did.
After about half an hour of making food and trying different stuff to solve the "Can't read superblock error" error, I found an answer that just lead to "Can't read secondary superblock error, sorry".
At least they apologize now lol.
I ended up trashing the centos-home volume (is volume and partition the same ?) and just smashing it all onto centos-root. I lost some data, but screw that, stuff is working and I'm not going to bed.
Yeah, stuff is working. I hope. No errors encountered yet.
Moral of the story: Home partition isn't needed and it's okay to kill it1