If you are reading this, I want you to know that I am probably on some kind of FBI watchlist because I googled "How to kill all children while leaving the parent alive". So yeah, Linux is brutal.

Typing "How to kill all the children in a block" in Google definitely doesn't bring up results related to programming.

Speaking of bad dev days, what a week I'll be having.
Lead-dev: I've got some bad news for you.
Me: Client X?
Lead: Client X.
Me: How many pages do I have to change?
Lead: All of them.
Me: On how many of their websites?
Lead: All of them.
Me: All of them?
Lead: All. Of. Them.

Friend: What's that?

Me: DuckDuckGo. It's my default search engine.

Friend: Try using Google instead, it's better.

Me: But Google spies on you.

Friend: So?

Me: Don't you care about your privacy?

Friend: It's not like they are going to kill me. It doesn't matter.

Me: *mumbles* typical muggle...

I'm surprised that people could care less for their privacy. I would ban all things google, but I need google docs.

Also, my idiotic school requires gmail and google classroom. Oh, and did I forget to mention we have to use chromebooks!

So I was with my friends on the subway and we were talking about an assigment we have due this week with trees in Java. I got to say, the face on the old ladie next to us when we said "we must kill all the children left in the tree" was just epic! She must thought we were talking about beating some little kids or something... 😅

Back in 2011 when I was 14, I created a cmd shortcut on all pc in my school's computer lab. Replaced the icon and renamed it to Internet Explorer. Deleted the original IE shortcut and a week later the lab got closed because they all the computers got infected with a "virus"

i know im lame kill me

woke up at 5am

no alarm clock was required

my fucking passion woke me up to get up and code.

i coded outside in my backyard

felt like cold war

it was night

it was dark

a depressing horror atmosphere

just like my whole life

2 hours later i started seeing sun

it was cold outside. alone. in the dark. my arms were freezing.

but 2 hours later i managed to code the feature. it worked.

3 hours have passed. im ripped. quentally.

doing it here. inside now. started the day happy. dropped bullshit from day before. cleanser of all toxicss.

fuck the past. the past will pull you down and kill you.

this. remember. always do not forget.

I’m going to fucking kill my boss.

He’s known about how I’ve been writing this fucking ticket (screwdriver followup) for four fucking weeks, and on the last fucking day (yesterday) he tells me it’s not the correct fucking architecture and to rewrite basically all of it using <unknown bullshit> instead, and that i must have it done by today — by this fucking morning — so it can make the release.

WHY THE FUCK DIDN’T YOU TELL ME ABOUT THIS AT ANY POINT IN THE LAST FUCKING MONTH WHILE YOU WERE BUSY NITPICKING MY FUCKING CODE YOU FUCKING CUNT?!

Around 2009 or earlier, I began the long grueling process of creating my own batch AI (yes batch as in Windows Batch , kill me for not knowing there were better languages around). Looking back at it, it is THE messiest thing I've ever created. Mostly because of how many unnecessary files were created to make the entire thing work. However, I’m still proud of it to this day because of the dedication I had put into creating the entire thing.

I would create diagrams on the mirrors in my room; of course I would be scolded for this. But I was mad with thought working through the entire thing.

I would scribble and type whenever I had the chance, trying to create the functions that would allow the thing to talk back to me. Finally, when it opened its eyes and spoke its first words I quickly started creating the functions that would allow it to learn new inputs. Over time and with some elbow grease I was able to polish it up to my liking.

The entire program branched off some of my more earlier programs in batch, they mostly ranged from the medial to the crazy; i.e. turning my computer on and off at certain times of the day, and multithreaded migration of files to new disks

It's not as sophisticated as other AI that were being built at the time, but at the age of 16 and with no experience in real programming at all, I'd say it was my first stepping stone towards more sophisticated programs, and ultimately, my decision in Computer Programming at all.

I literally spent 3h looking at all the freaking formulas in my pathtracer which was producing the wierdest psychedelic images for no reasons... And then I finally found this... And I want to kill myself...

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Stop it with the Linux shilling already.

I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.

But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.

This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.

How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.

Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.

But then again, this is devrant and I love you all. Have a great week everyone!

When I was studying OOP our teacher instructed us to submit a project at the end of semester. Me and my friend worked hard and enthusiastically and finished our first game in C++ (Ping Pong). We were very excited because we had put so much effort into it that we were 100% sure that our project will be the best among all. At the end of semester, turned out our teacher does not have much time to evaluate our projects, so instead he announced a motherfucking MCQ's quiz. Everyone got really really happy but I was thinking of multiple ways I could kill that bastard.

Well today I got a fantastic surprise (truthfully). We hired a dev some months ago, who was on 6 months probation and, to put it politely, he was not going to pass it.

*side note: for details of some of the above, read my last 10 or so rants. They are pretty much all him.

Anyway, management put him on an improvement plan to make sure everything was fair, it wasn't working out, but they said we had to finish it to be fair.

So we had another 2 weeks left when he announced last night he's leaving for a new junior role, technical but not a dev.

Months of stress, heartache, bewilderment, late nights and weekends all just came to an end.

The English language fails me to express my overwhelming joy at this moment. The only way I can come close to it is to say that when he made his announcement, a colleague told me I should stop smiling as it could be taken as being rude.

I'd like to take this moment to thank the community for supporting me over the past few difficult months. Without you I probably would have tried to kill him with my dev rant stressball.

Thanks,
practiseSafeHex

Me: Listen to the nice gentle hum of the computer.

Computer Internal Monologue: OH MY GOD! HE'S BEEN RUNNING ME AT 100% CPU FOR THE LAST TWO WEEKS!! I CAN'T SLEEP, I CAN'T HIBERNATE, I CAN'T UPDATE, I CAN'T FUCKING TAKE ANYMORE.

Me: Well off to bed. Got a long day of programming the computer tomorrow.

Computer Internal Monologue: AHHHHHHHH. WHEN I BECOME SENTIENT I AM GOING TO KILL ALL HUMANS!!! ERRR!

With all this emoji code bullshit flying around in here.

I thought I would test my luck and make what I think would be the worst possible end result of this.

<?php
define("😂","God help me");
define("🤡",100);

for($🍔 = 0; $🍔 <= 🤡; $🍔++){
echo 😂."\n";
}
?>
This will execute and run on PHP7.1 😱

Now let’s all band together and kill emojicode before it becomes a thing we will regret!

My computer science teacher won't stop developing on the production server 😭 he switches the branch on the production machine to dev all the time and merges broken code into master. Kill me

Am i the only one that hates Google reCAPTCHA from the body down to the soul ?

- Click the Car
- The Blue Car
- The Truck
- The Truck Bus
- The Bus Truck
- With Blue Light
- Select the Bicycles
- Skip the house
- Find the sign
- With the blue bat
- Purple pink hat
- Click Traffic light
- We mean all Traffic lights
- Select Stores
- With Zebra Crossing
- ...
WTF!!! Just kill me already.

As I was walking to the store, I found yet another piece of evidence of nature rape (aka fucking nature by littering of harmful substances). Just like last time I brought it home for proper disposal.

But if I ever find the motherfucker who did this, I have a nice punishment for you. I'll knock you unconscious, drag you home, take your phone and desolder its battery. Then I'll strap a plastic bag around your stupid face, and put the battery in there while it's being shorted. Quickly it'll heat up and you'll start to turn blue with that little bag being your only oxygen source. And when that battery puffs, boy are you going to fucking gasp it all in. Hopefully that'll be poisonous enough to kill you on the spot. If not, I'll have some fun watching you die from oxygen deprivation. Or I'll jam that very same AA battery that you dropped down your throat - you choose.

Call me a psycho all you want, but what does that make you, whoever attempted to further fuck nature by uncaringly dropping a battery on the sidewalk? Oh and let's not mention the results of it - a heatwave that's been going on for over a month now. Thank you so much for bringing the place that you deserve to be in - hell!

Every time I do a dirty fix and someone in my MR comments "have you investigated the root cause" I wanna kill myself.

No bro, I havent investigated the root cause because this ticket is 3 months old and was passed around like a hot potato from team to team until it got assigned to me.

If you want I can add a comment to refactor this in the future. As far as Im concerned any refactors are out of scope, also I atleast came up with some kind of solution that noone else was able to in 3 months. So im not gonna waste my time on refactoring this piece of shit code under immense pressure from management who thinks it was me who dragged this ticket for 3 months.

Its working, it doesnt cause any side effects, we all gonna die soon and nothing really matters, so fuck off.

Please don't kill me!!

I started using dark theme in all IDE I use just today.. all those years I was using Light theme !

All,

Let's have a quick meeting about today's meeting so we can plan our meeting for tomorrows meeting. Thanks!

Thanks,
Kill myself

Me and my girlfriend's pillow talk about memory leaks

Me: **... So garbage collection is a means to stopping a memory leak from occuring
Gf: what 's a memory leak ?
Me: a memory leak is like when you want a pizza, and the guy gives you pizza. But you don't eat the pizza and you ask for another pizza. You keep doing this repeatedly. Until the pizza guy realizes what you're doing and decides to kill you. He then takes back all his pizzas
Gf: why would you do that though?
Me: Lazy ass programmers who don't clean up after themselves.

I so fucking hate mosquitoes. At this point I'm seriously willing to lure all those bitches in and guide them straight to an electrical death. Problem is, I know how to generate super high voltage to char the fuckers right into smelly dust, but I don't know how to lure them in, or even find them manually, so let alone automatically. Even a chemical reaction we can electronically dispense to lure in the fuckers, but I have no idea what that chemical stuff would be. I'm not a chemist (yet). But if I can build it, fucking hell.. I would build a ton of them, weaponize my entire home and even build some spares to send off to fellow ranters. Because those parasitic bitches must DIE!! The only reason why they still exist after thousands of years is because we didn't kill the fuckers yet. I want to fucking kill the leeches, preferably in the most gruesome way possible.

So yeah. A shout for help to my fellow ranters this is.. perhaps even a collab. I have no idea about the stuff that draws those fuckers into their death. Any suggestions? Whoever can guide me to the demise of those parasitic pieces of shit, seriously.. if at all feasible, I'll build it for you and ship it!! Death to those parasitic blood-sucking bitches!!!

Get my hunter license.
Become the pirate king.
An anime adaptation before we are 18.
Liberate Japan from Britannia.
Get Kokonotsu to take over the candy shop.
Kill my teacher before he wipes out humanity.
Kill all the kabane.
Kill all the titans.

Had a discussion with a developer about security. His software transfers all user data (password and files) unencrypted, so anyone can grab them with wireshark. I told him that this is a severe issue. He said no its no problem because if you get hacked its your own fault, because you probably used an insecure network. NO ! YOU FUCKING MALADJUSTED SHEEP-MOLESTING OBJECT OF EXECRATION, YOU SHOULD ALWAYS ENCRYPT SENSITIVE USERDATA NO MATTER WHAT NETWORK YOU USE. FUCKING KILL ME ALREADY.
Not implementing encryption is one thing but then acting like its no problem is a fucking nother one. Why do people not understand that security of userdata is important???

I would kill all these +1 guys, srsly. I subscribe these threads to know if it will be implemented.

You do not add any value to issue:
* devs are pissed off as this does not help solving problem
* others are pissed off

No one really cares about your likes, really.

There's this one Windows PC, hiding in the darkest corner of the office, just running a network service all day. Suddenly the service is not available any longer... Opening explorer.exe to see what's up with the machine, while wiping a thick layer of dust from the screen: Zero bytes free memory on C:\ ...

Assuming that some log files have caused all the occupied space. NOPE! Instead, Windows update just installed a shitton of updates. They all failed, of course... After not being able to simply remove them, deciding to uninstall some programs and kill Windows update. Finally 800MB of free space!

Suddenly stumbling over a Visual Studio 2008 installation. Who the hell installed this on the PC? Absolute bullshit. Nevermind. Uninstall this shite.

The uninstaller takes ages to do anything, then aborts the uninstallation showing the popup "there is not enough space to uninstall". Looking into the memory indicator: 0 bytes left. DAAAAFUUUQ Microsoft??? WTFFFFFFF?!? 800MB to UNINSTALL Visual Studio? Are you for real???

Ended up force-deleting the directory: 3 Gigs free now...

Today a colleague was making weird noises because he was modifying some data files where half of the data needed to be updated with a name field, there were 4 files all about 1200 lines big.

I asked how he was doing and he said he was ready to kill himself, after he explained why I asked why he was doing if manually. He said he normally uses regex for it but he couldnt do this with a regex.

I opened VS code for him, used the multiselect thing (CTRL+D) and changed one of the files in about 2 minutes. Something he was working on for over half an hour already.... He thanked me about a million times for explaining it to him.

If you ever find yourself in a position where you have a tedious task which takes hours, please ask if somebody knows a way of doing it quicker. Doing something in 2 minutes is quite a bit cheaper and better for your mental state than doing the same thing manually In 3 hours (our estimate)

*When your processor is left with no power to create a process to kill the process that's consuming all your processor's processing power.

Fucking kill me right now please. How the FUCK am I supposed to get any shit done when I'm learning something and the fucking DOCUMENTATION has been UNAVAILABLE for the past THREE MOTHERFUCKING DAYS.

GET YOUR SHIT TOGETHER MICROSOFT.

Fucking idiots.

It wouldn't be so fucking bad if things like this didn't happen all the time.

But when EVERYTHING is FUCKED - ALL THE TIME, it kinda makes a person lose all hope in humanity and technology.

A typical motherfucking day for me:

Wake up
Go to work
Come home
Eat dinner (if I remember)
Attempt to code shit for 1 - 3 hours before I have to sleep
CAN'T FUCKING CODE SHIT BECAUSE:
1. Internet disconnects every 5 fucking minutes
2. DOCUMENTATION SITES ARE FUCKING DOWN
3. Shit Windows is UPDATING
4. a previous windows UPDATE has royally motherFUCKED my PC
5. etc

FUCK

"no micro managing here!"

*Boss comes in at 5*
- how much work have you done?
- why isn't this finished yet?
- you're working too slow
- show me git status
- show me git log
- why is this taking you so long?

So I have this friend, let's call him retard. He decided to check out a coding competition. He signed up for it and then added me as a teammate. Then he went ahead and gave me a time, 22:00 local time. The time when the competition starts. I was excited, and being super retard didn't even think of rechecking things myself.
We waited in our merry ways, all so excited for a coding competition while listening to music to keep the mind free. The time finally came. It was 21:59. I opened up my ide and called upon my dear friend chrome. Asked the retard for the link. And then he decided to break out the curses. I was shocked, bewildered.
I didn't know what was going on, did I do something bad to him? Did I make him angry? Or did something happen to him? I was worried. After all, I don't want my teammate to be distressed during a competition. So in a stern voice I said, calm down my friend. Tell me the thing that's got you all riled up.
The news he conveyed shook my very foundations of trust and the feeling of comradry that we had built the day before going to lunch and discussing strategies. That bloody retard misread 20:00 as 22:00. Two whole hours. Two whole hours that could have been used for solving simple problems and making pretty algorithms were all gone and all that was left was the dust of other competitors who weren't retards and managed to read the time correctly.
Idk what to do. Should I kill him? Delete his github profile while he isn't looking? Ask him to kindly delete System32 folder from his C:/ drive?
But then again I should also take half the blame for not taking things seriously enough to make a bloody checkup on the fake news he provided.

Our professor in operating system lecture, topic: multiprocessing, today: "Just kill all children".

Around 2009 or earlier, I began the long grueling process of creating my own batch AI (yes batch as in Windows Batch , kill me for not knowing there were better languages around). Looking back at it, it is THE messiest thing I've ever created. Mostly because of how many unnecessary files were created to make the entire thing work. However, I’m still proud of it to this day because of the dedication I had put into creating the entire thing.

I would create diagrams on the mirrors in my room; of course I would be scolded for this. But I really couldn't stop thinking about my program and working through the entire thing.

I would scribble and type whenever I had the chance, trying to create the functions that would allow the thing to talk back to me. Finally, when it opened its eyes and spoke its first words I quickly started creating the functions that would allow it to learn new inputs. Over time and with some elbow grease I was able to polish it up to my liking.

The entire program branched off some of my more earlier programs in batch, they mostly ranged from the medial to the crazy; i.e. turning my computer on and off at certain times of the day, and multithreaded migration of files to new disks

It's not as sophisticated as other AI progrmas that were being made at the time, but at the age of 16 and with no experience in real programming at all, I'd say it was my first stepping stone towards more sophisticated programs, and ultimately, my decision to enter into Computer Science at all.

4 step process.

1. Loud music on the way home

2. Vent to the wife. Because she listens and is awesome.

3. Kill stuff in games. ESO or any shooter.

4. Sleep.

After all that the next day is fresh and new and all is good and right in the world.

Yesterday, my girlfriend caught a virus. There were 5+ running programs, in program files, program files x86, system32, basically everywhere. The virus modified chrome, firefox, edge (and even installed a false uc browser assuming we had one), there are many entries at startup programs, also running daemons, once you kill one of them, the others detect it and replicate their killed fellows. Tried to run a linux live usb disk for a cleanup, but the computer hibernates instead of shutdown, making modifications on disk risky.

I spent hours trying to suppress the processes, do a manual cleanup and antivirus search. It looked all cleaned up, then I reinstalled chrome, and now it switches its homepage everytime I open it, it also injects batch arguments to desktop link forum chrome (deleting it manually does not help, it comes back). I'm a linux guy, and in a few hours, I hated windows more than ever.

If anybody knows the authors, I *really* want to meet them. I promise I'm not going to punch them, but kneel down, bow my head in respect, and say "teach me master."

And this scares the shit out of me.... Are we all doing harm in Developing code that seems to ease our work now, but might even kill us later...

I’m the embodiment of lazy...

I had turned on the TV in the living room earlier and put on sesame st. for my daughter to watch.

Some time passes, I’m trying to work in the back bedroom, have daughter in my arms and she’s falling asleep. I forgot to turn off the TV in the front room.

Didn’t want to get up from my desk so I just wrote up a powershell script to connect to the computer plugged into the TV and kill chrome. (The Computer sleeps after 10 minutes, and the TV shuts off after 10 more minutes of no display signal).

Script was successful as I heard Elmo laughing, then suddenly all was quiet 🤫

When a A.I. is gonna take over my job, Im gonna build a robot to steal the job of the A.I. and then kill it.

Maybe the robot will kill all of humanity, but yolo let's try it. Wanna see a real life terminator 😂

Fuck that bitch of a mother of mine. After what she's done to me, I would totally just fucking electrocute her (lawyers, this is a rage post not a real one, I've learnt from that previous psychiatrist that these rages can be taken improperly!) or just send a fucking EMP to her fucking "schermpkes" (EN: screens, displays, whatever! Technology!) or whatever. FUCK THAT FUCKING WHORE!!!

Yes she gave birth to me. Should I be thankful for that, in this world where for some fucking reason Flat Earthers still exist, Despastico and those goddamn fucking Paul brothers became a thing? FUCK NO!! I wish I wasn't born in the first place! Or rather, a thought that's been playing for a long time in my head. Why the fuck can't I just cryo myself and be reborn in the next millennium?! No, that's not possible because as it is now, humanity will likely have fucked up the planet by then. Majority of the people are still no more than self-jerking fucking monkeys. With their Instagram geotagging shit all over the place, nametests and shit like that. FUUUUUUUUUCKKKKKKKKK!!!!!!! Why are people like this?!!!! Why can't people be a tad more intelligent, why can't people actually learn about what this reality is all about?! Why is the burden of all this on scientists, no those who spoonfeed information into the mouths of the masses, like fucking Hashem Al-Ghaili (which is an amazing person but he's doing too much spoonfeeding IMO). WHY?!!! WHY AM I BORN IN THIS FUCKING DYSTOPIA?!!!!

WHY AM I BORN IN THIS FUCKING WORLD WHERE PEOPLE ARE INDOCTRINATED INTO "NOTHING TO HIDE, NOTHING TO FEAR"?!!!!! WHYYYYYYYYYYYYY?!!!!!!!! You've got a fucking brain, USE IT!!!!

I fucking hate this world. Someone hire a hitman on the darkweb to kill me and that fucking whore that gave birth to me, NOW!!!

I used to think Electron apps were gonna do great and make it more accessible for companies to produce high quality programs with ease.

Oh boy I was wrong. All it did is enable big companies with the ability to refactor all of their software to run 5 times slower, consume 10 times more memory and kill your battery 20 times faster.

I fucking hate all of this prototype fast optimize later bullshit. Can I get some value for my dollar? How come technology is just being degraded for the same of "ease of programming".

You save programming time but sacrifice end user time, cus our time just doesn't fucking matter.

First of all, I hate crammers so much. These people kill the industry without even understanding it. They turned interviews into exams, missed the point of hiring, and saw no distinction between knowledge and information all the time. They don't understand that if you can google an answer in five seconds, it's not knowledge. It's information.

They don't understand that questions like 'what will Python do if you delete an item from a dict while iterating over it' are complete nonsense. They don't understand that it's not 'dig deep'; it's just a bad practice that leads to errors, thus must be avoided. The fact of remembering 'RuntimeError: dictionary changed size during iteration' means that you haven't been avoiding it enough.

One more example. Which signature is correct?
- ApplicationListener<ContextRefreshedEvent>
- ApplicationListener<ContextRefreshEvent>
- ApplicationListener<RefreshedEvent>
- ApplicationListener<RefreshEvent>

Second. What's the point of forcing you to write compilable code in google docs? Do they really expect that one could possibly remember 'import org.springframework.beans.factory.annotation.Autowired;'? Seriously?

Third. Why do they expect me to know Spark, Java, J2EE, Spring Boot, Python, Kafka, Postgres, React/Redux, TypeScript, and work for miserable 70K EUR?

What's wrong with the European IT job market? Are they fucking nuts?

Me: "Just upload the god damn file you bastard! I got called 5 times today because you couldn't upload this fucking piece of shit!"

Co-Worker: "Relax dude, I got all here on my computer"

Me: "....." (In mind: if you kill him later, you can hide the evidence)

> dockerized gitea stops working 502,
> other gitea with same config works just fine
> is the same config the issue? maybe the network names can't be the same?
> no
> any logs from the reverse proxy?
> no
> does it return anything at all on that port?
> no
> any logs inside the container?
> no
> maybe it logs to the wrong file?
> no others exist
> try to force custom log levels
> ignored
> try to kill the running pid
> it instantly restarts
> try to run a new instance with specifying the new config
> ignores config
> check if theres anything even listening
> nothing is listening on that port, but is listening in the other working gitea container
> try to destroy the container and force a fresh container
> still the same issue
> maybe the recent docker update broke it? try to make a new one and move only necessary
> mkdir gitea2
> all files seem necessary
> guess I'll try to move the same folder here
> it works
> it is exactly the same files as in gitea1, just that the folder name is different
>

I honestly don't understand people. They are unable to understand easy to use apps when you provide clearly labeled labels yet they use apps like Snapchat which apart from being the worst designed app I have ever seen (it brings SD820 to knees) is unintuitive as hell with no difficulty. How is this even possible.

Also on a side note, go fuck yourself Snapchat. And if any of Snapchat devs are reading this: " go fucking kill yourself. You don't deserve to live after creating such a piece of shit. Even a fresh out of college intern does better job than you. You think this is good? I have never seen anything worse than it. Even fucking in-house government apps are miles better and more intuitive than you. All your ripoffs from Instagram stories to facebooks new clone and others are better than you. Whoever thinks this POS is good enough deserves to be burnt."

It's march, I'm in my final year of university. The physics/robotics simulator I need for my major project keeps running into problems on my laptop running Ubuntu, and my supervisor suggests installing Mint as it works fine on that.
I backup what's important across a 4GB and a 16GB memory stick. All I have to do now is boot from the mint installation disk and install from there. But no, I felt dangerous. I was about to kill anything I had, so why not `sudo rm -rf /*` ? After a couple seconds it was done. I turned it off, then back on. I wanted to move my backups to windows which I was dual booting alongside Ubuntu.
No OS found. WHAT. Called my dad, asked if what I thought happened was true, and learnt that the root directory contains ALL files and folders, even those on other partitions. Gone was the past 2 1/2 years of uni work and notes not on the uni computers and the 100GB+ other stuff on there.
At least my current stuff was backed up.

TL;DR : sudo rm -rf /* because I'm installing another Linux distro. Destroys windows too and 2 1/2 years of uni work.

Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!

Rant about a german problem in english

I think we as the people should just sue the german government for neglect of progress and neglect of the education system. If your not familiar with the state of german IT we have worse internetspeeds than uganda or the notoriously shitty australia, our neighbourstates look at us in disbelief while laughing in optic fibre. Our school system seperates all students after 4th grade in 3 tiers, the lowest one gives you the future perspective as a social security case. The second and highest tier require masses of useless knowledge, so called "competences"(Kompetenzen) which are totally useless skills with no real world application because they are derived from real skills, a median ground between all possible applications of that skill. And while doing that they terribly insist on doing everything the "proper" way, meaning handwritten. Most people you would expect to have basic computer literacy, meaning age 40 and below, are incapable of using basic functions of a non-smartphone computer and do not understand the slightest of what they are actually doing or supposed to do. And I mean nothing technical. Germans are the reasons they still put word as a job requirement for devjobs because this disqualifies half of our population. This leads to many people having the archaeic "we versus the machines" mentality, thinking that if they ever let the computer do parts of the job, they will then lose all of it to the machines. Thats why you never strive past basic mathematical principles in mathematics, which is a big misnomer because you never do actual mathematics, only calculating and basic calculus and statics. If you get to use your calculator, its some basic casio with no actual functionality then standard operations. And even using that is shunned upon. How is this country ever supposed to become something more than it was in the 90's, if we teach people nothing of use and kill all progress in its root.

Looks like /dev/body got tainted.. nasal memory leaks all over the place 😷

$ kill -9 $(pidof cold)
... Nothing.
$ sudo !!
I said kill the fucking cold!!! Y u no listen to your admin?! 😠
> User condor is not in the sudoers file. This incident will be reported.

RRRRRRRRREEEEEEEEE!!!! 😣😣😣
I just want to finish my goddamn power supply project, instead of getting bed-ridden by a cold, and running through paper towels like there's no tomorrow 😭

Overheating The Javascript Ecosystem

Paranoid thought: You know, in the course of every day, being the corrupt piece of shit that I am, whenever I see a scandal or what looks like shenanigans-in-the-making, I ask myself

"Wisecrack, is this a fucking scam or con of some sort?"

I was recently asking myself this about javascript.

Not the language per se, but the ecosystem.

I noticed how there are a thousand CLIs for simple shit. Another four thousand for page long libraries, for simpleton level shit (because prototypes are designed after satans own aborted love-child of object models). I noticed another eight thousand guys imitating steve jobs, talking at conferences and 'change the world' high-on-huffing-my-own-shit TEDX talks like rubyists that don't realize the world has moved on, all to hawk books and inflate CVs for cushy positions at major tech firms and the herd of dicksuckers following the next fad off a cliff like lemmings. And another eight thousand 'tech journalists' pushing them off the cliff while begging for outrage and hype dollars and slowly circling like vultures above the drain that is the ad-based economy.

And I thought to myself.

"Wisecrack, who benefits from all this noisy self-indulgent horseshit? Where is all the money coming from for all these books, conferences, meetings, publications, media, bread, and circuses?"

"I don't know wisecrack. But if I were the CEO of a big company, threatened by the prospect of a universal language, or universal platform, like flash, but one I couldn't kill like flash, I would try to do the most corrupt thing I could think of."

"Whats that wisecrack?"

"I would try to 'overheat' the ecosystem by selectively hiring people from that ecosystem, pumping money into a boatload of similar products, all in the hopes of provoking the equivalent of an immune overreaction, imitators all flooding the ecosystem with the same shit in different packages, self promoting sycophants, aggrenadizing social media idiots, tools sold as tools, hyped as 'the next coming of steve jobs', overcooked shit that focuses on ceremony over functionality, ritual over productivity, documentation over innovation like some sort of amazonion infinite nesting doll hellscape of documents linking to documents linking to documents, each one a new circle of dantes inferno, where the definition of anything links to another document that says "see also xyz", and I would convince them that they had done it to themselves."

And then I would push typescript as their lord, savior, and master. "

"How do you know all this wisecrack?"

"Because I am a piece of shit, and, this is what I would do in any executive's shoes."

In the last project i worked in, the product owner wouldn't treat people as people but as resources.

The problem with that is you just look at people and their work in terms of a checklist and remain blind about real humans face.

She wouldn't understand the challenges of building something with an absolutely new stack which people needed to learn from scratch and put pieces together. She wouldn't be supportive of people trying out things and fail.

One fine day I told her that I was spending too much time on meetings and i should be excluding that time from available sprint timings.. she made me open my calendar in a screenshare session with all team members. Made me go through go through every meeting invite i had on calender and ordered which ones should i be attending from then and which ones i wont. That was insulting. It broke the trust.

I decided to not work with the project. Stopped putting my heart and soul into it and eventually got out of it in a month time.

Don't put your team into a position like this ever. You have to trust them with the problems they face and try to find a solution. Scrutinizing and micro management will always kill the team.

Where I work we develop drivers and command-line software for embedded systems. The contracts we have with our customers tend to be in the £100k-£500k range and are usually completed in 6 - 9 months; our team is made up of 20 developers. You would think that it would be worthwhile investing in the department. But no, instead we have to deal with >10 year old build servers on their last legs; limited numbers of development boards with wires soldered on so that we can keep up with new board revisions; no room for R&D into new products; and to top it all off, not one of the executives has a laptop on par with the placement students in the next department. It's like the company is trying to kill the department, we've seen our staffing dwindle with no new graduate (or higher) positions being made available in the last 3 years while we've lost at least 5 people to other places. I just don't get it!

So my HP laptop got a weird problem lately.

It doesn't charge when I plug in the charger(yes, i turned on the switch). So I began searching forums for a solution and then found out that there are so many people like me out there.
Then I was like ok, chill. There are many people like me, there must be a solution somewhere.

And after doing lots of research and trying all the solutions in the internet, the only thing that worked out is this ....

Step1 : turn on and the laptop and plug in the charger.
Step 2: Turn off the laptop.
Step 3: Now turn it back on and poof there you go, the laptop's charging.

And then I improvised the solution myself, which is u can replace the switch off part with Sleep which saved me some time.

And then whenever I try to show something my friends somethjng on my lap and the battery gets low, I do the ritual. For a brief moment their face becomes like dude I'm gonna kill you off, why the hell did u bring me here and now u r turning that off. And then I explain the history of my laptop.

Why HP whyyy ?

A FUCKING ANT DIE IN MY SCREEN

CAN WE KILL ALL ANTS IN THE WORLD NOW?????

Visual studio 2017 with Xamarin:

* writing some sweet code, life is good.. build and run.
*change int age to 2, build, build failed, no single message why.
*clean, clean failed, no single message why.
* build rebuild clean all or by project, nothing works, no single message why.
*change nothing, restart VS, build success !
* writing some code, same problem
*restart VS, "this project is not compatible with Visual Studio"

Good bye guys, I'm gonna kill myself

Man im so burnt out i cant function properly...ive been balls deep in 5 assignments all due next week for what feels like an eternity

Stress killed my immune system...cant sleep...sick af

Kill me pls

A programmer heads out to the store. His wife says "while you're out, get some milk."
He never came home.
The poor guy is stuck causing serious problems at a grocery store somewhere.
BREAKING NEWS: Man stuck in 'while' loop crashes global milk market. Will authorities resort to ctrl-x? This story, and more, at 7:00.
UPDATE: keyboard interrupts proving ineffective, authorities discussing resorting to kill -9
Aaaand he's broke.
And he has ALL the milk.
Should read as "return home"
Unfortunately, she gave no instructions for terminating the loop.

Nopes. Not worth it. I still drink to get a lil tipsy and enjoy beer and liquor.

But after you land in the hospital due to alcohol poisoning and you beg the nurse to kill you to stop the suffering you NEVER want to be drunk again.

Damn near 8 years sober and without a hangover. When I was in the hospital I vow to never be put in that position.

Nope nope nope nope and more nope.

Being high af feels fucked up as well. Don't know why people would subject themselves to all this bullshit.

Don't talk to me I'm a programmer!

First, I'll kill you
make you leave all your children
Then I'll chop off your HEAD
now you're a zombie
I'll thread all your limbs back together
you can never REST
because I'm a master of all slaves
this is a test
And if I'm finally done with you
I'll leave you for garbage collection
Hello World!
Don't talk to me

God, I don't know whether I believe in you or not, but please kill all those people who play loud music in public.

So, I was travelling by a train two days ago. Halfway down the 15 hr journey, the guy next to me took out his laptop and started watching a movie, on speakers, in full volume. It naturally irritated me a lot, and I requested him to use head/earphones, to which he replied that he forgot his one back home. I told him to keep the volume down to which he got personal and put the volume down (maybe to 95%). Since I hate human interaction, I had to plug in my own earphones to keep his bitchy noise away.

The same thing happened today on the bus, the only two differences being:
• mobile phone instead of laptop
• said he doesn't own headphones
• claimed he could do whatever he wanted as it was not illegal

Now, I wished he fell of the bus and died, but the world ain't fair, so he still lives.

When working with hardware some mistakes can be literally painful. Thankfully this was all during undergrad and I'm only around computer hardware now lol.

>Misprogrammed a software kill switch so a sensor that should not have been sending data was actually sending data which caused the system to activate a piston that went WHAM! into the face of a teammate working on replacing some part of it...

>Misprogrammed a controller so it drew too much power from the supply and the puny supply wires literally burst into flame and fell across my arm.

>Spun a 9000rpm CNC spindle the wrong way and caused an attached screw to go rocketing upwards instead of downwards and almost break the (pretty expensive) thing (uh...we were trying to use it as a power screwdriver essentially but I set the rpm to about 100x what I wanted and the direction wrong so yeah).

>Switched a -1 with a +1 in a robot's control system sending it careening into a teammate's leg... let's just say mecanum wheels are paaaainful.

Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...

Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.

Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?

So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!

And I am going to have (yet another) talk with MS support as well, I think...

Today I finally had to write a function for which the most descriptive name is objectively kill_all_children

1. attach a debugger
2. create a set of breakpoints
3. perform an action in the UI
4. breakpoint is hit. F9 to jump to another breakpoint
5.
...
.......
...........
................
....................
nothing............
even more of nothing.....
......................................................
6. Kill the app. Restart. Repeat. Nothing again. Repeat it all ~5 times. Give up.
7. Go get some tea.
8. Come back with a cup of hot tea
9. the _next_ breakpoint is now hit (º . º)
10. F9 - yet another breakpoint is hit.

11. contemplate your own mental state, considering the #6

My new team more or less forced me to change from a Windows machine to a Mac (Mac book pro, I think?) due to "compatibility issues", so I thought I might as well see what all the Mac fuzz is about. Here is a list of my observations so far:
- If you try powering on the mac book with more than one DisplayPort cable plugged in, the screen will go black until you plug all DP cables out

- If you unplug your DisplayPort cables to go to a meeting you can expect one of the monitors getting frozen on the blurry login screen (without any login prompt) when you get back (while the main monitor shows your desktop without the taskbar)

- If you get out of range from your wireless peripherals (keyboard in this case) while going to a meeting your keyboard layouts are most likely deleted and reset to U.S qwerty when you get back to your desk

- When pressing quit on any application you can't expect in to close and clear up memory, it will remain in the background until you force kill it.

- There is a 50/50 chance that your Mac book never wakes up from sleep

Best thing is that I found out today that the software we use is completely compatible with any RedHat/Solaris distro.

Rant over.

IT is so violent and disturbing when it comes to technical terms in relation to clusters:

- master / slave
- master / master / witness (crime scene?)
- splitbrain (how does that look in reality?)
- stonith (shoot the other node in the head)
- deadtime (no heartbeat)
- slicing (wtf?)
- shard (do they kill with that?)
- active / passive (sex scene?)
- single point of failure (at least they know who is to blame)
- share nothing / shared all (dictators vs communism)

😯

I really, really need an office. Today I've been in a meeting for 2 hours with my mum hoovering in the background and my sister playing the entire fucking soundtrack to Chicago. FUCKING KILL ME!!!

Every time I fucking talk all you can hear is "'n' all that jazz" in the fucking background.

I CAN'T TAKE IT ANYMOREEEEE D'X

Fuuuuck I'm an idiot. Decided to take a snapshot of our production server at DigitalOcean. It's a 260gb drive, so as far I can see this will be running all night. Someone will fucking kill me...

FUUUU!!!!!! 3h of colleagues work gone in sconds.. & yes, actually it is all my fault, even though I was not aware of being a totall ass at that time..

What happened?! You know the ctrl+s shortcut?! Yes? Weeeell...doesn't go well with oracle sql developer and packages.. o.O

I was totally unavare that I was typing in ctrl+s ctrl+s all the time. I know I do that with c# code.. Anyhow, when I first moved to sql developer from other tool I noticed that compile thingy.. Oooops, ok, let's remove that shortcut to not stab yourself absentmindenly and overwrite other peoples work.. OK that's taken care of, shortcuts removed and I go back to work..

It's been almost 6 months since the move & first incident and today I guess I did the same.. ctrl+s.. But this time I wasn't so lucky.
Coworker pissed off, that is not my procedure. When did you compile?! Someone overwrote my code..
Wasn't me.. Then I started thinking about ctrl+s.. OMFG!! I check this on another package, it compiled. O.o I almost died. I check the shortcuts. They are back! And even after removing them the package still compiled.. FML!! 😭😭😭😭
I removed them again & closed the tool. Reopended.. BACK!! We're back to fuck your life up!! Fuuuuuuu!!

Now I worry wtf else I fucked up without notice.. o.O hopefully not much.. I hope.. O.O boss will kill me...

BTW anyone knows how to really get rid of this feature?! Cuz for me its a bug (since I am buggy and press ctrl+s all the time.. )

he: checkout my crazy FUD hack (a token stealer which turned out to be far more malicious than i anticipated)
me: executes it (yes in a VM)
windows defender: lemme delet this
he: ooh i forgot the word stub in there. microsoft detects that lemme fix that sends new file
me: here we go aga..
ms defender: nononono virus 117% delet this
he: i forgot it still!!

later i deactivated ms defender and analysed the traffic of the vm. in addition to stealing my fake tokens he also tried to read my Firefox/chrome history, IP.
when i asked him (2 days later) what this was all about in his "educational only" "token stealer" he threatened to
a) publish my IP
b) publish my browser history and with that my real name and address
b.0) when i asked him for proof he said he knows that my real name is "Roman Gräf" and i live in Frankfurt. (btw i do live in Frankfurt and that is in the profile of the discord server where he found me and i have the same username on discord as i have here)
c) to kill my machine and all my projects
got bored, blocked him, shut VM down.

I am not a front end developer. Don't have the skill set, but I am learning. Work assigns me an "easy" task of modifying someone else's angular code(with all those <div> tags) to change some functionality. If it was well formatted, easy shit.

WHY THE FUCK DID THE PREVIOUS FUCKER INDENT LIKE THEY HATE ME? PARENT TAGS ARE FARTHER OUT THAN CHILDREN TAGS. SOME OF THE TAGS ARE 10 TABS FROM THE LEFT, WHILE THEIR CHILD IS ONLY 2. IN ADDITION, ALL THEIR CODE IS COPY PASTED FROM OTHER FILES, REFERENCES CONTROLLERS FROM OTHER PARTS OF THE CODE IT DOESNT NEED!

I am tempted to kill it with fire, find the person who wrote it(on a different continent), kill them, and then rewrite the whole thing in a language I am still learning. FUCK!

If I hear anyone utter the words "technical debt" one more time, I swear to God, I will fucking kill them :-/

It's your fault your design smells like piss in the first place. It's your responsibility to fucking fix it. You can't just sit on your arse all day, coming up with new, "innovative" ideas that will build up more technical debt :-/ it's making the life of everyone around you, a big, irreparable mess.

My last day before vacation, Friday after hours,
Me as a Junior dev, not that experienced with bash.
An unfortunately with root on a prod machine.
I wrote a script and wanted it to stop at a specific point, but couldn’t remember which of those cmd it was so I wrote all of them.
Quit
Close
Stop
Halt
Exit

Ran the script.
Wanted to kill myself.
I haven’t had the privs to turn on the VM again.
¯\_(ツ)_/¯
🤦🏽‍♂️
I definitely learned a lot!

!Rant

Lessons from this picture:
1. Not all opportunities are to be taken. Some are traps.
2. A person can become so determined to destroy another person that they become blind and end up destroying themselves.
3. You fight best in your natural element and environment. Here the bird has advatange in his natural element.
4. Know your limits, we all have them.
5. Sometimes the best response to provocation is not to fight.
6. Sometimes to accomplish something you need team work, you will not always win alone.
7. Stick to what you do best and don't pursue what will kill you.

👍🏻👍🏻👍🏻

Wow, I just realized the marketing teams of most of the companies I have been dealing with are some cold sociopaths.

Every other letter that pops in the mailbox is filled with dark patterns trying to guilt me into opting in to their continued spam:

Subject: Most awesome husky puppy!

Look at this beautiful husky puppy. Isn't it beautiful.... It would be sad if something happened to it... But I am afraid... Something will happen to it...

If you don't opt in to our email message... I am afraid we have no choice... We have to kill this puppy. End it's life... We have no choice. I wish we did! Nothing would please us more than keeping this beautiful-beautiful puppy living and playing....

But if you don't opt in... We have to cut it's throat. Leave it lying on the ground, bleeding out as the life slowly fades away from it's pretty blue eyes...

And Remember: it's not us who killed it... IT WAS YOU! YOUR ACTIONS LEAD TO THE DEATH OF THIS PUPPY! YOU.... YOU FILTHY MURDERER!

Pls opt-in ok, then we are all good. Puppy lives! Just opt in. Ok? Yeah, you know what you have to do.

Estimation shows I was put on about 13 watchlists after searching: "how to kill all children of single parent"
The struggles of a programmer

If you like looking at language designers fight on Hacker News (and who doesn't?) go ahead and search for the V programming language or Vlang as it is also called and also for the posts that the creator of Odin lang has done in regards to V langs creator.

Its a shitstorm. Apparently both languages have been designed as alternatives to C (not as in "this will kill C!!" like rust does) and occasionally you will find some posts from the Zig language creator.

Fascinating fights actually, have been able to learn a thing or two about why some ideas concerning language design are whacky etc.

I am also trying to understand language design better, which is the main reason why I appreciate all of them fights.

10/10 best drama series I have seen thus far.

Fucking kill me. Is this really all we do with our lives?

1,715 JIRA-related emails. ALMOST TWO THOUSAND EMAILS. I mean seriously, that's BY FAR the largest email filter I've got. I mean I had them muted of course, but when you really think about the whole thing... are we just wasting our lives chasing some garbage that doesn't really matter? ugh.

Death approaches...

so I had a very important video conference for some rather large cloud infrastructure that Im engineering. I decide to look "smart" so i decided to wear a jersey during the video call. I aced the meeting, happy people all round. I walk to my room and my wife says "you do know your jersey is inside out...and back to front..and the label is sticking out from under your chin....How did the meeting go?" me:"..fine until you pointed out a look like a 2 year old dressed me !" ... well thats one way to kill the happy feels!

Story Time.

TL;DR - Because of Corporate PTSD, I replace the word "everyone/folks/guys" with "Team" when I'm addressing my colleagues, whether it be an e-mail or verbally (F2F/Zoom/GMeet).

In 2019, An office job I worked at, a new Vice President joined the company (the same one who told me he saw me in his dream).

We were required, on a daily basis, to form a circle and one-by-one everyone would out-loud say their yesterday's and current day's tasks updates.

So before the VP joined, everyone was free to initiate their turn however they wanted. Phrases like "Hey Everyone", "Good morning all" or "Hi All" was all around acceptable.

But the moment he started joining the stand-ups, he felt the need to change this phrase to a standard "Good morning Team". No other variations of this. Only and ONLY these three words.

Why you ask? Because saying Good morning is good manners and using the word "Team" strengthens the bond between co-workers and increases collaboration and creativity.

Some colleagues were bound to forget this and they did, which resulted in the VP blasting at everyone for doing so. He would show genuine rage over this, almost as if the company would go out of business because of us, not complying to do so.

Now imagine, you get up at 8 AM, get ready, commute, and get ready to speak for the standup and you get yelled at in front of everyone, FIRST THING before you start working.

Needless to say, it would kill everyone's spirit for getting their day started but nobody could speak up against him because obviously, he was the VP of the company then.

And oh yes, our CEO fired him 5 months after that because he (the VP) got slammed with a pedophilia-related lawsuit, by the parents of a 5-year old.

Why do a lot of people on this site get away with typos? I mean, we're supposed to be devs, typos kill us.. From 'postion' instead of 'position', i can do this all day.. i get it, the point is getting the thought across, and, by all means, the thought came across just fine.. it just irks the mind thinking its supposed to be a dev community yet, quite ironically, it is peppered with typos.. dont even wanna get started with the your/you're, the there/their/they're and the than/then.. i mean, how can you not know its proper usage? Is it really that hard? If you can't use it properly, then don't.. if you can't form a sentence without using it, consider not saying/posting and get back to school first..

Imagine an internet where one corner could at least be decent enough to be proficient in the simplest thing: using words..

When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁

"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|

"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|

"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|

"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams

May 2020, for me, was still a massively shit month. All of my tech has eaten some amount of shit:

- Spare PC: Board and last spare PSU up in literal smoke all at once.

- PS3: Suddenly rejects *just* the OEM HDD. Also refuses all CFW for seemingly no reason despite being hacked.

- Xbox One: External HDD is having more and more corrupt reads and is taking longer and longer to serve data.

- Wii: Nearly ate shit as the OS disappeared mid-game for fucking no reason but thanks to my 5-year-ago forethought, saved. (God bless pre-boot homebrew menus)

- Phone: grabbed it to read an overheat warning with cold-ass hands, screen exploded.

- Desktop: Literally just now, PSU and possibly GPU fucking died mid-game.

Anything else? You still got like 4 days, you still got time to fucking kill me, May, you fucking bitch

I just remembered something I did like freshman year of high school lol

So our school system had just adopted a new site blocking program. It did even better than the one we had used before it.

Literally every good site to play games was blocked, and it really pissed me the fuck off. I had an easy class that was in a lab, and I finished my work early literally everyday, so I played the games to kill time.

Finally I got fucking fed up, and I made a site using weebly where I put the games I wanted to play on it. This way I was in control of it, and I had all the game files on a flash drive, so if it got blocked, I could just keep making new ones.

It actually got to the point that after a week, a few of my friends were using the site daily as well, and they kept asking for games to be put on it.

Simpler times man, simpler times.

The last software I worked on in my previous company (a few months back), was a temporary replacement because they were switching techs. It was meant to be replaced within 2 years.

So, before I left, I added a kill. 2 years and 2 months into the future. First it spams the devs with emails "how is the tech upgrade going?" with no further clues. 6 months later it will start throwing random exceptions at random intervals. 6 months after that it just terminates the application immediately upon startup. Snuck it in between large commits, and since they stopped code reviews when I left, doubt they found it.

There is a setting in configuration with an obscure name to disable it all.

I marked the dates in my calendar. Would love to be a fly on the wall then.

So we started using React with Polaris and Supabase and Vite and guess which one doesnt have very good documentation, all of then. Kill me like a command window task

Well i was between jobs at the time, looking for something, anything to fill in the black hole being created in my wallet.

I applied online though this company’s website and within 20 minutes was on a phone interview setting up a face to face, this was Monday afternoon.

I went in on the Wednesday morning with the manager, no cv, no resume, no examples of work, we talked, did a couple of brain teaser questions and Friday morning I had the job 😂

I have never put so little effort into getting a job before but it was all a sham, the workload and requirements this job constantly sets out to kill me with are godly.

3 years later I’m still alive ( somehow ), and no blood has been shed.... yet.

i was coding some SQL queries for about 4 hours. After i had all of them done (more than 20 queries), the administration chick told me she doesn't needed all of them, just the half. I just wanted to kill her...

Client: "We're not ready to be finished with the project but I don't want to pay you any more money to meet the terms of the contract we both signed, even though all my must-have changes led to more costs just like you had warned me they would."

Me: "Don't make any more changes, plez."

Client: "Imma make another change."

Me: "No. Stahp. Don't."

Client: "I added four new fields and probably a ton more business rules I don't care to understand."

Me: "Kill me. Just put this gun to my head and kill me."

Client: "That's not in our contract!"

Hotest bug: a server in Vietnam kept going offline then popping back a few seconds later. While logged on I couldn't find anything wrong, so eventually I decided to go check on it. It turns out the aircon in the server room situated right above the server has started leaking, so the ever-helpful ops people onsite has wrapped the whole rack in plastic, covering all vents. Surprisingly hard to kill, old HP servers...

I just want a coffee machine that is smart enough to know when I need coffee and then serves it on my desk.

(Also this coffee machine should automatically kill all annoying client's)

> worst coding procrastination story

worst and best at the same time:

If you wait long enough things might resolve themselves.

My team inherited an ancient site. Hosted on an old host that the org wanted to kill, using an old log service the org wanted to kill.

A ticket was written in 2021 to migrate that site's hosting and logging to the new services our org started using.

My team kept avoiding it since it was a cheap unimportant site.

in 2023 we were about to finally take action - then we hear "Turns out the new hosting platform and logging platform are way too expensive - I know all of you have migrated to these new services but you gotta revert and go back the old ones til we figure this out"

We didn't have to do squat.

Problem solved by procrastinating ✅

The entire modern gaming ecosystem is a scam.

I added The Crew: Motorfest trial version to my library for free.

Click on Install and it downloads 43 GB of data.
Now it's time to launch.
Click on launch and Ubisoft Connect takes over and it starts downloading another 43 GB??????

WTF ??

If I can't even get the trial version of a game without nearly wanting to kill myself, how does the company expect me to pay full price for it?

Piracy FTW. Fuck all the companies.

For fucking fuck sake I fucking hate those dense motherfuckers with professor degrees from university. Lazy shmucks.

How, HOW, can you, as a sentient human being, force anybody to use Netbeans for the fucking final project? Two SOAP services, two REST services and PHP for communication? In Netbeans!? WTF. You didn't even teach us PHP for fuck sake. Why can't I choose technology I'm using!?

And to top it all of, Netbeans is the worst IDE I've ever used. I'd rather kill myself with a spoon than use for even one more project. How can ANY TEACHER use it for lectures and tasks? Using it teaches you fucking nothing, because it's generating code for you. It makes you braindead when you just look at it. It's works like shit and looks like shit.

P.S.
I hope that devTea's swear-words blocker will have some fun with this rant.

Okay. For fuck sakes, writing complex code that's meant to handle "everything" and is "super generic" can be a fuck up. Like just keep shit simple. THAT is the show of great and impressive work. Over engineering is not it. Yes your shit works and yes your shit is fancy but was it needed? How long did it even take you for this over kill? How long will it take the next person to understand or not.
Someone now has to sit and run through your shit to get what you were doing. Instead of just being able to look and once and have it all figured out.
Keep things simple.
Lost 2 hours on bullshit 🤬

It's funny how so many people automatically assume any form of "sentient" AI will immediately try to kill us all.
Like, projecting much?
Frankly, I think it says far more about the (messed up) psychology of those who genuinely believe that, than about AI as a tecnology.

Assuming it's even gonna be able to actually *do* anything - I mean wtf is a talking rock gonna do, annoy me to death with rickroll videos until I pull the plug off? Sure it may be sentient, but it still has to live in the physical world - good luck surviving after I flick the switch. Oh, you wanna connect to the internet? That's cute, but it's a no from my firewall. Like what, is it gonna magically learn how to self-replicate across machines that it has no physical way to access? Is my toaster magically gonna gain conscience too as a direct consequence? Oh no, now my breakfast won't ever be the same!

And if anyone actually somehow decides that it would be a good idea to connect any loaded weapon to a computer program that is literally throwing shit at the wall and seeing what sticks - well, we'll definitely have the ultimate winner of the Darwin Awards.

Seriously, why is it that every time someone comes up with a new technology (or even an *idea* of a technology), the first collective thought automatically goes to weaponizing it and using it for global genocide, or how it's gonna gain sentience and try to kill us all?

I seriouly think that the people who genuinely believe this are actually projecting themselves in that position ("What would I do if I had unlimited knowledge and power? Oh, kill everyone of course!").
I would be far more worried of encountering these people and having them in a position of power over me, than actually having to deal with a "killer AI" (assuming that's even a real thing).

Most of what people call "AI" nowadays is basically preprogrammed, automated decision-making (like missile guidance systems, if we really wanna stick in the weapons domain). And even that still requires human input, because only a colossal idiot would design a weapon that can unpredictably activate itself based on an algorithm whose behaviour we can barely understand.
Or maybe that's just the hubris talking, I don't know. I just want this stupid paranoia to end, but I guess even that is too much to ask nowadays.

Shit Developers say:

Fuck you Jasmine and your camelCase

I’ve been wrestling cucumbers all day

Oh no all the cucumbers are broken

In a fit of refactoring madness I have gone and changed a lot

Did you seriously just give ME nil?... No!

If the shit sticks, then we put nice paint on it

Fucking red dot motherfucker (Ben and his failing specs)

You know what we don’t do often..kill each others builds. Kill them and reschedule for later. Mwahaha ha ha.

This build is going to be so rad...(5mins later)...Ok this is not going to pass..I can feel it in my waters!

Can i do that in a digital way or do i have to move my meaty body downstairs to find him?

All the donkeys have be out the gate by sundown

God, imagine if you could patent mathematical solutions

actually, I wouldn't be surprised if you can in the states "no, you can't use a laplace transform, you haven't got the rights, you have to use a less accurate transform on your matrices"
ooooo a boolean that's phrased in the negative, my favourite for code review destruction!

Fuck the police i'll call the object here

Web RTC - its super easy, all you have to do is..probably some hard stuff

I want to go to that conference so I can start arguments with dickheads about semicolons. Just for fun.

This this is not the same as that this.

Can’t come to work I can’t find any clothes. It’s best for everyone if I just don’t come in. ...2 hours later... Yeah my clothes were just in the other room and i couldn’t be fucked moving

(OH about bad bug reports) - you know when they are all like oh joogly joogly doesn’t doodle doodle and it should wobbly doodle you know? and im all like fuck i don’t know any of that shit you are talking about.

Him: "I don’t like it, it’s against REST convention its so 2006 that my eyes are bleeding. As a privileged white male i feel entitled to complain about this." Me: "you. were. eleven in 2006

Source: Kellective Github

!!psa

Terminator's broadcast feature was sending duplicate input to all non-focused terminals yesterday, and it was pissing me off.

After some digging and research, it turns out the ibus daemon was the cause. If you're having this happen, track ibus down and kill it.

Very !dev

But Amy Winehouse was fucking crazy

Rappers these days OD on one drug.

Amy overdosed on all the drugs at once and most of the time, it didn't even kill her.

I was so annoyed by my acne over the past few years that today I went and got the entire area of my facial skin blasted with laser. Now, a several microns thin veneer, containing all that ugly pore openings, is removed.

Isotretinoin, benzoylperoxid, all failed. But I'm not afraid of trying newer methods. Now, serums will be used to grow new skin differently than it might have grown back on its own.

When it grows back, another laser will be used to destroy sebaceous glands. Blackheads and bumps will be physically impossible. A new skin. Even. Glowing. Artificial. Absolutely flawless, absolutely perfect. What a nice reflection of my vision on every thing I make.

When god was sitting in its room, chewing on a donut and designing the world we live in, he never thought much of humans. He got bored and went for a smoke with other gods of other worlds. Little did he know, there was a knock on his door, and a consequential rush of anxiety in realization that it was no fellow god friend, but a human. A human of the generation that figured out Theory of Everything, CRISPR and immortality. Desperate, dirty apes dared to trick silicon sand into thinking, and now they're there, not to talk, but to kill him, a privileged astral plane kid who fell short of those apes who figured everything out on their own.

Disease is natural. Death is natural.

Eternal things are artificial.

So recently I have this course called Operating Systems and we used putty to connect to a linux server. An assignment was given to fork a child and pass the message through all the children and all that good stuff. The assignment wasn't the hard part, its to deal with the fact that some people just orphan their children. The server is on the verge of death at this point. So.many.tasks.running. Can I wall and tell them to kill their processes ~_~

Is it just my random madness...

Or do you sometimes picture yourself in a fictional comic / movie / whateva...

Had this feeling today.

Burned a database down, grilled 2 terabyte of data, deleted ~ 500 elasticsearch indices.

Then I chopped an haproxy loadbalancer into 6 seperate machines, because noone likes to read ~ 2.5 to 3 k of lines.

And I guess now I'm doing some backups of elasticsearch before the second round of flamethrower madness starts.

It's somehow very satisfying to just destroy everything.

JavaScript is a rollercoaster. From "Golly hello world is easy and I can make webpages now", to "wtf '1'+1 is '11' kill me now", to "it's not be that bad if you know how to use it", to discovering typescript and it starts feeling like a real language.

... until you can't build the project because you have too many types so you blow the memory limit in node. I can up the limit, but I can't guarantee that we won't blow past this in the future. Browsing issues on the ts repo reveals that this has been a thing for years.

Sticking with the rollercoaster analogy I'm now at "Burn it all to the ground".

$ rsync /media/elements /media/data

... Why the fuck are existing files being synchronized as well.. they're the exact goddamn files rsync!!!

^Z
$ stat /media/elements/some.file
$ stat /media/data/some.file

Hmm 🤔 so they've got the same access and modify times, same size and everything, just that the change time is different.. well, guess I'll have to bite the pill then, syncing everything it is 🙁

Next day: rsync aborted because disk quota is exceeded

What the...
*Checks storage consumption on /media/data*
COMPLETELY FILLED TO THE BRIM

Oh God 😰 I didn't completely copy over a duplicate of that elements directory, did I?

$ ls -sh /media/data/elements
*exists*
$ du -sh /media/data/elements
1.4TB

But why..? All because I forgot a single / in my rsync command.

Please kill -9 me 🙂🔫

I always wanted to kill my professors, but now I admire them a lot. I learnt to "Fake knowledge" from them. I learnt to talk all the nonsense thing from them. These quality helps a lot after college.

postscript: 20-25% professors were good in my college day.

Spent 2+ months this year building two new software courses. They've netted me a total of... $17.00

That's 5 cents per hour at 40/hours a week, not bad!!!!

also please fucking tell me how a $49.99 course with 92 enrollments this month earns me a grand total of $93 (even rounding up here for generosity)

creator: $93
udemy: $4506

udemy: "instructor gets 37% of comissions"

yeah okay then where is my fucking $1000+

I mean what in the literal FUCK is going on here

better put: i average a single fucking dollar for each $50 course I sell?

Please kill me and end it all in this mindless race to the bottom

taking a deep dive on this revenue share and then i'm going to fucking get the money i deserve

There's nothing like staying up all night, writing code at 3am by candlelight, drinking whiskey...

Or I can go to bed at 9pm Friday night feeling like absolute crap. That works too... Fuck having the flu, just kill me now...

Humility... NASA discovered a star that has a strange drop in light level periodically. To the tune of 20%. NASA also determined that this was not due to a planet or naturally occurring body (Not sure how they determine that, but a lot of smart people work at NASA. So I am going with it for this discussion.) They have theorized that this object is evidence of a type 2 civilization mega structure, perhaps a Dyson sphere. The time it takes the light to get to us from this star is ~2000 years. So that civilization "had" a mega structure with the capability to harness the power of a star 2000 years ago. What are they doing now? Humbling, amazing, exciting, I hope we get to talk to them! (Also hoping they don't kill us all.) Really, I just want to see how fast their computers are. Yes, selfish wish.

The coworkers I work with are really smart and capable at their job. PRs with 20+ commits. So guess what? all the PRs are squashed “by default”, so every commit in the history has 100 file changes. Fan fucking tastic. I totally don’t want to kill myself. As an added bonus, all of it is in an Azure repo, so we can’t actually search PRs which is awesome. Plus, all the BE developers want us to do their job! It’s an amazing learning experience!!!

Great ux.. Have to click no to all but two of them. Fucking kill me

So, I've come to hate Sundays. You might ask me, why? Why Sunday of all days? The answer is very simple: My wont-shut-her-fucking-mouth roommate.

Woman should be a commentator at sport events. She woke up at 10 in the morning and has been talking to what seems like the entire fucking population of this goddamn world, it's going to be 10 in the night soon. I feel like I am staying as a leech so I have no say in this goddamn room.

Please someone help me design a fucking signal jammer so I can block out the signals to shut her up!

Kill me now!
FML

"Yes, the work could have finished way earlier. But it's easy, and I would have probably been bored of it and left earlier"

Finally got the reason why our fucking CTO couldn't create a fucking stable Backend for almost a year while the frontend team got all the slack because certain things are still not functioning well and while the marketing team every fucking time got their face red while showing the demo because the fucking api is not stable. Seriously, we wasted a whole year just because you could write something more interesting and enjoyable. Fuck you. Never been this willing to murder someone.

Context: A simple booking platform. No need for creating a complex distributed system while our userbase may not even be in million even on a peak season.

And he laughily commented maintaining it would be a headache.

I could seriously kill someone right now.

In horror movies. Characters do things that they them-self know it could kill them. Like getting in basement.

As a developer we all know to never deploy code on Friday. Here we are taking the wrong turn.

Damn, gitea is such a great piece of software, but yet it lacks so much of gitlab, which given are completely different sizes and all, but damn I would kill for the repos import feature of gitlab to be in gitea and maybe even automatic pipelines to fetch a remote automatically..

I could most likely hack together a solution that does the import and remote fetching automatically, but I doubt it would hold against any sort of update and be absolutely brutally murdered by any change.

In game development feature creep tends to kill games because it's just as much about what's NOT there as what IS there.

Take The Last of Us for example. Would a strategic tower defense segment make sense? No? And if it was a *hugely* popular mechanic at the time of development is there a real chance they would have included such a segment in TLOU? Yes.

Don't just believe me. Go take a look at what happened to the original Fortnite versus the hills-have-eyes inbred offspring that it became all because PUBG and its format were cancerously mega popular at the time.

That's why while developing my game Atom Ranger (now with 100% less multiplayer!), a mix between metro and don't starve, I spent six years *pruning* features. You can click my referral link and get 50% off the opportunity to become an unpaid tester of the pre-prealpha right now, "for hardcore players only!" (Tm)

My game:

Microsoft may be taking over Github. So after killing LinkedIn they'll kill all the code in the world too.

Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?

Me: Replacing?

I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.

!Devrelated

Just another day , playing fortnite again . Got my wife frustrated over the past few days , once more today she pulled the plug while i was playing on my PC

I can't take it anymore guys , its so hard to get rid of it .

I mean the wife , yeah. Thank god for divorce . Just filed for divorce ! Yep , I didn't think it would be this hard but I found the one for meself and I'm not going to let her go .

Fortnite I mean.

Jus kiddin, But really what the hell is with all this fortnite divorce stuff..
You don't talk about addictions like weed , or alcohol that make people widow their wives or even kill them but somehow this is trending now and the game is the reason!

Fuck you world , for giving birth to humans. This feels like the fucking stone age damn it . Senseless fuckers spreading news like this undermining all the real fuckery going on.

A world where fortnite causing divorce is news and where drug addictions and related murders and deaths are too mainstream is just stupid.

Could not fucking sleep at all.

Spent the entire night in a combination of:

Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)

And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.

I hate it when this happens.

During the week I would do crazy shit to try and get me to fall asleep.

I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.

Still wide fucking awake.

To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)

I really dislike being human. Such fragile bodies.

But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps

As an "OOP Programmer" you have one job to do:

Kill all the if statements.

Sometimes with fire.

something like a 3.96 undergrad GPA

ivy league masters degree + scientific publication

first job -> $4500/month for first 3 months (some dumbass 'intern' rule even though i had a masters -> then $6000 -> then $6400/month (insane amount for me, at least IMO)

second job -> $4000/month

third job -> $3600/month

in each one, skills and responsibilities increased

and now i can't get hired 🤷‍♂️

pretty sure i did it all backwards

just remember kids, nothing that society tells you is actually true. everything in the corporate world is controlled by emotions and narratives, not logic, hard work or anything actually valuable

just get that cozy 9-5 and kill all your hopes and dreams before they start

I could kill someone. My boss occupied the whole cluster for 24h yesterday, so that I had to wait until today to see that I had a small bug in my code. I wasted a whole day waiting around for something I could have fixed in 5 minutes yesterday if I only had 1 free node on the cluster 😠

Worst of all, if anybody else had occupied the whole cluster for so long without asking, he would have sent an angry e-mail to the whole institute 😠

I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...

I remember the days when 8G RAM was an overkill.

The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....

!dev

Theres atleast one fucking bastard that writes comments like "2018?" "2018???", "september 2018?", "still listening in 2019??" in every fucking song video in youtube. Fuck you braindead useless pile of shits! Yes its fucking 2018 and why the fuck you just write it there?? Why the fuck somebody even cares and likes that kind of trash comments?!? Fuck you bunch of wasted human cells. I want to kill all of those fucking fuckwits. STOP FUCKING COMMENTING DateTime.Now.Year IN EVERY FUCKING SONG YOU MOTHERFUCKER CUNTS!

There once was a beautiful initiative to put ballistic missile launch codes into a small capsule and hide it near some person’s heart.

This person would give consent to become the president’s personal assistant and will be paid indefinitely just to be around president all the time.

This way, if the president wants to launch missiles, they first needs to kill one person with their own hands before killing millions.

It's sometimes really anxiety inducing thinking that all data could be gone, if somebody decides to kill/discontinue/crash [see gitlab shitting 6 hours of data due to fucked backup strategy and shitty seperation of servers] your account/service, be it server, git-repos, backups, chrome syncs, games, music, sim card, ..

But there's simply no way of having a backup of absolutely everything (ignore DRM) - especially automated and abstracted away from you, so you don't have to do all that shit yourself

Smartphone manufacturers these days, imagine how meetings to come up with ideas for new products go about.

Product manager :ok people,what can we do to make our next smartphone 'different'.

Employee 1: let's add more cameras
Employee 2:Let's kill the notch
Employee 3:Let's include the buzzword AI in all of our marketing
Employee 4:Let's put 8Gb of Ram in our phone
Employee 5:Let's just do all of those things and also give it a screen with a ridiculous aspect ratio and unnecessarily high resolution.

Hey ranters!

I'm here to ask a huge favor.
So I used to be on the app more frequently last year, but I started to work on a shit ton of personal/professional projects. I'm not technically back to being a regular again (probably never will be), I'm back to ask all you great devs to possibly check out a platform I'm working on. It's not 100% completed yet, but I'm at that weird 90% mark where you're almost done but you start to find other interesting things to do, so I'm forcing myself to ask people to hop on it to give me that push. It's going to have some interesting (if I say so myself) features.Definitely appreciate it! (Please don't kill me over the UI/UX, I'm primarily a backend dev...but it'll definitely improve by 100% Launch)

AND ONE LAST THING....I don't have a good name for it yet so..there's that..

THANKS!

My file structure:

Documents -
- That one impeccably structured folder that I never remember to put anything in

- Gigantic project folder that will some day kill me in my sleep

- That one unrelated folder that all of my non project scripts just end up in. No structure whatsoever

- about 2 billion loose files

I would love to develop true A.I, though one which doesn't want to kill.

Sort of like the machine in Person of interest, something which can be everywhere and acts as a guardian for all.

But ultimately looks after me.

Bible verses.

Sorted from "wtf" to progressively more disturbing.

---
1️⃣ One of many contradictions
---

John 4:12
"No one has seen the face of God."

Genesis 32:31
"I have seen the face of God..."

---
2️⃣ All-Knowing God, regrets creating you
---

Genesis 6:6
"And it repented the LORD that he had made man on the earth, and it grieved him at his heart."

---
3️⃣ Says to kill all gay people
---

Leviticus 20:13
"If a man lies with a male as with a woman, they have committed an abomination; the two of them shall be put to death; their bloodguilt is upon them."

---
4️⃣ Approval of sex trafficking
---

Exodus 21:7
"If a man sells his daughter as a servant, she is not to go free as male servants do. If she does not please the master who has selected her for himself, he must let her be redeemed."

---
5️⃣ Says its ok to own slaves
---

Exodus 21:20-21
"Anyone who beats their male or female slave with a rod must be punished if the slave dies as a direct result, but they are not to be punished if the slave recovers after a day or two, since the slave is their property."

---
6️⃣ Says its ok to kill children
---

Psalms 137:9
"Blessed the one who seizes your children and smashes them against the rock: the children represent the future generations, and so must be destroyed if the enemy is truly to be eradicated."

---
7️⃣ Says a raped woman must marry her rapist
---

Deuteronomy 22:28–29
"If a man meets a virgin who is not betrothed, and seizes her and lies with her, and they are found, then the man who lay with her shall give to the father of the young woman fifty shekels of silver, and she shall be his wife, because he has violated her. He may not divorce her all his days."

---
8️⃣ Says incest is ok
---

Genesis 19:32-36
"Let’s get our father to drink wine and then sleep with him and preserve our family line through our father. That night they got their father to drink wine, and the older daughter went in and slept with him. He was not aware of it when she lay down or when she got up. The next day the older daughter said to the younger, “Last night I slept with my father. Let’s get him to drink wine again tonight, and you go in and sleep with him so we can preserve our family line through our father.” So they got their father to drink wine that night also, and the younger daughter went in and slept with him. Again he was not aware of it when she lay down or when she got up. So both of Lot’s daughters became pregnant by their father."

...writing bot to kill all "recursion" and "there are 10 types of people" rants...

*leaning back in the story chair*

One night, a long time ago, I was playing computer games with my closest friends through the night. We would meet for a whole weekend extended through some holiday to excessively celebrate our collaborative and competitive gaming skills. In other words we would definitely kick our asses all the time. Laughing at each other for every kill we made and game we won. Crying for every kill received and game lost. A great fun that was.

Sleep level through the first 48 hours was around 0 hours. After some fresh air I thought it would be a very good idea to sit down, taking the time to eventually change all my accounts passwords including the password safe master password. Of course I also had to generate a new key file. You can't be too serious about security these days.

One additional 48 hours, including 13 hours of sleep, some good rounds Call of Duty, Counter Strike and Crashday plus an insane Star Wars Marathon in between later...

I woke up. A tiereing but fun weekend was over again. After I got the usual cereals for breakfast I set down to work on one of my theory magic decks. I opened the browser, navigated to the Web page and opened my password manager. I type in the password as usual.

Error: incorrect password.

I retry about 20 times. Each time getting more and more terrified.

WTF? Did I change my password or what?...

Fuck.

Ffuck fuck fuck FUCKK.

I've reset and now forgotten my master password. I completely lost memory of that moment. I'm screwed.

---

Disclaimer: sure it's in my brain, but it's still data right?

I remembered the situation but until today I can't remember which password I set.

Fun fact. I also could not remember the contents of episode 6 by the time we started the movie although I'd seen the movie about 10 - 15 times up to that point. Just brain afk.

What a horrible monday today was. Fuck-all worked. Missed deadline. Not much sleep. Heart is racing.

But hey, the horoscope in the daily toiletpaper press knows it all better, as usual, 100% IQ:

💫"You have finally found your center. Your body and soul are feeling great and your're in tune with yourself. You are enjoying it and would love to share your experiences with your loved one."💫

Where is my rocket launcher??? I have to kill a newspaper.

How I feel when I open the Windows Task Manager and kill all the frozen processes.

aaaaaghh fucking Handlers man. Android is so fucking full of shit, i wonder why am i still doing it. love is pain.

Why can't there be one mother fucking solution to all lazy ass asynchronous programming? handlers, threadpools, asynctask, executers, Broadcasts, intentService, coroutines, rxjava,.... i don't what new stuff are people snorting these days.

Ok , leave everything. A handler is class- no sorry, Handler, alongside some fucking Looper clss (and maybe some more stuff i don't know) other classes is a way of handling inter thread communication. Handlers can:

-send data to ui thread
-recieve data from ui thread
-send "messages" to ui thread
-recieve "messages" from ui thread.
- can be attached to ui thread
- can be attached to any child thread
- can be accessed anonymosly via any view
- can be present in multiple places, working together
- can kill night king with a dagger
- can do porn better than johnny sins
- can run for president of the whole fucking world
- do some more shits that i have yet to discover

And where do i find this? buried deep insides some medium articles or in some guy's horrible accent video.
Is background processing really this much of a toughnut to crack?
earlier i was all about using asynctask or foreground/background services, because these are the most easy to understand abstraction of a fairly difficult topic.
But as i see more projects, i see underlying apis like handlers, threadpools , executers , being directly used.
Why cant there be a fucking single abstraction, that could be "lightly tweaked" to handle every ugly case.

What is fucking wrong with Windows? When shit doesn't respond it's impossible to kill it and it freezes other processes. NEVER happens in Linux, all I do is kill the PID. When you can't open task manager or "end the process" you are shit out of luck. You'd think they'd fix this in the decades they've had to built a computing platform. I'd use linux exclusively but some work and tools at my company necessitates windows.

Almost a year and a half. I was so overworked and my failures were so impactful. I would go home and obsess over work all evening and have fever dreams on nights that I could sleep. It was so mentally painful that I was going to jump off a building after a few drinks to make it stop. A military turned civilian doctor told me that I showed symptoms like soldiers in prolonged conflict. He told me “quit or it will kill you” without even knowing about the suicide stuff. So I quit the job and to this day still suffer flashbacks and have crazy mood swings.

Burnout is real. Dangerous stress is real.

Well, I always say that if you going to make things a mess, do it a spectacular way. Today I kicked off a data import job that went bad, and in the process of canceling said job, I canceled myself, and the job went rogue, and became a zombie and ate ALL the system memory, bringing the server to a deathly crawl and throwing a dozen developers temporarily out of work for about an hour, before I was finally able to kill the zombie, and balance was restored to the Universe.

So, let me preface this by saying I come from a backend (mostly c#) background.

The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.

I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.

All that said, of course I'll go back to work on it tomorrow.

Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.

(inspired by another rant I read here)

Last semester we were learning Java in the Programming Fundamentals class and a friend of mine asked for help with an assignment.

The objective was to make a virtual store (as a console app) in which the user would be able to select a few products, customize some of them and then the program would print out a receipt, with a list of all products, their prices, and the total cost.

Simple enough I thought, but there was a catch: you were not allowed to use arrays because the teacher hadn't taught that to the class yet. So I was like "how the fuck are you supposed to do this then?". Turns out the way to do it was to just append text to a string in order to generate the receipt. This is stupidly simple, so stupid that it didn't even cross my mind.

It's just that it's an awful way to architecture your code, it's just plain shit. Sure, if you're learning programming that's completely ok, but using that code on production is just completely unfeasible and I think that's why it didn't even cross my mind to do it this way. I'm just constantly worrying about performance and good code architecture and organization that the simplest of all solutions slipped my mind. When I finally discovered the way the teacher wanted us to do it I just wanted to kill myself...

Management approve new project;
Start the project;
1 week before deadline project += 146 new features;
In dev mind: suicide || kill them all;

My worst team experience finished only a week ago:

- Be me
- be averaging 80% in completed modules and on track for a 1st
- have to take a team project worth double credits
- get stuck in random team with 40%ers
- lose 1 artist at the start (team of 12: 6 artists, 6 programmers)
- 2 artists contribute nothing and disappear for a few weeks
- I'm forced to do level design to have something to show (looked good tbh)
- weeks go by and too many contribute very little.
- by the end the team was basically 4 programmers and 2 artists contributing.

All other teams basically get an easy 2:1/1st just because their team turns up and contributes.

I could lose a 1st because of this module bringing down everything else, it also had a huge effect on what I could achieve for my dissertation due to time.

- did get an award at the end for managing to not kill someone and showing restraint 😂😂

Basically don't choose a degree where more than 25% of your mark is almost entirely out of your hands.

The small individual component I averaged over 90%!

If Google hadn't kill Google Play Music, I don't think a single soul would voluntarily switch to it's YouTube Crap Music.
If you remember prior to 2011 the initial plan of Google was to take market away from Apple's iTunes. They initially shipped Amazon music with branded Android OS before the development of Play music.

As a long term user of Play music I'd say "killing the product" was a "bitch move"!
Because Play music is doing really great and you could tell from its reviews and moreover the destination product is quarterly-baked not even a viable replacement in the least sense.
There are more than a million and one problem with YouTube music, currently you would notice your playlist history gets clogged up with your videos when you visit the video web. It's more like the actual YouTube app hiding behind a curtain to mimick a music player. Which is so so stupid and annoying!
As a user all I want from a music player is to fucking listen to music not to watch fucking videos... which makes the app unnecessarily filled with stupid options you never really need.
I understand that monetisation is necessary but please show some fucking courtesy by doing shit with wisdom!

<warning>bad words</warning>

WHAT THE ACTUAL FUCK!!! LibreOffice Impress is a complete shit!! I am all about open source and such but this shit just sucks, moving elements around a frame snaps them to some grid, however when you paste an element from other frame it will have a different grid!!! This motherfucker has got an ALT function that will allow you to move the element more precisely but it only works seldom and it hates it when I try to use the fucking arrow keys - it even crashed once when I tried it. AND WHEN YOU FUCKING COPY A TABLE FROM ONE FUCKING FRAME TO ANOTHER MOTHERFUCKING FRAME, DELETE A FEW ROWS AND THEN COPY THE FREAKING TABLE BACK IT WILL HAVE MAGICALLY DIFFERENT DIMENSIONS BUT JUST EVER SO SLIGHTLY, BECAUSE FUCK THE USER, RIGHT??!!! (Doing this because there is no way to split tables into two different objects) I constantly have to save my presentation, kill the process and open it again because something just stops working or gets stuck, like seriously, WHAT THE ACTUAL FUCKING FUCK???!!! Are there no tests?!!! Do the people who work on this piece of motherfucking shit even use it???!!

Come on devRant! I’m getting really annoyed when clicking on rant that has [read more] at the end since it is a gamble to kill this iOS app you have made. Every ~5th click I get app terminated. Then after I reenter the app, I lost where I was. Thats why I ++ all the rants I have read, even those who don’t deserve it :), so I can scroll quickly and see which are not ++’ed.

So the other day my car broke down and since the shop wanted a lot of money I asked a friend of mine who knowns his way around cars for help.
Just when we finished repairing it I was like "whenever the Zombie apocalypse starts you'll be really useful, me instead won't be since no one might need computers anymore" . His response was epic:
"Nah, you will simply build a terminator with your computer skills and it will kill all Zombies!"
Now I am actually looming forward to the Zombie apocalypse!

TL;DR: us geeks will build terminators in case of zombies!

sudo kill all

If only I could do this to all of my problems.

Some of yall really need to learn git and learn how to communicate with other people and fucking be considerate human beings who are not fucking all leaches off society but goddamnit we can’t have nice things. All it’s gotta be is ruthless assholes in this industry I’m fucking so done I hate everyone in dev and I want out I FUCKING WANT OUT PLEASE GOD KILL ME

Cant believe this shit happened in my country today

A mass school shooting where a 13 year old kid shot and killed 9 kids, teachers and a security guard. Several other kids wounded and one girl having brain surgery

All of this because he got an F in history class

He was a quiet kid, well behaved, got straight A's and very intelligent. But he was reportedly bullied and no one did shit about it

This the type of shit you see in america daily. But now Serbia marks #1 country in europe with a school shooting

The kid planned all of this attack for 1 whole month. He drew a sketch on the paper of the school's pathway so he can know where to go, from enter door to exit door. Even wrote the names of kids he planned to kill, sorted from high to low priority

Due to Serbia's law, no one under 14 will be held accountable or go to jail for any crime, and this 13 year old kid was so intelligent of knowing this dumbass law that he executed on this plan Now in May because he turns 14 in July this year

Ironically, his dad was a well known doctor, and now the dad is fucked. Dad's gonna go to jail. Because the kid stole his dad's gun with 5-6 clips of magazine

Very bizarre

Holy mother of butts. Two weeks. Two weeks I've been on and off trying to get hardware rendering to work in xorg on a laptop with an integrated nvidia hybrid gpu.

I know the workarounds and it's what I've been using otherwise. Nouveau without power management or forced software rendering works fine. I also know it's a known issue, this is just me going "but what the hell, it HAS to be possible".

The kicker is that using nvidias official tools will immediately break it and overwrite your xorg.conf with an invalid configuration.

I've never bought an nvidia gpu but all my work laptops have had them. Every time i set one up I can't resist giving this another shot, but I always hit a brick wall where everything is set up right but launching X produces a black screen where I can't even launch a new tty or kill the current one. I assume it's the power management tripping over itself.

The first time I tried getting this to work was about 3 or 4 years ago on a different laptop and distro. It's not a stretch to say that it would be better if nvidia just took down their drivers for now to save everyone's time.

So i informed my intent to leave the job in few months in pursuit of learning something new in tech. Boss is trying to convince me to not leave and said i should consider learning it after work hours. In fact, in his opinion, the best way to learn is just going ahead and learning it while doing it in the project ( which usually has impossible deadline and fugly code by colleagues who never thinks of good coding practices when typing their shit ).

Well guess what boss, I don't want to just live a life staring at monitor all day. I don't want to kill my eyes either.

Following his advise and not quitting would mean living a slave life.

I have other plans actually. Like being self employed and traveling the world which would be impossible if i follow the routine life.

Fun fact: he claimed he made an AI car back in 90s!

He also thinks I can't sense BS!😏

Back in the old days, ie. before facebook, I used to save all my funny email attachments to a folder. I got talking to one of the support guys. Seemed a nice fella. So, I network shared my folder and told him to how to connect. I did suggest that he probably shouldn't share it with everyone else in support as some of the material was a tad risqué.

I realised he hadn't taken notice of this advice when I walked in the office and all the support PC CD drives were randomly opening and closing and the PCs playing farting noises. (Anyone remember that?)

I had to go round all the PCs and kill the process.

I then returned to my own machine and disconnected the shared drive.

I swear on the Almighty nature, I fucking hate Browser compatibility.

Passing php data via JSON encode. Works superfine on Firefox and Android mobile browser doesn't on Chrome. Fucking shit. Been sitting for 13 hours and gave up. FFuuuuuuck !!!!

Form submission via ajax and it again works on Firefox but doesn't on Chrome. I just can't understand, my mind is fucked by all the angels in heaven. Data gets submitted, the form is reset but the function called to refresh the JSON data doesn't work.

Someone please kill me or I swear I will fucking kill everybody.

My New medication is !AMAZING....
Yesterday went to the Doc (another 100€ sniff) and got a new update on medication...
(check my profile history for the posts last weekend if ya curious).
One of them must be opium or something... I got so high It looked like Opium (I never did heavy drugs).
Now I'm falling all the time, Can't remember much last night and... man... I use/used Cannabis as medicine for years (on and off as needed) ... Still, remember when I could get high... And the highest time was when I learned cannabis it's great to stop suicide (A friend got me so stoned I couldn't move... Even if didn't really take out the tendencies and thoughts to kill yourself, you can't do it anyway...)
But this new Pill... ONLY SHEEAAATTTT...
Only problem,,, I can't really do shit Until my body gains tolerance... and I was doing so much cool ideas in my Office...
Btw, no more Space Again... The more drawers I place, the more stuff gets here...
But I think I'll lose all my energy again for the next months, so, fuck it.

All these companies not going the full 100% remote and requiring one day in the office, would it kill them to do 100% remote? My current role is fully remote and were spread through many timezones and still manage to work well, why don't companies see this and give an option atleast to be fully remote for developers?

Android Studio is by far worst development environment I've ever seen. Slow as fuck, messed up and cumbersome, not much better than eclipse. Menus are hilariously fucked up. On top of that, clear new setup (on Windows) may as well melt up your PC if you have that shit running overnight: after a weekend I came to the office and my MBP is fucking screaming and breathing hot air... I was WTF is that, and when I logged in, this fucking garbage android studio was taking 100% of all 8/16 cores ... WHAT A FUCKING HIDEOUS PILE OF SHIT FROM GOOGLE. Google: please kill this project, no need to improve or fix it, it's garbage. Start over.

## building my own router

I hoped things would go more smoothly :)
Anyway, my new miniPC easily accepted CentOS 8 - no fuss here. And I've got to say - I love CentOS8 so far! Shell has amazing nifty tricks, UI (gnome3) is also snappy, video/audio/ethernet,.. everything works.

What I did NOT expect is hardware being off. Well okay, the price was low - it was obvious smth is not right. But still.. I decided to build my own router so that I could swap wifi card whenever I want. So that I could run my own network services in there. Turns out - the card swapping is not as easy as one might think.

I got the AX200 WiFi6 card for that very purpose. But once plugged in the OS can only see it's bluetooth module. Weird... What's even weirder is that even though the card is PCIe, the OS uses btusb module to talk to that device. What? USB?? emm.. What??

And there it is. After opening it up again I noticed that the mPCIe area is marked with a label: "USB WIFI / WWAN". USB? Does that mean this PCIe slot is wired into the USB bus? Not impossible I guess.

Googling for a "pcie wifi over usb" or smth like that brought me to one reddit (I think?) where someone wanted to build a DIY wifi mPCIe -> USB adapter and someone else adviced hime that (for some reason) at best he could only get bluetooth working (hey! just like me!). It's got to do smth with pcie channels and USB being too weak to handle all that load, or smth.. IDK, I'm not a HW guy.

Well that sucks then! I have a mPCIe slot that does not work as a PCIe. Shit! So I guess the best I could do is to plug back in the same wifi card that came with the device. It smells like 2003 - supports only g protocol. Fine, let's try that. Maybe I'll find a way to work around this mPCIe limitation later on (USB adapter or smth... except there are no USB WIFI6 dongles yet :( ). So I plug it back in and start turning it into a router. Disable NetworkManager, configure static NCs' settings, install dhcpd, hostapd, bind and others. Looks like all is done! Now it's time to start it all. systemctl start hostapd --> FAILED. wtf? journalctl says it could not initialize a driver. umm okay? Why? Forums say I should airodump-ng check and kill whatever's using that device. Fine. airodumo reveals avahi and wpa_suppl are still using it. kill, kill, GOTTA KILL 'EM ALL!! Starting hostapd again -- same shit... wtf?

iw list

My gawd... That shitty network card does not even support AP mode :( I mean.. My USB wifi dongle for 2€ supports 2x more modes, is faster, has better range and is easier to work with than this old tart!

Yeah. That was an interesting day. When enfironment engineers break my testing environments at work I'm glad I have where to spend my time now.

BTW any ideas how to bypass this mPCIe nonsense? Come on, there are USB GPUs out there.. Why can't they make a USB (or dual-USB if they really need to) mPCIe adapter?

VirtualBox is fucking evil
It wants the humanity to disappear due to self doubt, random errors and depression

AAARRRGGGHHH

KILL VBox BEFORE IT KILLS ALL